[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF54728.1

[Show Plain Result]


## Summary of Sequence Search
    1::149
    1::149     6e-73 100%  149 aa  DUT_CORGB RecName: Full=Deoxyuridine 5'-triphosphate
    1::149     5e-72  99%  149 aa  DUT_CORGL RecName: Full=Deoxyuridine 5'-triphosphate
   37::177     4e-60  85%  181 aa  DUT_COREF RecName: Full=Deoxyuridine 5'-triphosphate
   10::154     2e-53  70%  155 aa  DUT_CORJK RecName: Full=Deoxyuridine 5'-triphosphate
   11::150     3e-49  66%  152 aa  DUT_CORDI RecName: Full=Deoxyuridine 5'-triphosphate
    1::120     7e-47  72%  164 aa  DUT_RHOE4 RecName: Full=Deoxyuridine 5'-triphosphate
    1::120     2e-45  68%  165 aa  DUT_NOCFA RecName: Full=Deoxyuridine 5'-triphosphate
    5::118     5e-44  71%  154 aa  DUT_MYCSK RecName: Full=Deoxyuridine 5'-triphosphate
    5::118     5e-44  71%  154 aa  DUT_MYCSJ RecName: Full=Deoxyuridine 5'-triphosphate
    5::118     5e-44  69%  154 aa  DUT_MYCS2 RecName: Full=Deoxyuridine 5'-triphosphate
    5::118     2e-43  69%  154 aa  DUT_MYCVP RecName: Full=Deoxyuridine 5'-triphosphate
    5::118     1e-42  68%  154 aa  DUT_MYCGI RecName: Full=Deoxyuridine 5'-triphosphate
    5::112     1e-40  70%  154 aa  DUT_MYCPA RecName: Full=Deoxyuridine 5'-triphosphate
    5::112     1e-40  70%  154 aa  DUT_MYCA1 RecName: Full=Deoxyuridine 5'-triphosphate
    5::112     1e-40  69%  154 aa  DUT_MYCMM RecName: Full=Deoxyuridine 5'-triphosphate
    5::112     2e-40  69%  154 aa  DUT_MYCUA RecName: Full=Deoxyuridine 5'-triphosphate
    5::112     2e-40  70%  154 aa  DUT_MYCTU RecName: Full=Deoxyuridine 5'-triphosphate
    5::112     2e-40  70%  154 aa  DUT_MYCTA RecName: Full=Deoxyuridine 5'-triphosphate
    5::112     2e-40  70%  154 aa  DUT_MYCBT RecName: Full=Deoxyuridine 5'-triphosphate
    5::112     2e-40  70%  154 aa  DUT_MYCBP RecName: Full=Deoxyuridine 5'-triphosphate
    5::112     2e-40  70%  154 aa  DUT_MYCBO RecName: Full=Deoxyuridine 5'-triphosphate
   19::144     5e-40  65%  179 aa  DUT_THEFY RecName: Full=Deoxyuridine 5'-triphosphate
    5::112     6e-40  67%  154 aa  DUT_MYCLE RecName: Full=Deoxyuridine 5'-triphosphate
    5::112     6e-40  67%  154 aa  DUT_MYCLB RecName: Full=Deoxyuridine 5'-triphosphate
   13::147     7e-36  51%  176 aa  DUT_STRGG RecName: Full=Deoxyuridine 5'-triphosphate
   15::155     9e-36  53%  158 aa  DUT_BIFLI RecName: Full=Deoxyuridine 5'-triphosphate
   15::155     4e-35  52%  158 aa  DUT_BIFLO RecName: Full=Deoxyuridine 5'-triphosphate
   15::155     4e-35  52%  158 aa  DUT_BIFLD RecName: Full=Deoxyuridine 5'-triphosphate
    8::147     2e-34  55%  183 aa  DUT_STRCO RecName: Full=Deoxyuridine 5'-triphosphate
   15::146     4e-34  53%  152 aa  DUT_PROAC RecName: Full=Deoxyuridine 5'-triphosphate
    4::147     7e-33  52%  175 aa  DUT_STRAW RecName: Full=Deoxyuridine 5'-triphosphate
    1::144     2e-30  49%  152 aa  DUT_LEIXX RecName: Full=Deoxyuridine 5'-triphosphate
   13::141     8e-30  50%  146 aa  DUT_TROWT RecName: Full=Deoxyuridine 5'-triphosphate
   13::141     8e-30  50%  146 aa  DUT_TROW8 RecName: Full=Deoxyuridine 5'-triphosphate
   17::147     8e-30  50%  147 aa  DUT_ANASK RecName: Full=Deoxyuridine 5'-triphosphate
   17::147     8e-30  50%  147 aa  DUT_ANADE RecName: Full=Deoxyuridine 5'-triphosphate
   17::147     8e-30  50%  147 aa  DUT_ANAD2 RecName: Full=Deoxyuridine 5'-triphosphate
    5::141     1e-29  47%  143 aa  DUT_CLOK5 RecName: Full=Deoxyuridine 5'-triphosphate
    9::152     2e-29  50%  153 aa  DUT_EHRCJ RecName: Full=Deoxyuridine 5'-triphosphate
    1::147     3e-29  45%  149 aa  DUT_NEOSM RecName: Full=Deoxyuridine 5'-triphosphate
    5::146     3e-29  50%  146 aa  DUT_GEOBB RecName: Full=Deoxyuridine 5'-triphosphate
    4::146     4e-29  50%  147 aa  DUT_DICTD RecName: Full=Deoxyuridine 5'-triphosphate
   10::153     8e-29  48%  153 aa  DUT_WOLPP RecName: Full=Deoxyuridine 5'-triphosphate
    8::149     8e-29  49%  149 aa  DUT_SPHWW RecName: Full=Deoxyuridine 5'-triphosphate
    4::144     8e-29  47%  148 aa  DUT_PELLD RecName: Full=Deoxyuridine 5'-triphosphate
    6::145     2e-28  44%  145 aa  DUT_CLOTE RecName: Full=Deoxyuridine 5'-triphosphate
    5::146     3e-28  49%  146 aa  DUT_GEOSM RecName: Full=Deoxyuridine 5'-triphosphate
    6::148     3e-28  55%  150 aa  DUT_AQUAE RecName: Full=Deoxyuridine 5'-triphosphate
    8::149     9e-28  48%  149 aa  DUT_GEOSF RecName: Full=Deoxyuridine 5'-triphosphate
    3::150     2e-27  47%  151 aa  DUT_GLUOX RecName: Full=Deoxyuridine 5'-triphosphate
    3::141     3e-27  44%  143 aa  DUT_ACAM1 RecName: Full=Deoxyuridine 5'-triphosphate
    5::147     4e-27  45%  148 aa  DUT_THETN RecName: Full=Deoxyuridine 5'-triphosphate
    1::146     4e-27  47%  147 aa  DUT_DICT6 RecName: Full=Deoxyuridine 5'-triphosphate
    6::146     5e-27  46%  147 aa  DUT_PELCD RecName: Full=Deoxyuridine 5'-triphosphate
   13::156     6e-27  46%  156 aa  DUT_WOLTR RecName: Full=Deoxyuridine 5'-triphosphate
   10::153     6e-27  46%  153 aa  DUT_WOLPM RecName: Full=Deoxyuridine 5'-triphosphate
   10::153     8e-27  47%  153 aa  DUT_WOLWR RecName: Full=Deoxyuridine 5'-triphosphate
    1::152     8e-27  47%  152 aa  DUT_RHOPS RecName: Full=Deoxyuridine 5'-triphosphate
   17::150     1e-26  47%  150 aa  DUT_SYNAS RecName: Full=Deoxyuridine 5'-triphosphate
    4::146     1e-26  48%  147 aa  DUT_ANAMM RecName: Full=Deoxyuridine 5'-triphosphate
    4::146     1e-26  48%  147 aa  DUT_ANAMF RecName: Full=Deoxyuridine 5'-triphosphate
    1::152     1e-26  47%  152 aa  DUT_OLICO RecName: Full=Deoxyuridine 5'-triphosphate
   18::152     1e-26  48%  152 aa  DUT_NITWN RecName: Full=Deoxyuridine 5'-triphosphate
   17::118     1e-26  55%  147 aa  DUT_ANADF RecName: Full=Deoxyuridine 5'-triphosphate
   12::144     2e-26  45%  145 aa  DUT_SYNWW RecName: Full=Deoxyuridine 5'-triphosphate
    4::144     2e-26  45%  145 aa  DUT_PROA2 RecName: Full=Deoxyuridine 5'-triphosphate
    6::155     2e-26  45%  156 aa  DUT_RHIL3 RecName: Full=Deoxyuridine 5'-triphosphate
   16::145     3e-26  46%  146 aa  DUT_ZYMMO RecName: Full=Deoxyuridine 5'-triphosphate
    1::152     3e-26  47%  152 aa  DUT_RHOP2 RecName: Full=Deoxyuridine 5'-triphosphate
    1::147     3e-26  48%  154 aa  DUT_ACICJ RecName: Full=Deoxyuridine 5'-triphosphate
    5::142     4e-26  54%  144 aa  DUT_HYDS0 RecName: Full=Deoxyuridine 5'-triphosphate
    5::147     5e-26  44%  148 aa  DUT_THEPX RecName: Full=Deoxyuridine 5'-triphosphate
    5::147     5e-26  44%  148 aa  DUT_THEP3 RecName: Full=Deoxyuridine 5'-triphosphate
    3::147     5e-26  46%  150 aa  DUT_RICBR RecName: Full=Deoxyuridine 5'-triphosphate
    3::147     5e-26  46%  150 aa  DUT_RICB8 RecName: Full=Deoxyuridine 5'-triphosphate
    2::147     5e-26  44%  148 aa  DUT_RICAH RecName: Full=Deoxyuridine 5'-triphosphate
   18::147     7e-26  49%  148 aa  DUT_RICTY RecName: Full=Deoxyuridine 5'-triphosphate
    6::147     7e-26  47%  148 aa  DUT_RICPR RecName: Full=Deoxyuridine 5'-triphosphate
    3::141     9e-26  41%  142 aa  DUT_TRIEI RecName: Full=Deoxyuridine 5'-triphosphate
    3::147     9e-26  45%  148 aa  DUT_RICFE RecName: Full=Deoxyuridine 5'-triphosphate
   11::155     9e-26  45%  156 aa  DUT_RHIEC RecName: Full=Deoxyuridine 5'-triphosphate
    3::143     1e-25  45%  144 aa  DUT_PORGI RecName: Full=Deoxyuridine 5'-triphosphate
    3::143     1e-25  45%  144 aa  DUT_PORG3 RecName: Full=Deoxyuridine 5'-triphosphate
    5::141     1e-25  50%  142 aa  DUT_CLONN RecName: Full=Deoxyuridine 5'-triphosphate
    4::142     1e-25  38%  143 aa  DUT_CLODI RecName: Full=Deoxyuridine 5'-triphosphate
    4::142     1e-25  38%  143 aa  DUT_CLOD6 RecName: Full=Deoxyuridine 5'-triphosphate
    3::147     1e-25  45%  148 aa  DUT_RICM5 RecName: Full=Deoxyuridine 5'-triphosphate
    5::155     1e-25  44%  156 aa  DUT_AGRRK RecName: Full=Deoxyuridine 5'-triphosphate
   18::147     2e-25  48%  148 aa  DUT_RICCK RecName: Full=Deoxyuridine 5'-triphosphate
    1::122     2e-25  53%  151 aa  DUT_RHOCS RecName: Full=Deoxyuridine 5'-triphosphate
    4::142     2e-25  51%  145 aa  DUT_CLOAB RecName: Full=Deoxyuridine 5'-triphosphate
    4::144     2e-25  45%  150 aa  DUT_CHLP8 RecName: Full=Deoxyuridine 5'-triphosphate
   11::155     3e-25  45%  156 aa  DUT_RHIE6 RecName: Full=Deoxyuridine 5'-triphosphate
    4::144     3e-25  52%  148 aa  DUT_PROVI RecName: Full=Deoxyuridine 5'-triphosphate
   27::145     3e-25  49%  158 aa  DUT_HELHP RecName: Full=Deoxyuridine 5'-triphosphate
   13::142     3e-25  47%  144 aa  DUT_FLAJ1 RecName: Full=Deoxyuridine 5'-triphosphate
    6::155     3e-25  45%  156 aa  DUT_RHILW RecName: Full=Deoxyuridine 5'-triphosphate
   13::149     4e-25  47%  150 aa  DUT_DESPS RecName: Full=Deoxyuridine 5'-triphosphate
    1::123     6e-25  51%  155 aa  DUT_PARL1 RecName: Full=Deoxyuridine 5'-triphosphate
   20::159     6e-25  44%  160 aa  DUT_DEBHA RecName: Full=Deoxyuridine 5'-triphosphate
   20::154     6e-25  49%  155 aa  DUT_CAUCR RecName: Full=Deoxyuridine 5'-triphosphate
   20::154     6e-25  49%  155 aa  DUT_CAUCN RecName: Full=Deoxyuridine 5'-triphosphate
    3::147     7e-25  44%  148 aa  DUT_RICRS RecName: Full=Deoxyuridine 5'-triphosphate
    3::147     7e-25  44%  148 aa  DUT_RICRO RecName: Full=Deoxyuridine 5'-triphosphate
    3::147     7e-25  44%  148 aa  DUT_RICCN RecName: Full=Deoxyuridine 5'-triphosphate
    3::147     7e-25  44%  148 aa  DUT_RICAE RecName: Full=Deoxyuridine 5'-triphosphate
    2::114     7e-25  54%  147 aa  DUT_GLOVI RecName: Full=Deoxyuridine 5'-triphosphate
    3::143     1e-24  44%  144 aa  DUT_BACV8 RecName: Full=Deoxyuridine 5'-triphosphate
    4::147     1e-24  44%  152 aa  DUT_CHLTE RecName: Full=Deoxyuridine 5'-triphosphate
    4::144     1e-24  44%  149 aa  DUT_CHLCH RecName: Full=Deoxyuridine 5'-triphosphate
    3::142     2e-24  48%  142 aa  DUT_NAUPA RecName: Full=Deoxyuridine 5'-triphosphate
    3::113     2e-24  48%  145 aa  DUT_CYAP7 RecName: Full=Deoxyuridine 5'-triphosphate
    4::142     2e-24  42%  144 aa  DUT_ALKMQ RecName: Full=Deoxyuridine 5'-triphosphate
    5::153     2e-24  44%  155 aa  DUT_RHOSK RecName: Full=Deoxyuridine 5'-triphosphate
    3::142     2e-24  41%  143 aa  DUT_FINM2 RecName: Full=Deoxyuridine 5'-triphosphate
    4::147     2e-24  41%  153 aa  DUT_CHLL2 RecName: Full=Deoxyuridine 5'-triphosphate
    3::146     4e-24  44%  148 aa  DUT_RICPU RecName: Full=Deoxyuridine 5'-triphosphate
    5::149     4e-24  41%  149 aa  DUT_GEOSL RecName: Full=Deoxyuridine 5'-triphosphate
   14::154     4e-24  45%  154 aa  DUT_CYTH3 RecName: Full=Deoxyuridine 5'-triphosphate
    1::144     4e-24  41%  145 aa  DUT_CHLPB RecName: Full=Deoxyuridine 5'-triphosphate
   13::155     4e-24  45%  157 aa  DUT_BRUSU RecName: Full=Deoxyuridine 5'-triphosphate
   13::155     4e-24  45%  157 aa  DUT_BRUSI RecName: Full=Deoxyuridine 5'-triphosphate
   13::155     4e-24  45%  157 aa  DUT_BRUME RecName: Full=Deoxyuridine 5'-triphosphate
   13::155     4e-24  45%  157 aa  DUT_BRUMB RecName: Full=Deoxyuridine 5'-triphosphate
   13::155     4e-24  45%  157 aa  DUT_BRUC2 RecName: Full=Deoxyuridine 5'-triphosphate
   13::155     4e-24  45%  157 aa  DUT_BRUAB RecName: Full=Deoxyuridine 5'-triphosphate
   13::155     4e-24  45%  157 aa  DUT_BRUA2 RecName: Full=Deoxyuridine 5'-triphosphate
   13::155     4e-24  45%  157 aa  DUT_BRUA1 RecName: Full=Deoxyuridine 5'-triphosphate
    5::153     5e-24  44%  155 aa  DUT_RHOS4 RecName: Full=Deoxyuridine 5'-triphosphate
   15::148     5e-24  42%  148 aa  DUT_GEOMG RecName: Full=Deoxyuridine 5'-triphosphate
   18::152     5e-24  56%  152 aa  DUT_BRAJA RecName: Full=Deoxyuridine 5'-triphosphate
   26::130     6e-24  53%  161 aa  DUT_RHILO RecName: Full=Deoxyuridine 5'-triphosphate
    4::144     6e-24  42%  153 aa  DUT_CHLPD RecName: Full=Deoxyuridine 5'-triphosphate
    7::147     8e-24  41%  147 aa  DUT_SOLUE RecName: Full=Deoxyuridine 5'-triphosphate
    7::146     8e-24  41%  148 aa  DUT_ORITI RecName: Full=Deoxyuridine 5'-triphosphate
   43::155     8e-24  49%  160 aa  DUT_BEII9 RecName: Full=Deoxyuridine 5'-triphosphate
    5::122     1e-23  54%  152 aa  DUT_MARMM RecName: Full=Deoxyuridine 5'-triphosphate
    4::118     1e-23  49%  148 aa  DUT_PELPB RecName: Full=Deoxyuridine 5'-triphosphate
   11::155     1e-23  53%  156 aa  DUT_AGRT5 RecName: Full=Deoxyuridine 5'-triphosphate
    3::113     2e-23  44%  142 aa  DUT_SYNP2 RecName: Full=Deoxyuridine 5'-triphosphate
    7::146     2e-23  41%  148 aa  DUT_ORITB RecName: Full=Deoxyuridine 5'-triphosphate
   48::152     2e-23  51%  152 aa  DUT_BRASO RecName: Full=Deoxyuridine 5'-triphosphate
    8::152     3e-23  45%  157 aa  DUT_AZOC5 RecName: Full=Deoxyuridine 5'-triphosphate
   52::152     7e-23  50%  152 aa  DUT_RHOPB RecName: Full=Deoxyuridine 5'-triphosphate
   18::123     7e-23  53%  152 aa  DUT_NITHX RecName: Full=Deoxyuridine 5'-triphosphate
    3::116     9e-23  49%  144 aa  DUT_BACTN RecName: Full=Deoxyuridine 5'-triphosphate
    5::139     2e-22  41%  140 aa  DUT_SCHPO RecName: Full=Probable deoxyuridine 5'-triphosphate
   19::141     2e-22  43%  142 aa  DUT_CYAA5 RecName: Full=Deoxyuridine 5'-triphosphate
    9::130     3e-22  49%  160 aa  DUT_SINMW RecName: Full=Deoxyuridine 5'-triphosphate
   18::123     3e-22  57%  152 aa  DUT_RHOPT RecName: Full=Deoxyuridine 5'-triphosphate
   18::123     3e-22  57%  152 aa  DUT_RHOPA RecName: Full=Deoxyuridine 5'-triphosphate
    6::146     3e-22  40%  146 aa  DUT_FUSNN RecName: Full=Deoxyuridine 5'-triphosphate
    6::148     3e-22  41%  149 aa  DUT_BDEBA RecName: Full=Deoxyuridine 5'-triphosphate
    9::149     3e-22  39%  149 aa  DUT_WOLSU RecName: Full=Deoxyuridine 5'-triphosphate
  114::251     3e-22  41%  252 aa  DUT_HUMAN RecName: Full=Deoxyuridine 5'-triphosphate
   15::144     4e-22  43%  146 aa  DUT_TREPS RecName: Full=Deoxyuridine 5'-triphosphate
   15::144     4e-22  43%  146 aa  DUT_TREPA RecName: Full=Deoxyuridine 5'-triphosphate
    7::151     8e-22  43%  153 aa  DUT_HALHL RecName: Full=Deoxyuridine 5'-triphosphate
    3::116     8e-22  48%  144 aa  DUT_BACFR RecName: Full=Deoxyuridine 5'-triphosphate
    3::116     8e-22  48%  144 aa  DUT_BACFN RecName: Full=Deoxyuridine 5'-triphosphate
   14::130     1e-21  49%  160 aa  DUT_RHIME RecName: Full=Deoxyuridine 5'-triphosphate
   31::182     2e-21  46%  184 aa  DUT_BARHE RecName: Full=Deoxyuridine 5'-triphosphate
   63::204     2e-21  39%  205 aa  DUT_RAT RecName: Full=Deoxyuridine 5'-triphosphate
    3::158     3e-21  52%  163 aa  DUT_HELMI RecName: Full=Deoxyuridine 5'-triphosphate
    3::115     3e-21  47%  145 aa  DUT_HELAH RecName: Full=Deoxyuridine 5'-triphosphate
    6::144     3e-21  41%  145 aa  DUT_CHLTR RecName: Full=Deoxyuridine 5'-triphosphate
    6::144     3e-21  41%  145 aa  DUT_CHLTB RecName: Full=Deoxyuridine 5'-triphosphate
    6::144     3e-21  41%  145 aa  DUT_CHLTA RecName: Full=Deoxyuridine 5'-triphosphate
    6::144     3e-21  41%  145 aa  DUT_CHLT2 RecName: Full=Deoxyuridine 5'-triphosphate
   30::158     4e-21  45%  159 aa  DUT_CANAL RecName: Full=Deoxyuridine 5'-triphosphate
    1::121     5e-21  42%  151 aa  DUT_SILPO RecName: Full=Deoxyuridine 5'-triphosphate
    6::144     5e-21  41%  145 aa  DUT_CHLMU RecName: Full=Deoxyuridine 5'-triphosphate
    3::115     8e-21  45%  145 aa  DUT_HELPJ RecName: Full=Deoxyuridine 5'-triphosphate
    7::143     1e-20  43%  145 aa  DUT_CHLPN RecName: Full=Deoxyuridine 5'-triphosphate
   29::134     1e-20  50%  177 aa  DUT_BARBK RecName: Full=Deoxyuridine 5'-triphosphate
   15::122     1e-20  47%  152 aa  DUT_ROSDO RecName: Full=Deoxyuridine 5'-triphosphate
    8::120     1e-20  52%  151 aa  DUT_DESHY RecName: Full=Deoxyuridine 5'-triphosphate
    8::120     1e-20  52%  151 aa  DUT_DESHD RecName: Full=Deoxyuridine 5'-triphosphate
   13::142     2e-20  44%  144 aa  DUT_TREDE RecName: Full=Deoxyuridine 5'-triphosphate
    3::115     2e-20  44%  145 aa  DUT_HELPH RecName: Full=Deoxyuridine 5'-triphosphate
    3::115     2e-20  44%  145 aa  DUT_HELP2 RecName: Full=Deoxyuridine 5'-triphosphate
    3::115     3e-20  44%  145 aa  DUT_HELPY RecName: Full=Deoxyuridine 5'-triphosphate
    3::115     3e-20  44%  145 aa  DUT_HELPS RecName: Full=Deoxyuridine 5'-triphosphate
   12::151     4e-20  38%  163 aa  DUT_ADEG8 RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     5e-20  39%  151 aa  DUT_ACTPJ RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     5e-20  39%  151 aa  DUT_ACTP7 RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     5e-20  39%  151 aa  DUT_ACTP2 RecName: Full=Deoxyuridine 5'-triphosphate
   12::151     7e-20  39%  151 aa  DUT_IDILO RecName: Full=Deoxyuridine 5'-triphosphate
   33::168     9e-20  38%  169 aa  DUT_SOLLC RecName: Full=Deoxyuridine 5'-triphosphate
   45::123     9e-20  53%  160 aa  DUT_METSB RecName: Full=Deoxyuridine 5'-triphosphate
    4::144     1e-19  40%  145 aa  DUT_LEPBL RecName: Full=Deoxyuridine 5'-triphosphate
    4::144     1e-19  40%  145 aa  DUT_LEPBJ RecName: Full=Deoxyuridine 5'-triphosphate
   31::146     1e-19  46%  185 aa  DUT_BARQU RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     2e-19  39%  151 aa  DUT_PROMH RecName: Full=Deoxyuridine 5'-triphosphate
    5::144     2e-19  40%  145 aa  DUT_LEPIN RecName: Full=Deoxyuridine 5'-triphosphate
    5::144     2e-19  40%  145 aa  DUT_LEPIC RecName: Full=Deoxyuridine 5'-triphosphate
    1::114     3e-19  40%  141 aa  DUT_PBCV1 RecName: Full=Deoxyuridine 5'-triphosphate
   25::161     4e-19  39%  178 aa  DUT_ADEG1 RecName: Full=Deoxyuridine 5'-triphosphate
   14::150     5e-19  36%  150 aa  DUT_PARUW RecName: Full=Deoxyuridine 5'-triphosphate
    8::116     5e-19  47%  147 aa  DUT_CHLT3 RecName: Full=Deoxyuridine 5'-triphosphate
   11::149     5e-19  50%  150 aa  DUT_ACIBY RecName: Full=Deoxyuridine 5'-triphosphate
   11::149     5e-19  50%  150 aa  DUT_ACIBT RecName: Full=Deoxyuridine 5'-triphosphate
   11::149     5e-19  50%  150 aa  DUT_ACIBS RecName: Full=Deoxyuridine 5'-triphosphate
   11::149     5e-19  50%  150 aa  DUT_ACIBC RecName: Full=Deoxyuridine 5'-triphosphate
   11::149     5e-19  50%  150 aa  DUT_ACIB5 RecName: Full=Deoxyuridine 5'-triphosphate
   11::149     5e-19  50%  150 aa  DUT_ACIB3 RecName: Full=Deoxyuridine 5'-triphosphate
   12::152     6e-19  47%  153 aa  DUT_ASHGO RecName: Full=Deoxyuridine 5'-triphosphate
   17::128     8e-19  40%  165 aa  DUT_NEUCR RecName: Full=Deoxyuridine 5'-triphosphate
    1::151     8e-19  40%  152 aa  DUT_COXBN RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     1e-18  38%  151 aa  DUT_PSYIN RecName: Full=Deoxyuridine 5'-triphosphate
    3::141     1e-18  37%  157 aa  DUT_YARLI RecName: Full=Deoxyuridine 5'-triphosphate
   12::149     1e-18  39%  151 aa  DUT_PSEAE RecName: Full=Deoxyuridine 5'-triphosphate
   12::149     1e-18  39%  151 aa  DUT_PSEA8 RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     1e-18  38%  151 aa  DUT_HAES2 RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     1e-18  38%  151 aa  DUT_HAES1 RecName: Full=Deoxyuridine 5'-triphosphate
   13::150     2e-18  39%  152 aa  DUT_SHEON RecName: Full=Deoxyuridine 5'-triphosphate
   12::149     2e-18  39%  151 aa  DUT_PSEAB RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     2e-18  39%  151 aa  DUT_NITOC RecName: Full=Deoxyuridine 5'-triphosphate
    1::151     2e-18  40%  152 aa  DUT_COXBU RecName: Full=Deoxyuridine 5'-triphosphate
    1::151     2e-18  40%  152 aa  DUT_COXBR RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     2e-18  37%  151 aa  DUT_ACTSZ RecName: Full=Deoxyuridine 5'-triphosphate
   12::149     2e-18  38%  151 aa  DUT_PSEE4 RecName: Full=Deoxyuridine 5'-triphosphate
   12::149     2e-18  39%  151 aa  DUT_PSEA7 RecName: Full=Deoxyuridine 5'-triphosphate
    9::147     2e-18  36%  148 aa  DUT_KLULA RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     2e-18  38%  152 aa  DUT_HAEDU RecName: Full=Deoxyuridine 5'-triphosphate
    7::146     2e-18  39%  147 aa  DUT_CHLFF RecName: Full=Deoxyuridine 5'-triphosphate
    9::146     3e-18  36%  147 aa  DUT_YEAST RecName: Full=Deoxyuridine 5'-triphosphate
   12::149     3e-18  39%  151 aa  DUT_PSEMY RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     3e-18  38%  151 aa  DUT_HAEIN RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     3e-18  38%  151 aa  DUT_HAEIG RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     3e-18  38%  151 aa  DUT_HAEIE RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     3e-18  38%  151 aa  DUT_HAEI8 RecName: Full=Deoxyuridine 5'-triphosphate
   26::144     3e-18  42%  144 aa  DUT_CANGA RecName: Full=Deoxyuridine 5'-triphosphate
   13::150     4e-18  38%  152 aa  DUT_SHESM RecName: Full=Deoxyuridine 5'-triphosphate
   13::150     4e-18  38%  152 aa  DUT_SHESA RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     4e-18  38%  151 aa  DUT_PASMU RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     4e-18  38%  151 aa  DUT_METCA RecName: Full=Deoxyuridine 5'-triphosphate
    4::146     4e-18  39%  147 aa  DUT_CHLCV RecName: Full=Deoxyuridine 5'-triphosphate
    5::141     5e-18  35%  142 aa  DUT_SWPVK RecName: Full=Deoxyuridine 5'-triphosphate
   13::150     5e-18  38%  152 aa  DUT_SHESW RecName: Full=Deoxyuridine 5'-triphosphate
   13::150     5e-18  38%  152 aa  DUT_SHEPC RecName: Full=Deoxyuridine 5'-triphosphate
   13::150     7e-18  38%  152 aa  DUT_SHEB5 RecName: Full=Deoxyuridine 5'-triphosphate
   39::174     7e-18  35%  179 aa  DUT_DICDI RecName: Full=Deoxyuridine 5'-triphosphate
    6::146     7e-18  41%  149 aa  DUT_BLOPB RecName: Full=Deoxyuridine 5'-triphosphate
   13::150     9e-18  38%  152 aa  DUT_SHEB9 RecName: Full=Deoxyuridine 5'-triphosphate
   13::150     9e-18  38%  152 aa  DUT_SHEB8 RecName: Full=Deoxyuridine 5'-triphosphate
   13::150     9e-18  38%  152 aa  DUT_SHEB2 RecName: Full=Deoxyuridine 5'-triphosphate
   12::149     9e-18  38%  151 aa  DUT_PSEPW RecName: Full=Deoxyuridine 5'-triphosphate
   13::150     9e-18  39%  152 aa  DUT_HAHCH RecName: Full=Deoxyuridine 5'-triphosphate
   48::152     9e-18  57%  152 aa  DUT_BRASB RecName: Full=Deoxyuridine 5'-triphosphate
   11::149     9e-18  36%  150 aa  DUT_ALCBS RecName: Full=Deoxyuridine 5'-triphosphate
   13::150     1e-17  38%  152 aa  DUT_SHESR RecName: Full=Deoxyuridine 5'-triphosphate
   13::150     1e-17  39%  152 aa  DUT_SHEHH RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     1e-17  37%  151 aa  DUT_MANSM RecName: Full=Deoxyuridine 5'-triphosphate
    8::145     1e-17  36%  147 aa  DUT_VACCP RecName: Full=Deoxyuridine 5'-triphosphate
    8::145     1e-17  36%  147 aa  DUT_VACCC RecName: Full=Deoxyuridine 5'-triphosphate
    8::145     1e-17  36%  147 aa  DUT_VACCA RecName: Full=Deoxyuridine 5'-triphosphate
   13::150     1e-17  39%  152 aa  DUT_SHEPA RecName: Full=Deoxyuridine 5'-triphosphate
   13::150     2e-17  37%  152 aa  DUT_SHEWM RecName: Full=Deoxyuridine 5'-triphosphate
   12::149     2e-17  38%  151 aa  DUT_PSEPG RecName: Full=Deoxyuridine 5'-triphosphate
    4::146     2e-17  38%  147 aa  DUT_CHLAB RecName: Full=Deoxyuridine 5'-triphosphate
    3::145     3e-17  39%  146 aa  DUT_THIDA RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     3e-17  35%  152 aa  DUT_SERP5 RecName: Full=Deoxyuridine 5'-triphosphate
   12::149     3e-17  37%  151 aa  DUT_PSEPK RecName: Full=Deoxyuridine 5'-triphosphate
   18::148     3e-17  43%  150 aa  DUT_NEIG2 RecName: Full=Deoxyuridine 5'-triphosphate
   11::149     3e-17  37%  150 aa  DUT_ACIAD RecName: Full=Deoxyuridine 5'-triphosphate
    4::143     3e-17  34%  145 aa  DUT_FOWPV RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     4e-17  39%  153 aa  DUT_THICR RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     4e-17  35%  151 aa  DUT_SHISS RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     4e-17  35%  151 aa  DUT_SHIDS RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     4e-17  35%  151 aa  DUT_SHIBS RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     4e-17  35%  151 aa  DUT_SHIB3 RecName: Full=Deoxyuridine 5'-triphosphate
   13::150     4e-17  36%  152 aa  DUT_SHEDO RecName: Full=Deoxyuridine 5'-triphosphate
   13::150     4e-17  36%  152 aa  DUT_SHEAM RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     4e-17  36%  152 aa  DUT_PHOLL RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     4e-17  35%  151 aa  DUT_ESCF3 RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     4e-17  35%  152 aa  DUT_ECOUT RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     4e-17  35%  152 aa  DUT_ECOSM RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     4e-17  35%  152 aa  DUT_ECOSE RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     4e-17  35%  151 aa  DUT_ECOLU RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     4e-17  35%  152 aa  DUT_ECOLC RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     4e-17  35%  151 aa  DUT_ECOL6 RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     4e-17  35%  152 aa  DUT_ECOL5 RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     4e-17  35%  152 aa  DUT_ECOK1 RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     4e-17  35%  151 aa  DUT_ECOHS RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     4e-17  35%  151 aa  DUT_ECO8A RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     4e-17  35%  151 aa  DUT_ECO81 RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     4e-17  35%  151 aa  DUT_ECO7I RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     4e-17  35%  152 aa  DUT_ECO5E RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     4e-17  35%  151 aa  DUT_ECO57 RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     4e-17  35%  151 aa  DUT_ECO55 RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     4e-17  35%  151 aa  DUT_ECO45 RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     4e-17  35%  151 aa  DUT_ECO27 RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     4e-17  35%  151 aa  DUT_ECO24 RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     6e-17  35%  152 aa  DUT_SHIFL RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     6e-17  35%  151 aa  DUT_SHIF8 RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     6e-17  36%  152 aa  DUT_SALAR RecName: Full=Deoxyuridine 5'-triphosphate
   12::149     6e-17  38%  151 aa  DUT_PSEU5 RecName: Full=Deoxyuridine 5'-triphosphate
   12::149     6e-17  37%  151 aa  DUT_PSEP1 RecName: Full=Deoxyuridine 5'-triphosphate
   12::149     6e-17  38%  151 aa  DUT_PSEFS RecName: Full=Deoxyuridine 5'-triphosphate
   18::148     6e-17  41%  150 aa  DUT_NEIMA RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     6e-17  36%  151 aa  DUT_HAEPS RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     6e-17  37%  151 aa  DUT_ECOLI RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     6e-17  37%  151 aa  DUT_ECODH RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     6e-17  37%  151 aa  DUT_ECOBW RecName: Full=Deoxyuridine 5'-triphosphate
   18::148     7e-17  41%  150 aa  DUT_NEIM0 RecName: Full=Deoxyuridine 5'-triphosphate
   18::148     7e-17  41%  150 aa  DUT_NEIG1 RecName: Full=Deoxyuridine 5'-triphosphate
    6::150     1e-16  36%  151 aa  DUT_YERPS RecName: Full=Deoxyuridine 5'-triphosphate
    6::150     1e-16  36%  151 aa  DUT_YERPG RecName: Full=Deoxyuridine 5'-triphosphate
    6::150     1e-16  36%  151 aa  DUT_YERPE RecName: Full=Deoxyuridine 5'-triphosphate
    6::150     1e-16  36%  151 aa  DUT_YERP3 RecName: Full=Deoxyuridine 5'-triphosphate
    8::145     1e-16  35%  147 aa  DUT_VARV RecName: Full=Deoxyuridine 5'-triphosphate
    7::150     1e-16  36%  152 aa  DUT_SHEFN RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     1e-16  36%  151 aa  DUT_SALTY RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     1e-16  36%  151 aa  DUT_SALTI RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     1e-16  36%  152 aa  DUT_SALSV RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     1e-16  36%  151 aa  DUT_SALPK RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     1e-16  36%  152 aa  DUT_SALPC RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     1e-16  36%  152 aa  DUT_SALPB RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     1e-16  36%  151 aa  DUT_SALPA RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     1e-16  36%  152 aa  DUT_SALNS RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     1e-16  36%  152 aa  DUT_SALHS RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     1e-16  36%  151 aa  DUT_SALG2 RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     1e-16  36%  151 aa  DUT_SALEP RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     1e-16  36%  152 aa  DUT_SALDC RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     1e-16  36%  152 aa  DUT_SALCH RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     1e-16  36%  152 aa  DUT_SALA4 RecName: Full=Deoxyuridine 5'-triphosphate
    8::145     1e-16  35%  147 aa  DUT_CWPXG RecName: Full=Deoxyuridine 5'-triphosphate
    5::141     1e-16  35%  143 aa  DUT_ANTLO RecName: Full=Deoxyuridine 5'-triphosphate
    7::153     1e-16  47%  155 aa  DUT_XYLFM RecName: Full=Deoxyuridine 5'-triphosphate
    5::142     1e-16  35%  144 aa  DUT_VACCW RecName: Full=Deoxyuridine 5'-triphosphate
   13::150     1e-16  36%  152 aa  DUT_SHELP RecName: Full=Deoxyuridine 5'-triphosphate
    8::145     1e-16  35%  147 aa  DUT_RABPU RecName: Full=Deoxyuridine 5'-triphosphate
    1::137     1e-16  35%  139 aa  DUT_PRB01 RecName: Full=Deoxyuridine 5'-triphosphate
   18::148     1e-16  40%  150 aa  DUT_NEIMB RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     1e-16  36%  152 aa  DUT_CITK8 RecName: Full=Deoxyuridine 5'-triphosphate
   12::120     2e-16  43%  151 aa  DUT_TOLAT RecName: Full=Deoxyuridine 5'-triphosphate
   13::150     2e-16  37%  152 aa  DUT_SHEPW RecName: Full=Deoxyuridine 5'-triphosphate
   12::149     2e-16  37%  151 aa  DUT_PSE14 RecName: Full=Deoxyuridine 5'-triphosphate
   12::149     2e-16  36%  151 aa  DUT_PSESM RecName: Full=Deoxyuridine 5'-triphosphate
   12::149     2e-16  36%  151 aa  DUT_PSEF5 RecName: Full=Deoxyuridine 5'-triphosphate
    6::148     2e-16  46%  149 aa  DUT_NITMU RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     2e-16  35%  152 aa  DUT_KLEP7 RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     2e-16  35%  152 aa  DUT_KLEP3 RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     2e-16  35%  152 aa  DUT_ENT38 RecName: Full=Deoxyuridine 5'-triphosphate
   14::119     2e-16  46%  155 aa  DUT_DINSH RecName: Full=Deoxyuridine 5'-triphosphate
    5::153     2e-16  39%  154 aa  DUT_DICNV RecName: Full=Deoxyuridine 5'-triphosphate
    7::153     3e-16  46%  155 aa  DUT_XYLFT RecName: Full=Deoxyuridine 5'-triphosphate
    7::153     3e-16  46%  155 aa  DUT_XYLF2 RecName: Full=Deoxyuridine 5'-triphosphate
   13::150     3e-16  36%  152 aa  DUT_SHESH RecName: Full=Deoxyuridine 5'-triphosphate
   16::153     3e-16  37%  154 aa  DUT_PSYCK RecName: Full=Deoxyuridine 5'-triphosphate
    9::138     3e-16  35%  159 aa  DUT_ORFN2 RecName: Full=Deoxyuridine 5'-triphosphate
   16::147     3e-16  39%  148 aa  DUT_BURTA RecName: Full=Deoxyuridine 5'-triphosphate
   16::147     3e-16  38%  148 aa  DUT_BURS3 RecName: Full=Deoxyuridine 5'-triphosphate
   12::149     3e-16  36%  151 aa  DUT_AZOVD RecName: Full=Deoxyuridine 5'-triphosphate
   12::149     4e-16  36%  151 aa  DUT_PSEU2 RecName: Full=Deoxyuridine 5'-triphosphate
    7::152     4e-16  34%  152 aa  DUT_PECCP RecName: Full=Deoxyuridine 5'-triphosphate
    7::152     4e-16  34%  152 aa  DUT_ERWCT RecName: Full=Deoxyuridine 5'-triphosphate
   16::147     4e-16  38%  148 aa  DUT_BURVG RecName: Full=Deoxyuridine 5'-triphosphate
    1::150     5e-16  38%  152 aa  DUT_XANCP RecName: Full=Deoxyuridine 5'-triphosphate
    1::150     5e-16  38%  152 aa  DUT_XANCB RecName: Full=Deoxyuridine 5'-triphosphate
    1::150     5e-16  38%  152 aa  DUT_XANC8 RecName: Full=Deoxyuridine 5'-triphosphate
    1::122     5e-16  43%  152 aa  DUT_AERHH RecName: Full=Deoxyuridine 5'-triphosphate
  725::841     6e-16  38% 1124 aa  POL_FIVSD RecName: Full=Pol polyprotein;Contains:  RecName:
   16::147     6e-16  38%  148 aa  DUT_BURCJ RecName: Full=Deoxyuridine 5'-triphosphate
   16::147     6e-16  38%  148 aa  DUT_BURCH RecName: Full=Deoxyuridine 5'-triphosphate
   16::147     6e-16  38%  148 aa  DUT_BURCC RecName: Full=Deoxyuridine 5'-triphosphate
   16::147     6e-16  38%  148 aa  DUT_BURCA RecName: Full=Deoxyuridine 5'-triphosphate
  719::841     8e-16  39% 1124 aa  POL_FIVPE RecName: Full=Pol polyprotein;Contains:  RecName:
   13::152     8e-16  36%  153 aa  DUT_WIGBR RecName: Full=Deoxyuridine 5'-triphosphate
    6::148     8e-16  36%  149 aa  DUT_JANMA RecName: Full=Deoxyuridine 5'-triphosphate
   16::147     8e-16  37%  148 aa  DUT_BURA4 RecName: Full=Deoxyuridine 5'-triphosphate
    1::122     8e-16  44%  152 aa  DUT_AERS4 RecName: Full=Deoxyuridine 5'-triphosphate
   22::153     1e-15  39%  155 aa  DUT_XANOR RecName: Full=Deoxyuridine 5'-triphosphate
   22::153     1e-15  39%  155 aa  DUT_XANOP RecName: Full=Deoxyuridine 5'-triphosphate
   16::147     1e-15  37%  148 aa  DUT_BURCM RecName: Full=Deoxyuridine 5'-triphosphate
    5::147     1e-15  36%  148 aa  DUT_RALPJ RecName: Full=Deoxyuridine 5'-triphosphate
   16::153     1e-15  37%  154 aa  DUT_PSYA2 RecName: Full=Deoxyuridine 5'-triphosphate
   14::148     1e-15  39%  149 aa  DUT_DECAR RecName: Full=Deoxyuridine 5'-triphosphate
    8::145     1e-15  34%  147 aa  DUT_CAMPS RecName: Full=Deoxyuridine 5'-triphosphate
    8::145     1e-15  34%  147 aa  DUT_CAMPM RecName: Full=Deoxyuridine 5'-triphosphate
    5::147     1e-15  36%  148 aa  DUT_BURPP RecName: Full=Deoxyuridine 5'-triphosphate
    5::147     1e-15  36%  148 aa  DUT_BURP8 RecName: Full=Deoxyuridine 5'-triphosphate
   12::146     1e-15  41%  148 aa  DUT_BPT5 RecName: Full=Deoxyuridine 5'-triphosphate
   22::153     2e-15  39%  155 aa  DUT_XANOM RecName: Full=Deoxyuridine 5'-triphosphate
   22::153     2e-15  39%  155 aa  DUT_XANC5 RecName: Full=Deoxyuridine 5'-triphosphate
   22::153     2e-15  39%  155 aa  DUT_XANAC RecName: Full=Deoxyuridine 5'-triphosphate
    6::148     2e-15  38%  149 aa  DUT_RHOFD RecName: Full=Deoxyuridine 5'-triphosphate
   17::148     2e-15  38%  149 aa  DUT_BORPA RecName: Full=Deoxyuridine 5'-triphosphate
   17::148     2e-15  38%  149 aa  DUT_BORBR RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     2e-15  34%  151 aa  DUT_SODGM RecName: Full=Deoxyuridine 5'-triphosphate
    5::147     2e-15  36%  148 aa  DUT_BURXL RecName: Full=Deoxyuridine 5'-triphosphate
   18::148     3e-15  38%  149 aa  DUT_AZOSB RecName: Full=Deoxyuridine 5'-triphosphate
    7::153     4e-15  45%  155 aa  DUT_XYLFA RecName: Full=Deoxyuridine 5'-triphosphate
   16::147     4e-15  36%  148 aa  DUT_RALSO RecName: Full=Deoxyuridine 5'-triphosphate
    4::148     4e-15  39%  149 aa  DUT_NITEU RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     5e-15  34%  152 aa  DUT_ERWT9 RecName: Full=Deoxyuridine 5'-triphosphate
  151::294     5e-15  35%  296 aa  438L_IIV6 RecName: Full=Probable deoxyuridine 5'-triphosphate
   18::149     7e-15  38%  150 aa  DUT_METFK RecName: Full=Deoxyuridine 5'-triphosphate
   16::147     9e-15  37%  148 aa  DUT_BURM1 RecName: Full=Deoxyuridine 5'-triphosphate
   16::153     1e-14  40%  154 aa  DUT_PSYWF RecName: Full=Deoxyuridine 5'-triphosphate
   18::148     2e-14  39%  149 aa  DUT_NITEC RecName: Full=Deoxyuridine 5'-triphosphate
   17::148     3e-14  36%  149 aa  DUT_METPP RecName: Full=Deoxyuridine 5'-triphosphate
   18::149     3e-14  38%  150 aa  DUT_LEPCP RecName: Full=Deoxyuridine 5'-triphosphate
   18::150     3e-14  32%  151 aa  DUT_HAMD5 RecName: Full=Deoxyuridine 5'-triphosphate
   17::149     3e-14  35%  149 aa  DUT_POLSQ RecName: Full=Deoxyuridine 5'-triphosphate
    6::148     3e-14  33%  149 aa  DUT_HERAR RecName: Full=Deoxyuridine 5'-triphosphate
    3::120     3e-14  42%  150 aa  DUT_CHRVO RecName: Full=Deoxyuridine 5'-triphosphate
   17::149     3e-14  36%  149 aa  DUT_BORA1 RecName: Full=Deoxyuridine 5'-triphosphate
    6::149     3e-14  42%  150 aa  DUT_BAUCH RecName: Full=Deoxyuridine 5'-triphosphate
   18::148     4e-14  38%  149 aa  DUT_AZOSE RecName: Full=Deoxyuridine 5'-triphosphate
    3::142     8e-14  32%  144 aa  DUT_ENCCU RecName: Full=Deoxyuridine 5'-triphosphate
    6::150     1e-13  33%  151 aa  DUT_YERE8 RecName: Full=Deoxyuridine 5'-triphosphate
   16::118     1e-13  43%  148 aa  DUT_BURPS RecName: Full=Deoxyuridine 5'-triphosphate
   16::118     1e-13  43%  148 aa  DUT_BURP6 RecName: Full=Deoxyuridine 5'-triphosphate
   16::118     1e-13  43%  148 aa  DUT_BURP1 RecName: Full=Deoxyuridine 5'-triphosphate
   16::118     1e-13  43%  148 aa  DUT_BURP0 RecName: Full=Deoxyuridine 5'-triphosphate
   16::118     1e-13  43%  148 aa  DUT_BURMS RecName: Full=Deoxyuridine 5'-triphosphate
   16::118     1e-13  43%  148 aa  DUT_BURMA RecName: Full=Deoxyuridine 5'-triphosphate
   16::118     1e-13  43%  148 aa  DUT_BURM9 RecName: Full=Deoxyuridine 5'-triphosphate
   16::118     1e-13  43%  148 aa  DUT_BURM7 RecName: Full=Deoxyuridine 5'-triphosphate
    1::121     2e-13  39%  152 aa  DUT_LEGPH RecName: Full=Deoxyuridine 5'-triphosphate
    1::121     2e-13  39%  152 aa  DUT_LEGPC RecName: Full=Deoxyuridine 5'-triphosphate
    1::121     2e-13  39%  152 aa  DUT_LEGPA RecName: Full=Deoxyuridine 5'-triphosphate
    6::149     3e-13  32%  154 aa  DUT_BUCAT RecName: Full=Deoxyuridine 5'-triphosphate
    6::149     3e-13  32%  154 aa  DUT_BUCAI RecName: Full=Deoxyuridine 5'-triphosphate
    6::149     3e-13  32%  154 aa  DUT_BUCA5 RecName: Full=Deoxyuridine 5'-triphosphate
   17::119     5e-13  42%  149 aa  DUT_BORPE RecName: Full=Deoxyuridine 5'-triphosphate
   18::148     8e-13  37%  151 aa  DUT_BLOFL RecName: Full=Deoxyuridine 5'-triphosphate
    1::121     1e-12  38%  152 aa  DUT_LEGPL RecName: Full=Deoxyuridine 5'-triphosphate
   13::151     2e-12  33%  152 aa  DUT_ENTS8 RecName: Full=Deoxyuridine 5'-triphosphate
   12::149     3e-12  34%  151 aa  DUT_PSEPF RecName: Full=Deoxyuridine 5'-triphosphate
   17::148     3e-12  34%  149 aa  DUT_POLNS RecName: Full=Deoxyuridine 5'-triphosphate
  718::841     4e-12  38% 1124 aa  POL_FIVT2 RecName: Full=Pol polyprotein;Contains:  RecName:
  756::872     2e-11  35% 1145 aa  POL_EIAVY RecName: Full=Pol polyprotein;Contains:  RecName:
  757::873     2e-11  35% 1146 aa  POL_EIAVC RecName: Full=Pol polyprotein;Contains:  RecName:
  757::873     2e-11  35% 1146 aa  POL_EIAV9 RecName: Full=Pol polyprotein;Contains:  RecName:
   18::117     5e-11  40%  149 aa  DUT_LARHH RecName: Full=Deoxyuridine 5'-triphosphate
   12::150     5e-11  32%  152 aa  DUT_BUCBP RecName: Full=Deoxyuridine 5'-triphosphate
  705::827     8e-11  30% 1109 aa  POL_CAEVC RecName: Full=Pol polyprotein;Contains:  RecName:
    3::147     8e-11  34%  148 aa  DUT_FRAP2 RecName: Full=Deoxyuridine 5'-triphosphate
   43::159     1e-10  40%  314 aa  VPRT_SRV2 RecName: Full=Protease;         EC=3.4.23.-;
   22::136     1e-10  38%  314 aa  VPRT_MPMV RecName: Full=Protease;         EC=3.4.23.-;
   17::142     1e-10  31%  143 aa  DUT_YMTV RecName: Full=Deoxyuridine 5'-triphosphate
   43::136     1e-10  41%  314 aa  VPRT_SRV1 RecName: Full=Protease;         EC=3.4.23.-;
  681::803     4e-10  33% 1086 aa  POL_OMVVS RecName: Full=Pol polyprotein;Contains:  RecName:
   19::121     4e-10  32%  150 aa  DUT_LACLA RecName: Full=Deoxyuridine 5'-triphosphate
   63::158     4e-10  36%  188 aa  DUT_ICHV1 RecName: Full=Deoxyuridine 5'-triphosphate
   39::155     3e-09  41%  274 aa  VPRT_MMTVB RecName: Full=Protease;         EC=3.4.23.-;
  696::818     4e-09  31% 1101 aa  POL_VILVK RecName: Full=Pol polyprotein;Contains:  RecName:
  700::822     4e-09  31% 1105 aa  POL_VILV2 RecName: Full=Pol polyprotein;Contains:  RecName:
  700::822     4e-09  31% 1105 aa  POL_VILV1 RecName: Full=Pol polyprotein;Contains:  RecName:
  700::822     4e-09  31% 1105 aa  POL_VILV RecName: Full=Pol polyprotein;Contains:  RecName:
   17::147     2e-08  35%  148 aa  DUT_FRATW RecName: Full=Deoxyuridine 5'-triphosphate
   17::147     2e-08  35%  148 aa  DUT_FRATT RecName: Full=Deoxyuridine 5'-triphosphate
   17::147     2e-08  35%  148 aa  DUT_FRATN RecName: Full=Deoxyuridine 5'-triphosphate
   17::147     2e-08  35%  148 aa  DUT_FRATM RecName: Full=Deoxyuridine 5'-triphosphate
   17::147     2e-08  35%  148 aa  DUT_FRAT1 RecName: Full=Deoxyuridine 5'-triphosphate
   17::147     3e-08  34%  148 aa  DUT_FRATO RecName: Full=Deoxyuridine 5'-triphosphate
   17::147     3e-08  34%  148 aa  DUT_FRATH RecName: Full=Deoxyuridine 5'-triphosphate
   17::147     3e-08  34%  148 aa  DUT_FRATF RecName: Full=Deoxyuridine 5'-triphosphate
   10::157     6e-08  32%  159 aa  DUT_BUCAP RecName: Full=Deoxyuridine 5'-triphosphate
   55::148     1e-07  37%  326 aa  VPRT_JSRV RecName: Full=Bifunctional protease/dUTPase;Includes:
  667::751     7e-07  39% 1117 aa  POK4_HUMAN RecName: Full=HERV-K_6q14.1 provirus ancestral Gag-Pol
   27::159     5e-06  35%  165 aa  DUTP_ASFB7 RecName: Full=Deoxyuridine 5'-triphosphate
   27::159     6e-06  34%  165 aa  DUTP_ASFK5 RecName: Full=Deoxyuridine 5'-triphosphate
   27::159     8e-06  35%  165 aa  DUTP_ASFWA RecName: Full=Deoxyuridine 5'-triphosphate
   27::159     8e-06  35%  165 aa  DUTP_ASFP4 RecName: Full=Deoxyuridine 5'-triphosphate
   71::151     1e-05  35%  187 aa  DCD_METMJ RecName: Full=Probable deoxycytidine triphosphate
   83::147     1e-05  45%  180 aa  DCD_AQUAE RecName: Full=Deoxycytidine triphosphate deaminase;      
   27::159     1e-05  34%  162 aa  DUTP_ASFM2 RecName: Full=Deoxyuridine 5'-triphosphate
   58::127     9e-05  34%  166 aa  DCD_THEAC RecName: Full=Probable deoxycytidine triphosphate
   72::148     9e-05  32%  183 aa  DCD_METB6 RecName: Full=Probable deoxycytidine triphosphate
  551::643     1e-04  38%  827 aa  GAG_IPMA RecName: Full=Retrovirus-related Gag polyprotein;Contains:
   78::141     3e-04  38%  323 aa  VPRT_SMRVH RecName: Full=Protease;         EC=3.4.23.-;
   69::148     7e-04  34%  178 aa  DCD_AERPE RecName: Full=Probable deoxycytidine triphosphate
   77::156     0.001  30%  197 aa  DCD_METTH RecName: Full=Probable deoxycytidine triphosphate
    1::149

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTDLAPIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLA
DUT_CORGB       MTDLAPIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLA
DUT_CORGL       MTDLAAIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLA
DUT_COREF       ------IRLLRLDPGLPMPRRAHRGDAGVDLHSTTDVVIAPGHRELVGTGVAIALPLGTVGLIHPRSGLA
DUT_CORJK       ----APLRIVRLDKELPLPRRAHPTDAGIDLYTAQDVTIAPGCRELVGTGIAIALPVGTVGLVHPRSGLA
DUT_CORDI       ------VAIQRLDPELPLPVRKHRGDAGADLFSAESVTIEPGHRILVGTGIAIALPIGTVGLIHPRSGRA
DUT_RHOE4       MSDHLSIALKRLDPDLPVPQRAHPGDAGVDLCSTSDVTIEPGHRTLVGTGIAIALPVGTVGLIHPRSGLA
DUT_NOCFA       MSALSPIPLRRLDPGIPVPTRAHPGDAGVDLCTTEDVVLAPGERVLVGTGIAVALPVGTVGLIHPRSGLA
DUT_MYCSK       ------LAVLRLDRELPMPARAHDGDAGVDLFSARDVELAPGQRELVPTGIAVAIPHGMVGLVHPRSGLA
DUT_MYCSJ       ------LAVLRLDRELPMPARAHDGDAGVDLFSARDVELAPGQRELVPTGIAVAIPHGMVGLVHPRSGLA
DUT_MYCS2       ------LAVVRLDRELPMPTRAHDGDAGVDLYSAENVELAPGQRALVSTGIAVAIPHGMVGLVHPRSGLA
DUT_MYCVP       ------LAVVRLDRDLPLPSRAHDGDAGVDLYSAQDVELAPGQRALVPTGIAVAIPHGMVGLIHPRSGLA
DUT_MYCGI       ------LAVVRLDPDLPLPSRAHDGDAGVDLYSAQDVELGPGERALVPTGVAVAIPHGMVGLIHPRSGLA
DUT_MYCPA       ------LAIVRLDPGLPLPSRAHEGDAGVDLYSAEDVRLEPGRRALVRTGVAVAIPFGMVGLVHPRSGLA
DUT_MYCA1       ------LAIVRLDPGLPLPSRAHEGDAGVDLYSAEDVRLEPGRRALVRTGVAVAIPFGMVGLVHPRSGLA
DUT_MYCMM       ------LAVVRLDPGLPLPSRAHDGDAGVDLYSAEDVVLPPGQRALVRTGVAVAIPFGMVGLVHPRSGLA
DUT_MYCUA       ------LAVVRLDPGLPLPSRAHDGDAGVDLYSAEDVVLPPGQRALVRTGVAVAIPFGMVGLVHPRSGLA
DUT_MYCTU       ------LAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLA
DUT_MYCTA       ------LAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLA
DUT_MYCBT       ------LAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLA
DUT_MYCBP       ------LAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLA
DUT_MYCBO       ------LAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLA
DUT_THEFY       VSDLSPVEIRRLDPDLPLPRYAHPGDAGADLVTAEDVVLAPGERATVRTGIAIALPDGYAAFIHPRSGLA
DUT_MYCLE       ------LAVVRLDPGLPLPSRAHDGDAGVDLYSVEDVKLAPGQRALVRTGLAVAIPFGMVGLIHPRSGLA
DUT_MYCLB       ------LAVVRLDPGLPLPSRAHDGDAGVDLYSVEDVKLAPGQRALVRTGLAVAIPFGMVGLIHPRSGLA
DUT_STRGG       -----------LDPDVPIPSYGHPGDAGADLVTTEAAELAPGERAVLPTGVSIALPDGYAAFVHPRSGLA
DUT_BIFLI       ------VLVKSLDPEHPLLRYAHAGDAGADLITTVDVTLKPFERALVPTGVAIALPAGYVALVHPRSGLA
DUT_BIFLO       ------VLVKSLDPEHPAQLHAHAGDAGADLITTVDVTLKPFERALVPTGVAIALPAGYVALVHPRSGLA
DUT_BIFLD       ------VLVKSLDPEHPAQLHAHAGDAGADLITTVDVTLKPFERALVPTGVAIALPAGYVALVHPRSGLA
DUT_STRCO       ------VLIRRVDPDVPLPAYAQPGDAGADLRTTVERELAPGERAVLPTGVSVALPEGYAAFVHPRSGLA
DUT_PROAC       -----------------MPRYAMPGDAGADLTCRHDVDLAPGERAMVETGVRVALPDGYVGFVNPRSGLA
DUT_STRAW       ----APLNVLRVDPDVPLPAYEHPGDAGADLRTTESCELKPGERAVLPTGVSVALPEGYAAFVHPRSGLA
DUT_LEIXX       MTDTVDIPIIA--KRLPV--YAHPGDAGADLCAAEAVTLEPGERHTVPTGVSIALPEGYAAFVVPRSGLA
DUT_TROWT       ------------------PQRAFDGDAGFDLQSSHTAVIQPRCRQVVKTGIAIALPDGYAGFIMPRSGLA
DUT_TROW8       ------------------PQRAFDGDAGFDLQSSHTAVIQPRCRQVVKTGIAIALPDGYAGFIMPRSGLA
DUT_ANASK       ---------------LDLPRYESAGAAGLDLRADEPFTLAPGERRVVPTGLALELPPGHEGQVRPRSGLA
DUT_ANADE       ---------------LDLPRYESAGAAGLDLRADEPFTLAPGERRVVPTGLALELPPGHEGQVRPRSGLA
DUT_ANAD2       ---------------LDLPRYESAGAAGLDLRADEPFTLAPGERRVVPTGLALELPPGHEGQVRPRSGLA
DUT_CLOK5       --------VKRINKEAILPFYAHEGDAGLDLFSVEEVLIKPMERKLIATGIKIQLPPNTEGQVRPRSGLA
DUT_EHRCJ       ------IKVIKLNSNLPLPSYSTENSSGMDLYSTQDVILAPGCRACINTGIAISVPNGYEAQVRPRSGLA
DUT_NEOSM       MQEHAKILLLPHGKDLEIPRYASKGSSGLDLRAAIEGTLKPGMFELVPTGICIELPEGLEAQIRPRSGLA
DUT_GEOBB       -----PVRIKRL-RATPLPAYMTEHAAGVDLCASADFVLAPGERALVPTGLAIELPPGFEAQVRPRSGLA
DUT_DICTD       ------VLIERIDKDLPLPNYATHGSAALDLYSRIDFELPPGGGLVIPTGIRIALPEGYLALVLPRSGLA
DUT_WOLPP       ------IKKLSHGKSLPLPCYATMQSAGMDLYAALDVILNPLERLLIPTGIVIAIPNGFEGQVRPRSGLA
DUT_SPHWW       ------IKLKRLDHGLPLPAYATAHAAGLDVVSAEDVTLAPGARHAVATGFAIAIPEGYEVQVRPRSGLA
DUT_PELLD       ------VKIVRLNKQAFLPVYATRHAAGMDVSACLEAVVAPGSAELIATGLAIELPEGYEAQLRPRSGLA
DUT_CLOTE       ------LKIKLLKEDAKLPQYAHDNDAGMDLFSTEDKIINPGKHALILTGISIELPENTEAQIRPRSGLA
DUT_GEOSM       -----PVRIKRL-RATPLPGYMTEHAAGVDLCASADFVLSPGERALVPTGLAIELPPGFEAQVRPRSGLA
DUT_AQUAE       ------LKIKRLPQDLPLPSYATPHSSGLDLRAAIEKPIKPFERVLIPTGLILEIPEGYEGQVRPRSGLA
DUT_GEOSF       ------IKRIRPEKGNPLPRYMTAHAAGVDLCADLDQVLEPGERTLVPTGIAIELPEGYEAQIRPRSGLA
DUT_GLUOX       -TDLIDVRITRLSEGLPLPAYATAGAAGFDFLAAVDATIAPGERVLVPTGLCIALPPAYELQVRPRSGLA
DUT_ACAM1       ------IKIIKLTESAQVPRYSHADDAGLDLFAIEAQKILPGASALIPTGIAIELPQGTEAQVRPRSGLA
DUT_THETN       ------LKIKRTEKDLPLPAYMSEGAAGMDLYANVEVTINPGEVELIPTGIQIELPPNYEAQIRPRSGLA
DUT_DICT6       ---MVKVLIERIDKDLPLPNYATSGSAALDLYSRIDFELPPGGGLVIPTGIKIALPEGYLAFVLPRSGLA
DUT_PELCD       ------IKVKRLHSKAMLPAYMSPHAAGMDLYACPDGVVKPGCRTIVPTGIALAIPVGYEGQVRPRSGLA
DUT_WOLTR       ------IKKLSHGKDLPLPCYATMQSAGMDLYAANSIVLNPLERLLIPTGIVIVIPNGFEGQIRPRSGLA
DUT_WOLPM       ------IKRLSHGEDLSLPCYATTQSAGMDLYAALNAVLNPLERLLVPTGIVIAIPNGFEGQIRPRSGLA
DUT_WOLWR       ------IKRLSHGEDLSLPCYATVQSAGMDLYAALNAVLNPLERLLVPTGIVIAIPNGFEGQVRPRSGLA
DUT_RHOPS       MSDTIAVEIKQLPEGLPLPAYQSAHAAGLDLCAANSALLAPGSYVLVPTGLTIALPENYEAQVRPRSGLA
DUT_SYNAS       ---------------LSLPRYMSEHAAGMDICAAVEVVILPGERALIPTGIAIALPEGFEAQIRPRSGLA
DUT_ANAMM       ------VKILRLASGLPLPSYATPKSAGLDLYAAVDSVVHPGGRCAVKTGVALELPDGYEAQIRSRSGLA
DUT_ANAMF       ------VKILRLASGLPLPSYATPKSAGLDLYAAVDSVVHPGGRCAVKTGVALELPDGYEAQIRSRSGLA
DUT_OLICO       MTEPLRIAVTQLPQGLPLPAYQTEHAAGLDLLAAVPEAIAPGERALVPTGLAIALPAGYEAQVRPRSGLA
DUT_NITWN       ---------------LPLPSYQSTQAAGLDLIAAAPLVLAAGRRAMVPTGLVIALPDGYEAQVRPRSGLA
DUT_ANADF       ---------------LELPRYETDGAAGLDLRADEPVTLAPGERRLVPTGLALEIPPGHEGQVRPRSGLA
DUT_SYNWW       --------------DLPLPRYMTPGSSGLDLYAAVDELIPSGKIVLVPTGLALAIPEGYEAQIRPRSGLA
DUT_PROA2       ------VNIVRVNKNAILPRYATQHAAGMDIAACLDVTIQPSETVLVPTGLAVELPEGYEAQLRPRSGLA
DUT_RHIL3       --DLSPLNLIRLGEGLDLPAYESKGAAGMDLRAAVDEALLPGKRALVPTGFIFEIPEGFEGQVRPRSGLA
DUT_ZYMMO       ---------------LPFPSYASEGAAGMDVVSAEDVILQPMQRYPVKTGFAVAIPNGYEIQVRARSGLA
DUT_RHOP2       MSPAIAVEIKRLPEGLPLPAYQSAHAAGLDLCAANSASLAPGCHMLVPTGLCIALPPNYEAQVRPRSGLA
DUT_ACICJ       MTIAVAVKRLAHGAGLPLPDYATAGSAGLDLLAAVDAVIAPGARALVPTGLAIALPPDFELQVRPRSGLA
DUT_HYDS0       --------VKKLREDAALPFYATSGASGLDLFCVDDVVIRPFERVLVSTGIAIELPEGYEAQIRPRSGLA
DUT_THEPX       ------LKIKKTDKDLPLPAYMSEGAAGMDLYANVEVILQPGEIKLIPTGIQIELPPNFEAQIRPRSGLA
DUT_THEP3       ------LKIKKTDKDLPLPAYMSEGAAGMDLYANVEVILQPGEIKLIPTGIQIELPPNFEAQIRPRSGLA
DUT_RICBR       ---ITQVKVKKLDNFFKLPEYATDHSAGMDLTAANEQTIKAGEIQLIPTGIAIALPELFEAQIRPRSGLA
DUT_RICB8       ---ITQVKVKKLDNFFKLPEYATDHSAGMDLTAANEQTIKAGEIQLIPTGIAIALPELFEAQIRPRSGLA
DUT_RICAH       --NITQVKIKKLENSGSLPEYATEHSAGMDLIAANEQTIKAGEIQLIPTGIAIALPYSFEAQIRPRSGLA
DUT_RICTY       -----------------LPAYATEHSAGVDLIAANEQLIKVGSIQLIPTGIAIALPDSFEAQIRPRSGLA
DUT_RICPR       ------VKIKKLENFLGLPEYATEHSAGMDLVAANEQTIKVGSIQLIPTGIAIALPESFEAQIRPRSGLA
DUT_TRIEI       ------LKIKKLDELAIIPFYAHKGDAGLDLFSIDESTINPGESKLIHTGISIELPSGTEAQIRPRSGLA
DUT_RICFE       ---ITQVKIKKLENSGSLPEYATEHSAGMDLIAANEQTIKAGEIQLIPTGIAIALPDSFEAQIRPRSGLA
DUT_RHIEC       ------LNLIRLGEGLDLPAYESKGAAGMDLRAAVDGTLAPGERALLPTGFIFEIPEGFEGQVRPRSGLA
DUT_PORGI       ------IKIINRSHH-PLPTYATSASAGMDLRASIEEPITPLERRLIPTGLFIELPVGYEAQIRPRSGLA
DUT_PORG3       ------IKIINRSHH-PLPAYATSASAGMDLRASIEEPITPLERRLIPTGLFIELPVGYEAQIRPRSGLA
DUT_CLONN       --------VEKTNEKAIIPFQAHEGDAGMDLFSVEEITLKPMERKLIHTGIKIQLPKDTEAQIRPRSGLA
DUT_CLODI       ------LKVKKLNDDAIIPNFAHKGDAGMDLYSIEEVVIPPGETKLIKTGICIELPTMTEAQVRPRSGLA
DUT_CLOD6       ------LKVKKLNDDAIIPNFAHKGDAGMDLYSIEEVVIPPGETKLIKTGICIELPTMTEAQVRPRSGLA
DUT_RICM5       ---ITQVKIKKLENSGSLPEYATEHSAGMDLIAANEQTIKAGAIQLIPTGIAIALPDSFEAQIRPRSGLA
DUT_AGRRK       -TDTRPLNLIRLGRGLDLPAYETKGAAGMDLRAATTLTLAPGKRALVPSGFIFEIPEGFEAQIRPRSGLA
DUT_RICCK       -----------------LPKYATEHSAGMDLIAANKQIIKIGEIQLIPTGIAIALPDLFEAQIRPRSGLA
DUT_RHOCS       MTDLS-IAVTRLPHDLPLPAYATEHAAGMDLLAAVPVILAPGERRLIPTGLAIALPDGYEAQVRPRSGLA
DUT_CLOAB       ------LKIKKIDDAAILPECAHEGDAGLDLFSVEEKVIKAGESALIGTGIQMELPPETEAQVRPRSGLA
DUT_CHLP8       ------VKIVRLKEKASLPAYATAHAAGMDVSACLDAPVTPSSSALIPTGLAIELPEGYEAQLRPRSGLA
DUT_RHIE6       ------LNLIRLGEGLELPAYESQGAAGMDLRAAVDGTLPPGKRALVPTGFIFEIPEGFEGQVRPRSGLA
DUT_PROVI       ------VKIVRLNKQAFLPVYATAHAAGMDVSACLEVVVEPFSTALIPAGFAIELPIGYEMQLRPRSGLA
DUT_HELHP       --------------------------AGFDLHAVEDSLIKARDRGLVGTGLAFEIESGFEVQVRPRSGLA
DUT_FLAJ1       -----------------LPNYETIASAGMDLRANIPITLKPLERTIVKTGLFIELPIGYEAQVRPRSGLA
DUT_RHILW       --DLRPLNLIRLGEGLDLPAYESKGAAGMDLRAAVDEALQPGKRALVPTGFIFEIPEGFEGQVRPRSGLA
DUT_DESPS       ----------RETETLSLPAYETEGAAGMDVAACLDATIEPGDIVLIPTGFALAIPTGYEIQVRPRSGLA
DUT_PARL1       MNPLIDVRVQRLPHSLPLPRYETSGAAGMDLIAALPEVLAPGERAMVPTGLAIALPQGFEAQVRPRSGLA
DUT_DEBHA       ------LRVFLRSENATLPTRGSVLSAGYDIYASEEAVIPAQGQGLVGTDISVAVPIGTYGRVAPRSGLA
DUT_CAUCR       --------------DLPVPAYATVGAAGFDLHVPDDAVLKPGARCMAPTGFSVAIPDGYEMQVRPRSGLA
DUT_CAUCN       --------------DLPVPAYATVGAAGFDLHVPDDAVLKPGARCMAPTGFSVAIPDGYEMQVRPRSGLA
DUT_RICRS       ---ITQVKIKKLENSGSLPEYATEHSAGMDLIAANEQTIKAAAIQLIPTGIAIALPDSFEAQIRPRSGLA
DUT_RICRO       ---ITQVKIKKLENSGSLPEYATEHSAGMDLIAANEQTIKAAAIQLIPTGIAIALPDSFEAQIRPRSGLA
DUT_RICCN       ---ITQVKIKKLENSGSLPEYATEHSAGMDLIAANEQTIKAAAIQLIPTGIAIALPDSFEAQIRPRSGLA
DUT_RICAE       ---ITQVKIKKLENSGSLPEYATEHSAGMDLIAANEQTIKAAAIQLIPTGIAIALPDSFEAQIRPRSGLA
DUT_GLOVI       --DPVRVAIQRLAHCFALPTCAHPGDAGLDLFAAVPLSIAPGRFTRVPTGIALGLPAGYMAFVQPRSGLA
DUT_BACV8       ------IQVINKSKHA-LPEYATGQSAGMDIRANLDEVLKPLQRCLVPTGLYIALPEGFEAQIRPRSGLA
DUT_CHLTE       ------VKIVRLNQKAILPVYATAHAAGMDVSACLDATVPSSASALIPTGFAIELPEGYEAQLRPRSGLA
DUT_CHLCH       ------IKIVRLXXXXXXXXXXXXXXXGMDVAACLEAPVAPFSTALIPTGFALELPIGYEAQLRPRSGLA
DUT_NAUPA       ------LKIKKLNQEALIPAYQTKEAAGFDLHSIEDVIIKPGERKLIGTGLAFEIEFGYEVQIRPRSGLA
DUT_CYAP7       ------LKVTKLEKAAILPKYVHSDDSGLDLSAIEDLEIPPGESQLVPTGIAIELPPNTEAQIRPRSGLA
DUT_ALKMQ       ------IKIKRINNLAKLPEYAHDGDAGMDLFSIEEKVIDPGGVALIHTGIKIELPEKTEAQIRPRSGLA
DUT_RHOSK       ------VRVIRADAALPLPSYETAGAAGADLRANLPPVLAPLGRVLVPTGLRIEIPEGFEVQIRPRSGLA
DUT_FINM2       ------VKIINKSNN-PLPKYSTIGSSGMDLRAYTDITLKPLERTLIPTGIYISIPEGYEIQIRPRSGLS
DUT_CHLL2       ------VKIVRVNKKAHLPVYATAHAAGMDVAACLDVMLEPFSTALIPSGFAIELPEGYEAQLRPRSGLA
DUT_RICPU       ---ITQVKIKKLENSGSLPEYATEHSAGMDLIAANEQTIKAAAIQLIPTGIAIALPDSFEAQIRPRSGLA
DUT_GEOSL       ---LVKIRRIRSGSDLPLPRTPHAAGMXXXXXXXXXXXXEPGERALVPTGIAIALPDGFEAQIRPRSGLA
DUT_CYTH3       ------VKIVNKSNNA-LPAYQTAQAAGMDLSATEAIVLQPLQRQLVPTGLFIELPEHTEAQIRPRSGLA
DUT_CHLPB       ---MVKVPVVRVNEKAILPHYATFQAAGMDLAACLDVTLAPFSTALIPTGLAIELPPGYEAQLRPRSGLA
DUT_BRUSU       --------IIRLEKGLDLPAYETAGSAGMDLRAAVQIVLLPGRRTLVPTGLILEIPQGYEVQIRPRSGLA
DUT_BRUSI       --------IIRLEKGLDLPAYETAGSAGMDLRAAVQIVLLPGRRTLVPTGLILEIPQGYEVQIRPRSGLA
DUT_BRUME       --------IIRLEKGLDLPAYETAGSAGMDLRAAVQIVLLPGRRTLVPTGLILEIPQGYEVQIRPRSGLA
DUT_BRUMB       --------IIRLEKGLDLPAYETAGSAGMDLRAAVQIVLLPGRRTLVPTGLILEIPQGYEVQIRPRSGLA
DUT_BRUC2       --------IIRLEKGLDLPAYETAGSAGMDLRAAVQIVLLPGRRTLVPTGLILEIPQGYEVQIRPRSGLA
DUT_BRUAB       --------IIRLEKGLDLPAYETAGSAGMDLRAAVQIVLLPGRRTLVPTGLILEIPQGYEVQIRPRSGLA
DUT_BRUA2       --------IIRLEKGLDLPAYETAGSAGMDLRAAVQIVLLPGRRTLVPTGLILEIPQGYEVQIRPRSGLA
DUT_BRUA1       --------IIRLEKGLDLPAYETAGSAGMDLRAAVQIVLLPGRRTLVPTGLILEIPQGYEVQIRPRSGLA
DUT_RHOS4       ------VRVIRADTALPLPGYETAGAAGADLRANLPPVLAPLGRVLVPTGLRIEIPDGFEVQIRPRSGLA
DUT_GEOMG       ------------DQNLPCYMTVHAAGMXXXXXXXXXXXXNPGERKLVPTGLAIALPDGFEAQIRPRSGLA
DUT_BRAJA       ---------------LPLPAYQTAEAAGLDLMAAVDATLASGRYALVPTGLAIALPPGHEAQVRPRSGLA
DUT_RHILO       ---------------LPLPAYESTGAAGMDLRAAVPLLILPGKRSLVPTGLILEIPEGMEGQVRPRSGLA
DUT_CHLPD       ------VKIVRLNEKALLPVYATTHAAGMDVAACLEVVVLPFETALIPSGFAIELPEGYEAQLRPRSGLA
DUT_SOLUE       ------IRIQRTHPQAILPTYAHAEDAGMDLHAVEDVTLEPGVARLVSTGLTLEVPPGFEAQVRPRSGLA
DUT_ORITI       -------QIYQFEGTSSLPAYSTNGSAGMDLYAASPMIIKPHETALVPAGIAISLPYGYEAQIRSRSGLA
DUT_BEII9       -------------------------------HGTT-LVLEPGGRHLLPTGFCLEIPEGYEAQVRPRSGLA
DUT_MARMM       -----PVKIKPLDEGLALPAYETPQSAGMDLRAAVPASIPPGEWRLIPVGIAIALPAGFEAQVRPRSGLA
DUT_PELPB       ------VKIVRLNKQASLPVYATAHAAGMDISACIEATIQPSTTALIPSGFALELPEGYEAQLRPRSGLA
DUT_AGRT5       ------LRLVRLANDLELPSYETRGAAGMDLRAAVPADLQPGERALVPTGFIFEVPQGYEAQIRPRSGLA
DUT_SYNP2       ------LRLLKLHPNAIIPKYQHEGDSGVDLHAIEPVAIAPHKTALIKTGLAAEIPIGTELQIRPRSGLA
DUT_ORITB       -------QIYQFEGASSLPAYSTNGSAGMDLYAASPMIIKPHETALVPAGIAISLPYGYEAQIRSRSGLA
DUT_BRASO       -----------------------------------------GSHAMVPTGLSIALPDGFEAQVRPRSGLA
DUT_AZOC5       ------VPVVRLPHDLPLPEYATAASAGMDLXXXXXXXXXXGAWALVPTGLALELPEGMEAQVRPRSGLA
DUT_RHOPB       ---------------------------------------------LVPTGLTLALPPGYEAQVRPRSGLA
DUT_NITHX       ---------------LPLPAYHSSQAAGLDLMAATPLVLAAGQYAMVPTGLIIALPDGFEAQVRPRSGLA
DUT_BACTN       ------VQVINKSKH-PLPAYATELSAGMDIRANLSEPIAPLQRCLVPTGIYIALPQGFEAQVRPRSGLA
DUT_SCHPO       --------VQKLSEKATIPTKGSANSAGYDLYAAAECIVPRRGKVLVDTDLAIAVPEGTYGRVAPRSGLA
DUT_CYAA5       ----------------------HDNDSGLDLVSTETVEIPSGESKLVKTGISIELPPNTEAQIRPRSGLA
DUT_SINMW       --DLTPLTLVRLSEGLDLPAYETAGAAGMDLRAAVPATIRPGARTLVPTGFVFEIPAGHEGQIRPRSGLA
DUT_RHOPT       ---------------LPLPEYQTAHAAGLDLIAAVDATLQPGRYVLVPTGLTIALPENYEAQVRPRSGLA
DUT_RHOPA       ---------------LPLPEYQTAHAAGLDLIAAVDATLQPGRYVLVPTGLTIALPENYEAQVRPRSGLA
DUT_FUSNN       ------VKVIR-EEGVELPKYETEGSAGMDVRANIKESITLKSLELVPTGLKVAIPEGYEIQVRPRSGLA
DUT_BDEBA       ------VKIKKLENHGDLPQYQSLGASGFDVRAQLPVVLNPGERAMIPTGLSFEIPLGYEIQARPRSGWA
DUT_WOLSU       ------IRLLKLHPNAVIPAYQSAGAAGFDLCCVESLEIPPLGRALVSTXXXXXXXXXXXXQIRPRSGLA
DUT_HUMAN       ------LRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLA
DUT_TREPS       ------------------PEYQTLGSSGADLRAFLPGEVHPLGRVLVPTGVCVELPVGLEMQIRPRSGLA
DUT_TREPA       ------------------PEYQTLGSSGADLRAFLPGEVHPLGRVLVPTGVCVELPVGLEMQIRPRSGLA
DUT_HALHL       ----ARIVDARLGSEIPLPDYATDGSAAIDLRACLDEPLAPGQRRLIGTGLAVNIDPGLVGVVASRSGLS
DUT_BACFR       ------IQVINKSKH-PLPAYATELSAGMDIRANISEPIAPMQRCLVPTGLFIALPQGFEAQIRPRSGLA
DUT_BACFN       ------IQVINKSKH-PLPAYATELSAGMDIRANISEPIAPMQRCLVPTGLFIALPQGFEAQIRPRSGLA
DUT_RHIME       ------LTLVRLPEGLDLPAYETAGAAGMDLRAALPATIRPGERALVPTGFIFEIPAGHEGQIRPRSGLA
DUT_BARHE       ------LSIQRLDQGLELPHYATAGSAGLDLRAALSVILAPGQRALIPTGLIFHLSPGFEAQIRPRSGLA
DUT_RAT         --DDASLRFVRLSEHATAPTRGSARAAGYDLYSAYDYTIPSMEKALVKTDIQIAVPSGCYGRVAPRSGLA
DUT_HELMI       ------VQIKRLHPEAMIPERQTKLASGFDLHVL-DAVIFPGERILVRTGIAIQMGEGMEAQVRPRSGLA
DUT_HELAH       ------IKIQKIHPNALIPKYQTEGSSGFDLHAVENAVIKPHSVGLVRIGICLSLEVGYELQVRTRSGLA
DUT_CHLTR       ----------KLESGSSLPEYATSGASGADVRANINEPIAPGQRALIPTGISVEIPHGYEIQVRSRSGLA
DUT_CHLTB       ----------KLESGSSLPEYATSGASGADVRANINEPIAPGQRALIPTGISVEIPHGYEIQVRSRSGLA
DUT_CHLTA       ----------KLESGSSLPEYATSGASGADVRANINEPIAPGQRALIPTGISVEIPHGYEIQVRSRSGLA
DUT_CHLT2       ----------KLESGSSLPEYATSGASGADVRANINEPIAPGQRALIPTGISVEIPHGYEIQVRSRSGLA
DUT_CANAL       -----------------VPTKGSALAAGYDLYSAEAATIPAHGQGLVSTDISIIVPIGTYGRVAPRSGLA
DUT_SILPO       ---MVAIRVIRADTQVPLPSYETTGAAGADIRANLSLTLAPGGRALIPTGLRVEIPAGYEIQIRPRSGLA
DUT_CHLMU       ----------KLESGSSLPEYATSGASGADVRANISEPIAPGQRALIPTGISVDIPHGYEIQVRSRSGLA
DUT_HELPJ       ------IKIQKIHPNALIPKYQTEGSSGFDLHAVEEVVIKPHSVGLVRIGICLSLEVGYELQVRTRSGLA
DUT_CHLPN       -----------LDSGGELPEYTTPGAAGADLRANIEEPIAPGQRALIPTGIKAEIPEGYELQVRPRSGLA
DUT_BARBK       ---------------LGLPHYATEGSAGLDLRAALSITLSPGQRALIPTGLIFHLSPGFEAQIRPRSGLA
DUT_ROSDO       ------------DTSVPLPAYETSGAAGADIRANCPVTLAPGARALVPTGLRMAIPQGYEVQIRPRSGLA
DUT_DESHY       ------IAYVRKDKAPKLPQYATPGAAGVDLQASLDQTIEPGQIVKIPTGLAIELPHAGVGFVFARSGLA
DUT_DESHD       ------IAYVRKDKAPKLPQYATPGAAGVDLQASLDQTIEPGQIVKIPTGLAIELPHAGVGFVFARSGLA
DUT_TREDE       -----------------LPEYKTSGSAGADLRALIEEILKPMQRCLIPTGLSVELPKGIELQVRPRSGLA
DUT_HELPH       ------IKIQKIHPNALIPKYQTEGSSGFDLHAVEEVTIKPHSVGLVKIGICLSLEVGYELQVRTRSGLA
DUT_HELP2       ------IKIQKIHPNALIPKYQTEGSSGFDLHAVEEVTIKPHSVGLVKIGICLSLEVGYELQVRTRSGLA
DUT_HELPY       ------IKIQKIHPNALIPKYQTDGSSGFDLHAVEEVMIKPHSVGLVKIGICLSLEVGYELQVRTRSGLA
DUT_HELPS       ------IKIQKIHPNALIPKYQTEGSSGFDLHAIEEVMIKPHSVGLVKIGICLSLEVGYELQVRTRSGLA
DUT_ADEG8       -----PVKLL-FKKHSPFPQRATSGAAGYDLCSSADVVVPPKSRSLIPTDLSFQFPRGVYGRIAPRSGLA
DUT_ACTPJ       ----------RIGNEFPLPAYATEGSAGLDLRALTESAVAPGQTVLIPTGISIYIAPNLAAVILPRSGLG
DUT_ACTP7       ----------RIGNEFPLPAYATEGSAGLDLRALTESAVAPGQTVLIPTGISIYIAPNLAAVILPRSGLG
DUT_ACTP2       ----------RIGNEFPLPAYATEGSAGLDLRALTESAVAPGQTVLIPTGISIYIAPNLAAVILPRSGLG
DUT_IDILO       ----------RIGQSIPLPEYATQGSAGMDLRACLDQTIEPGQTQLIGTGIAMYIDPNYAATILPRSGLG
DUT_SOLLC       -------RVKKLSENAVLPSRASSLAAGYDLSSAAETKVPARGKALVPTDLSIAVPQGTYARIAPRSGLA
DUT_METSB       --------------------------------------LEPGERRLVPTGLVLQIPPSHEGQLRPRSGLA
DUT_LEPBL       -----PIKKLRSNAELPVLQTKHA--AGYDVHACLDSILEPNKVTLVPTGLSFEIPQEYHFEIRPRSGFS
DUT_LEPBJ       -----PIKKLRSNAELPVLQTKHA--AGYDVHACLDSILEPNKVTLVPTGLSFEIPQEYHFEIRPRSGFS
DUT_BARQU       -----PVECLEHGQGLELPHYATSGSAGLDLRXXXXXXXXPGQRALIPTGLVFHLLPGFEAQIRPRSGLA
DUT_PROMH       ----------RIGQEYPLPAYATTGSAGLDLRACLDAVLAPGQTELLPTGLAVHIAEGLAAMVLPRSGLG
DUT_LEPIN       ------VQKLRPNAELPLLQTKQA--AGYDIHACLDSVLEPGNVGLVPTGLSFAIPQEFHFEIRPRSGFS
DUT_LEPIC       ------VQKLRPNAELPLLQTKQA--AGYDIHACLDSVLEPGNVGLVPTGLSFAIPQEFHFEIRPRSGFS
DUT_PBCV1       ---MSSLLVKKLVESATTPMRGSEGAAGYDISSVEDVVVPAMGRIAVSTGISIRVPNGTYGRIAPRSGLA
DUT_ADEG1       ---------VRLSPHAVPPVRATHGAAGYDLFSAYDIKVPARGRALVPTDLVFQFPPGCYGRIAPRSGLA
DUT_PARUW       --------LIENEELLPFYMTPEAAGADVKAYLKESLEIPPGQSALIPTGMRLAIPEGYEIQVRPRSGLA
DUT_CHLT3       ----------KLHPEARLPKYATEGAAGMDISACLDEPISVEAQSVVPTGLALEIPPGYEAQLRPRSGLA
DUT_ACIBY       ----------RLGKEWPLPSYATAGSAGLDLRACLDEAIEPGQTVLVKTGMAIYIDVNFAGLILPRSGLG
DUT_ACIBT       ----------RLGKEWPLPSYATAGSAGLDLRACLDEAIEPGQTVLVKTGMAIYIDVNFAGLILPRSGLG
DUT_ACIBS       ----------RLGKEWPLPSYATAGSAGLDLRACLDEAIEPGQTVLVKTGMAIYIDVNFAGLILPRSGLG
DUT_ACIBC       ----------RLGKEWPLPSYATAGSAGLDLRACLDEAIEPGQTVLVKTGMAIYIDVNFAGLILPRSGLG
DUT_ACIB5       ----------RLGKEWPLPSYATAGSAGLDLRACLDEAIEPGQTVLVKTGMAIYIDVNFAGLILPRSGLG
DUT_ACIB3       ----------RLGKEWPLPSYATAGSAGLDLRACLDEAIEPGQTVLVKTGMAIYIDVNFAGLILPRSGLG
DUT_ASHGO       ----APTLKVQLRSENAIPTKGSAAAAGYDIYASQDCVIPGRGQGLVATDVSFTVPVGTYGRIAPRSGLA
DUT_NEUCR       -----PLLIKKLSDKARLPTRGSAFAAGYDIYASKETTIPARGKGLVETDISMAVPAGTYGRIAPRSGLA
DUT_COXBN       MTHSVQLKILRLGSEFPLPAYATKGSAGLDLRACLDEPIEPDETCLISTGLAIYLGHSNVAAILPRSGLG
DUT_PSYIN       ----------RIGKEFPLPEHATAGSAGMDLRACIDQIIKPGETQLIPTGIAIHISPGLAATILPRSGLG
DUT_YARLI       ------LKVAFLNENARAPTRGSVHAAGYDLYAAEEKTIPANGRGLVDLGLSMSIPEGTYARIAPRSGLA
DUT_PSEAE       ----------RLGSDFPLPQYATPGSAGLDLRAMLDSVLGPGQTLLIPTGLSIYIAPGLAALVLPRSGLG
DUT_PSEA8       ----------RLGSDFPLPQYATPGSAGLDLRAMLDSVLGPGQTLLIPTGLSIYIAPGLAALVLPRSGLG
DUT_HAES2       ----------RIGTEFPLPTYATIGSAGLDLRALVDEEVQPGETKLISTGLSIYIAPNLAAVILPRSGLG
DUT_HAES1       ----------RIGTEFPLPTYATIGSAGLDLRALVDEEVQPGETKLISTGLSIYIAPNLAAVILPRSGLG
DUT_SHEON       ----------RIGSEFPLPAYATPGSAGMDLRAMIDTTIAPGETQLVPTGIAIHVAPGLAALILPRSGLG
DUT_PSEAB       ----------RLGSDFPLPQYATPGSAGLDLRAMLDTVLGPGQTLLIPTGLSIYIAPGLAALVLPRSGLG
DUT_NITOC       ----------RLGKEFPLPDYATAGAAGLDLRACIERPLAPGATKLIPTGLAIYIADPRFAAVLPRSGLG
DUT_COXBU       MTHSVQLKILRLGSEFPLPAYATTGSAGLDLRACLDEPIEPDETCLISTGLAIYLGHSNVAAILPRSGLG
DUT_COXBR       MTHSVQLKILRLGSEFPLPAYATTGSAGLDLRACLDEPIEPDETCLISTGLAIYLGHSNVAAILPRSGLG
DUT_ACTSZ       ----------RIGAQFPLPAYATTGSAGLDLRALTDEAIQPGETKLIPTGLSVYIADPQLAVILPRSGLG
DUT_PSEE4       ----------RLGTEFPLPQYATPGSAGLDLRALLDTVLEPGQTLLIPTGLSVYIDPGLAAMILPRSGLG
DUT_PSEA7       ----------RLGTDFPLPQYATPGSAGLDLRAMLDTVLGPGQTLLIPTGLSIHIAPGLAALVLPRSGLG
DUT_KLULA       ------LKVQLRSADAKVPTKGSTTAAGYDIYASQPGVIPARGQGIAKTDISFTVPVGTYGRIAPRSGLA
DUT_HAEDU       ----------RIGREFPLPTYATTGSAGLDLRALIDSAITAGQTVLIPTGISVYIAPNLAAVILPRSGLG
DUT_CHLFF       -----------LESGVDLPEYATEGASGADLRANIEEPIAPGQRVLVPTGIKMQIPQGYEVQVRPRSGLA
DUT_YEAST       ------LKIQLRSASATVPTKGSATAAGYDIYASQDITIPAMGQGMVSTDISFTVPVGTYGRIAPRSGLA
DUT_PSEMY       ----------RLGQEFPLPQYATPGSAGLDLRAMLDIVLEPGQTVLIPTGLSIYIDPGLAAMILPRSGLG
DUT_HAEIN       ----------RIGNEFPLPTYATEGSAGLDLRALIDESIQPGETKLIPTGLSIYIAPNLAAVILPRSGLG
DUT_HAEIG       ----------RIGNEFPLPTYATEGSAGLDLRALIDESIQPGETKLIPTGLSIYIAPNLAAVILPRSGLG
DUT_HAEIE       ----------RIGNEFPLPTYATEGSAGLDLRALIDESIQPGETKLIPTGLSIYIAPNLAAVILPRSGLG
DUT_HAEI8       ----------RIGNEFPLPTYATEGSAGLDLRALIDESIQPGETKLIPTGLSIYIAPNLAAVILPRSGLG
DUT_CANGA       --------------------------AGYDIYASADYVIPAMGQGMVPTDISFTVPEGTYGRIAPRSGLA
DUT_SHESM       ----------RIGSEFPLPAYATPGSAGMDLRAMIDTTIAPGETQLIPTGIAIHVAPGLAAVILPRSGLG
DUT_SHESA       ----------RIGSEFPLPAYATPGSAGMDLRAMIDTTIAPGETQLIPTGIAIHVAPGLAAVILPRSGLG
DUT_PASMU       ----------RIGTEFPLPTYATEGSAGLDLRALIDATVEAGQTVLIPTGLSLYIADPTLAVILPRSGLG
DUT_METCA       ----------RLGNEIPLPHYATPGAAGLDLRACLDAVLQPGETRLIPTGFAIHIDPDLAAVLLPRSGLG
DUT_CHLCV       --------VCELESGADLPEYATEGASGADLRAHIEEPIAPGQRVLIPTGIKMQIPQGYEVQVRPRSGLA
DUT_SWPVK       ------VKCVKLSNNAIIPNRSMSGSAGYDLYSAYSYTVKPYNRILVRTDICLMIPDKCYGRISPRSGLS
DUT_SHESW       ----------RIGSEFPLPAYATLGSAGMDLRAMIDTTIAPGETQLIPTGIAIHVAPGLAAVILPRSGLG
DUT_SHEPC       ----------RIGSEFPLPAYATLGSAGMDLRAMIDTTIAPGETQLIPTGIAIHVAPGLAAVILPRSGLG
DUT_SHEB5       ----------RIGSEFPLPAYATPGSAGMDLRAMIDTTIAPGETVLIPTGIAIHVAQGLAAVILPRSGLG
DUT_DICDI       -------KVKKLSDKAIIPQRGSKGAAGYDLSSAHELVVPAHGKALAMTDLQIAIPDGTYGRIAPRSGLA
DUT_BLOPB       ------VKIIRIYKHFYLPKYATSGSAGLDLSACLDKTIYPGKTHLISTGIAIHISDTKIGVILPRSGLG
DUT_SHEB9       ----------RIGSEFPLPAYATPGSAGMDLRAMIDTTIAPGETVLIPTGIAIHVAPGLAAVILPRSGLG
DUT_SHEB8       ----------RIGSEFPLPAYATPGSAGMDLRAMIDTTIAPGETVLIPTGIAIHVAPGLAAVILPRSGLG
DUT_SHEB2       ----------RIGSEFPLPAYATPGSAGMDLRAMIDTTIAPGETVLIPTGIAIHVAPGLAAVILPRSGLG
DUT_PSEPW       ----------RLGSEFPLPQYATPGSAGLDLRALLDTVLEPGQTLLIPTGLSIYIDPGLAAMILPRSGLG
DUT_HAHCH       ----------RLGNEIPLPAYATDGSAGLDLRAAEPVTLQPGETTLIPTGMAIHLSPGLAAMLLPRSGLG
DUT_BRASB       -----------------------------------------GSHAMVPTGLSLALPDGYEAQVRPRSGLA
DUT_ALCBS       ----------RLGDSIPLPHYATDGSAGLDLRAMVKETLQPGDTELLPTGMSIFIDPGYAGMILPRSGLG
DUT_SHESR       ----------RIGSEFPLPAYATLGSAGMDLRAMIDTTIAPGETQLIPTGIAIHVAPGLAAVLLPRSGLG
DUT_SHEHH       ----------RIGTEFPLPAYATPGSAGMDLRAITDTVIQPGETVLIPTGIAIHVADPSLAIILPRSGLG
DUT_MANSM       ----------RIGNEFPLPAYATSGSAGLDLRALIEEGLQPGETKLIPTGLSIYIAPNLAAVILPRSGLG
DUT_VACCP       ----SPVRFVKETNRAKSPTRQSPGAAGYDLYSAYDYTIPPGERQLIKTDISMSMPKICYGRIAPRSGLS
DUT_VACCC       ----SPVRFVKETNRAKSPTRQSPGAAGYDLYSAYDYTIPPGERQLIKTDISMSMPKICYGRIAPRSGLS
DUT_VACCA       ----SPVRFVKETNRAKSPTRQSPGAAGYDLYSAYDYTIPPGERQLIKTDISMSMPKICYGRIAPRSGLS
DUT_SHEPA       ----------RIGTEFPLPAYATPGSAGMDLRAITDTVIQPGETVLIPTGIAIHVADPSLAIILPRSGLG
DUT_SHEWM       ----------RIGSEYPLPAYATPGSAGMDLRAMTSLSVAPGETRLIPTGISIHVADPSLAVILPRSGLG
DUT_PSEPG       ----------RLGSEFPLPTYATPGSAGLDLRALLDTVLEPGQTLLIPTGLSIYIDPGLAAVILPRSGLG
DUT_CHLAB       --------LCELESGVSLPEYATEGASGADLRANIKEPMAPGQRVLVPTGIKMQIPQGYEVQVRPRSGFA
DUT_THIDA       ------VKILDARLRDQLPHYATPGAAGLDLRACIDAPIAPGETRLVPTGMAIHLAPGYAALILPRSGLG
DUT_SERP5       ----------RIGKDFPLPTYATPGSAGLDLRACLDSAVAPGETQLLPTGLAIHIATDLAAVILPRSGLG
DUT_PSEPK       ----------RLGSEFPLPAYATPGSAGLDLRALLDTILEPGQTVLIPTGLSIYIDPGLAAVILPRSGLG
DUT_NEIG2       -----------------IPAYATEGSAGLDLRACLDVVLQPGETFLVPTGLAIYLPAYTAVLL-PRSGLG
DUT_ACIAD       ----------RLGQEWPLPSYATTGSAGLDLRACLDEAIQPGQTVLIKTGMAIYIDTNFAGLILPRSGLG
DUT_FOWPV       ------VTVYKISDRAKLPYKQTSYSAGYDLYSAYDYVIEPMNKELIKTDIILKIPNGYYGRIAPRSGLA
DUT_THICR       ----------RLGKEIEMPHYGTKGSAGLDLRACNDMIIEPGQTVLIPTGMAIHLDPGLAAMLLPRSGLG
DUT_SHISS       ----------RVGKEFPLPTYATSGSAGLDLRACLDDAVAPGDSTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_SHIDS       ----------RVGKEFPLPTYATSGSAGLDLRACLDDAVAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_SHIBS       ----------RVGKEFPLPTYATSGSAGLDLRACLDDAVAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_SHIB3       ----------RVGKEFPLPTYATSGSAGLDLRACLDDAVAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_SHEDO       ----------RIGTQFPLPAYATPGSAGMDLRAMVDTTLAPGETKLIPTGIAIHVADPSLAVILPRSGLG
DUT_SHEAM       ----------RIGSEFPLPAYATPGSAGMDLRAMLDTTIAPGETVLIPTGIAVHVADPSLAVILPRSGMG
DUT_PHOLL       ----------RIGEEFPLPTYATPGSAGLDLRACLDNAVAPGQTELLPTGLAIHIDEQLAAVILPRSGLG
DUT_ESCF3       ----------RVGKEFPLPTYATSGSAGLDLRACLDDAVAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_ECOUT       ----------RVGKEFPLPTYATSGSAGLDLRACLDDAVAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_ECOSM       ----------RVGKEFPLPTYATSGSAGLDLRACLDDAVAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_ECOSE       ----------RVGKEFPLPTYATSGSAGLDLRACLDDAVAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_ECOLU       ----------RVGKEFPLPTYATSGSAGLDLRACLDDAVAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_ECOLC       ----------RVGKEFPLPTYATSGSAGLDLRACLDDAVAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_ECOL6       ----------RVGKEFPLPTYATSGSAGLDLRACLDDAVAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_ECOL5       ----------RVGKEFPLPTYATSGSAGLDLRACLDDAVAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_ECOK1       ----------RVGKEFPLPTYATSGSAGLDLRACLDDAVAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_ECOHS       ----------RVGKEFPLPTYATSGSAGLDLRACLDDAVAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_ECO8A       ----------RVGKEFPLPTYATSGSAGLDLRACLDDAVAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_ECO81       ----------RVGKEFPLPTYATSGSAGLDLRACLDDAVAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_ECO7I       ----------RVGKEFPLPTYATSGSAGLDLRACLDDAVAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_ECO5E       ----------RVGKEFPLPTYATSGSAGLDLRACLDDAVAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_ECO57       ----------RVGKEFPLPTYATSGSAGLDLRACLDDAVAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_ECO55       ----------RVGKEFPLPTYATSGSAGLDLRACLDDAVAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_ECO45       ----------RVGKEFPLPTYATSGSAGLDLRACLDDAVAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_ECO27       ----------RVGKEFPLPTYATSGSAGLDLRACLDDAVAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_ECO24       ----------RVGKEFPLPTYATSGSAGLDLRACLDDAVAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_SHIFL       ----------RVRKEFPLPTYATSGSAGLDLRACLDDAVAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_SHIF8       ----------RVRKEFPLPTYATSGSAGLDLRACLDDAVAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_SALAR       ----------RVGQQFPLPTYATSGSAGLDLRACLDGAVAPGATTLVPTGLAIHIADPSLAAVMPRSGLG
DUT_PSEU5       ----------RLGRDFPLPEYATPGSAGLDLRAMLDTVLEPGQTLLIPTGLAIHIADPTLALVLPRSGLG
DUT_PSEP1       ----------RLGSEFPLPAYATPGSAGLDLRALLDTLLEPGQTILIPTGLSIYIDPGLAAVILPRSGLG
DUT_PSEFS       ----------RIGNEFPLPAYATPGSAGLDLRAMLDTVLEPGQTLLIPTGLSIYVDPGLAALILPRSGLG
DUT_NEIMA       -----------------VPVYATKGSAGLDLRACLDVVLQPGETFLVPTGLAIYLADPSYAAVLPRSGLG
DUT_HAEPS       ----------RIGTEFPLPTYATTGSAGLDLRALIEQTVEAGQTVLIPTGISVYIAPNLAAVILPRSGLG
DUT_ECOLI       ----------RVGKEFPLPTYATSGSAGLDLRACNDAVLAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_ECODH       ----------RVGKEFPLPTYATSGSAGLDLRACNDAVLAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_ECOBW       ----------RVGKEFPLPTYATSGSAGLDLRACNDAVLAPGDTTLVPTGLAIHIADPSLAMMLPRSGLG
DUT_NEIM0       -----------------IPAYATEGSAGLDLRACLDVVLQPGETFLVPTGLAIYLANPAYAAVLPRSGLG
DUT_NEIG1       -----------------IPAYATEGSAGLDLRACLDVVLQPGETFLVPTGLAIYLANPAYAAVLPRSGLG
DUT_YERPS       ------IKILRVGNEFPLPTYATEGSAGLDLRACLDHAVEPGQTTLLPTGLAIHIDSALAAVILPRSGLG
DUT_YERPG       ------IKILRVGNEFPLPTYATEGSAGLDLRACLDHAVEPGQTTLLPTGLAIHIDSALAAVILPRSGLG
DUT_YERPE       ------IKILRVGNEFPLPTYATEGSAGLDLRACLDHAVEPGQTTLLPTGLAIHIDSALAAVILPRSGLG
DUT_YERP3       ------IKILRVGNEFPLPTYATEGSAGLDLRACLDHAVEPGQTTLLPTGLAIHIDSALAAVILPRSGLG
DUT_VARV        ----SPVRFVKETNRAKSPTRQSPYAAGYDLYSAYDYTIPPGERQLIKTDISMSMPKFCYGRIAPRSGLS
DUT_SHEFN       ------LKIIRIGNEFPLPAYATPGSAGMDLRAMIDTVIEPSQTVLIPTGIAIHVADPSLAVILPRSGMG
DUT_SALTY       ----------RVGQQFPLPTYATSGSAGLDLRACLDDAVAPGATTLVPTGLAIHIADPSLAAVMPRSGLG
DUT_SALTI       ----------RVGQQFPLPTYATSGSAGLDLRACLDDAVAPGATTLVPTGLAIHIADPSLAAVMPRSGLG
DUT_SALSV       ----------RVGQQFPLPTYATSGSAGLDLRACLDDAVAPGATTLVPTGLAIHIADPSLAAVMPRSGLG
DUT_SALPK       ----------RVGQQFPLPTYATSGSAGLDLRACLDDAVAPGATTLVPTGLAIHIADPSLAAVMPRSGLG
DUT_SALPC       ----------RVGQQFPLPTYATSGSAGLDLRACLDDAVAPGATTLVPTGLAIHIADPSLAAVMPRSGLG
DUT_SALPB       ----------RVGQQFPLPTYATSGSAGLDLRACLDDAVAPGATTLVPTGLAIHIADPSLAAVMPRSGLG
DUT_SALPA       ----------RVGQQFPLPTYATSGSAGLDLRACLDDAVAPGATTLVPTGLAIHIADPSLAAVMPRSGLG
DUT_SALNS       ----------RVGQQFPLPTYATSGSAGLDLRACLDDAVAPGATTLVPTGLAIHIADPSLAAVMPRSGLG
DUT_SALHS       ----------RVGQQFPLPTYATSGSAGLDLRACLDDAVAPGATTLVPTGLAIHIADPSLAAVMPRSGLG
DUT_SALG2       ----------RVGQQFPLPTYATSGSAGLDLRACLDDAVAPGATTLVPTGLAIHIADPSLAAVMPRSGLG
DUT_SALEP       ----------RVGQQFPLPTYATSGSAGLDLRACLDDAVAPGATTLVPTGLAIHIADPSLAAVMPRSGLG
DUT_SALDC       ----------RVGQQFPLPTYATSGSAGLDLRACLDDAVAPGATTLVPTGLAIHIADPSLAAVMPRSGLG
DUT_SALCH       ----------RVGQQFPLPTYATSGSAGLDLRACLDDAVAPGATTLVPTGLAIHIADPSLAAVMPRSGLG
DUT_SALA4       ----------RVGQQFPLPTYATSGSAGLDLRACLDDAVAPGATTLVPTGLAIHIADPSLAAVMPRSGLG
DUT_CWPXG       ----SPVRFVKETNRAKSPTRQSPGAAGYDLYSAYDYTIPPGERQLIKTDISMSMPKFCYGRIAPRSGLS
DUT_ANTLO       ------ITVKRLFSDAKIPVRHSEGAAAYDLYAYEDTVVAPNERKVIATGVRITVPLSCQGTIYSRSGLA
DUT_XYLFM       -----PLQIKILDPRLPLPTYATEASAGLDLRAALDATLVPGDAELLSTGIAIHLVDPSLAVVLPRSGLG
DUT_VACCW       ----SPVRFVKETNRAKSPTRQSPYAAGYDLYSAYDYTIPPGERQLIKTDISMSMPKFCYGRIAPRSGLS
DUT_SHELP       ----------RIGSQFPLPAYATPGSAGMDLRAMTTMVIQPGETQLIPTGIAVHVADPSLAVILPRSGMG
DUT_RABPU       ----SPVRFVKETNRAKSPTRQSPYAAGYDLYSAYDYTIPPGERQLIKTDISMSMPKFCYGRIAPRSGLS
DUT_PRB01       -----------MGSKIPLPQYETKGSAGLDLRACLDSNLSAGTSQLIPIGFAMYLEPGLAAMVIPRSGLG
DUT_NEIMB       -----------------VPVYATEGSAGLDLRACLDVVLQPGETFLVPTGLAIYLANPAYAAVLPRSGLG
DUT_CITK8       ----------RVGQQFPLPTYATSGSAGLDLRACLDDAVAPGATTLVPTGLAIHIADPSLAAVMPRSGLG
DUT_TOLAT       ----------RIGNEFPLPEYATPGSAGLDLRACLDAVLAPGETQLIPTGLAIHIAPGLCATILPRSGLG
DUT_SHEPW       ----------RIGTQFPLPAYATLGSAGMDLRAITDIAIQPGETVLIPTGIAVHVADPSLAIILPRSGLG
DUT_PSE14       ----------RIGNEFPLPAYATVGSAGLDLRAMLDTVLEPGQTLLIPTGLSIYIDPGLAALILPRSGLG
DUT_PSESM       ----------RIGNEFPLPAYATVGSAGLDLRAMLDTLLEPGQTLLIPTGLSIYIDPGLAALILPRSGLG
DUT_PSEF5       ----------RIGNEFPLPQYATPGSAGLDLRAMLDTLLEPGQTLLIPTGLSVYIDPGLAALILPRSGLG
DUT_NITMU       ------IKILDSRLKDQLPAYATSGSAGLDLRACIEHVIQPGEAHLIPTGIAIHLSPGLAALVLPRSGLG
DUT_KLEP7       ----------RVGQQFPLPTYATSGSAGLDLRACLDDAVAPGATTLLPTGLAIHIADPSLAVILPRSGLG
DUT_KLEP3       ----------RVGQQFPLPTYATSGSAGLDLRACLDDAVAPGATTLLPTGLAIHIADPSLAVILPRSGLG
DUT_ENT38       ----------RVGQQFPLPTYATSGSAGLDLRACLDEAVAPGATTLIPTGLAIHVADPSLAVILPRSGLG
DUT_DINSH       ------------DEAIPLPSYATVGAAGADLRANLPVEIQPLCRVIVPTGLRVAIPAGYEMQIRPRSGLA
DUT_DICNV       -----PYKILRLGGEIPLPTYATSGSAALDIRAVESIVLAADECRLIGSGLAIADP-NYCGIVLPRSGLG
DUT_XYLFT       -----PLQIKILDPRLPLPTYATEASAGLDLRAALDATLVPGDAELLSTGIAIHLVDPSLAVVLPRSGLG
DUT_XYLF2       -----PLQIKILDPRLPLPTYATEASAGLDLRAALDATLVPGDAELLSTGIAIHLVDPSLAVVLPRSGLG
DUT_SHESH       ----------RIGSQFPLPAYATPGSAGMDLRAMTSIQVAPGETILIPTGISIHVADSSLAVILPRSGLG
DUT_PSYCK       ------------DKAFSLPTRATDGSAGIDLRACIDETIKAGATHLIGTGLAVYIQPNFAGMILPRSGLG
DUT_ORFN2       ------LQVVRLSQNATIPARGSPGAAGLDLCSAYDCVIPSHCSRVVFTDLLIKPPSGCYGRIAPRSGLA
DUT_BURTA       -----------------LPKYATTGSAGLDLRACLDAPVTPGDTALVPTGLAIHLAPGYAALILPRSGLG
DUT_BURS3       -----------------LPAYATTGSAGLDLRACLDAPVTPGETTLVPTGLAIHLAPGYAALILPRSGLG
DUT_AZOVD       ----------RLGSDYPLPAYATAGSAGLDLRAMLELTLEPGQTALIPTGLAIHIAPGLAALVLPRSGLG
DUT_PSEU2       ----------RIGNEFPLPAYATTGSAGLDLRAMLDTLLEPGQTLLIPTGLSIYIDPGLAALILPRSGLG
DUT_PECCP       ------VKIVRVGQQFPLPTYATPGSAGLDLRACLDQAIEAGETTLIPTGLAIHIATGLAAVILPRSGLG
DUT_ERWCT       ------VKIVRVGQQFPLPTYATPGSAGLDLRACLDQAIEAGETTLIPTGLAIHIATGLAAVILPRSGLG
DUT_BURVG       -----------------LPAYATTGSAGLDLRACLDAPVTPGETTLVPTGLAIHLAPGYAALILPRSGLG
DUT_XANCP       MTQSLQVKLLRFGDLWPLPAYATEASAGMDLRAALEATLEPGDAALIPSGIAIHLDDPQVAVILPRSGLG
DUT_XANCB       MTQSLQVKLLRFGDLWPLPAYATEASAGMDLRAALEATLEPGDAALIPSGIAIHLDDPQVAVILPRSGLG
DUT_XANC8       MTQSLQVKLLRFGDLWPLPAYATEASAGMDLRAALEATLEPGDAALIPSGIAIHLDDPQVAVILPRSGLG
DUT_AERHH       MTTQIELKILRIGTEYPLPAYATPGSAGMDLRALLDATLAPGDTTLVPTGLAIHIQPGLCATILPRSGLG
POL_FIVSD       -------------------------DAGYDLLAAKEIHLLPGEVKVIPTGVKLMLPKGHWGLIMGKSSIG
DUT_BURCJ       -----------------LPAYATTGSAGLDLRACLDAPVTPGETTLVPTGLAIHLAPGYAALILPRSGLG
DUT_BURCH       -----------------LPAYATTGSAGLDLRACLDAPVTPGETTLVPTGLAIHLAPGYAALILPRSGLG
DUT_BURCC       -----------------LPAYATTGSAGLDLRACLDAPVTPGETTLVPTGLAIHLAPGYAALILPRSGLG
DUT_BURCA       -----------------LPAYATTGSAGLDLRACLDAPVTPGETTLVPTGLAIHLAPGYAALILPRSGLG
POL_FIVPE       -----------------LDKRSE--DAGYDLLAAKEIHLLPGEVKVIPTGVKLMLPKGYWGLIIGKSSIG
DUT_WIGBR       ----------RFGKEFFLPKYFTDGSSGMDLRACIDKEINPNETVLISTGVSIDISDQKIGLILPRSGLS
DUT_JANMA       ------VKILDPRMQEQLPAYATAGSAGLDLRACLDATIKPGETHLVPTGLAIHLAPGYAAMILPRSGMG
DUT_BURA4       -----------------MPAYATTGSAGLDLRACLDAPVTPGETTLVPTGLAIHLAPGYAALILPRSGLG
DUT_AERS4       MTTQIELKILRIGTEYPLPAYATPGSAGMDLRALLDAPIAPGDTILVPTGLAIHIQPGLCATILPRSGLG
DUT_XANOR       ----------------PLPAHATESSAGMDLRAALEATLQPGDAALIPSGIAIHLADPQLAVILPRSGLG
DUT_XANOP       ----------------PLPAHATESSAGMDLRAALEATLQPGDAALIPSGIAIHLADPQLAVILPRSGLG
DUT_BURCM       -----------------MPAYATTGSAGLDLRACLDAPVTPGETTLVPTGLAIHLAPGYAALILPRSGLG
DUT_RALPJ       ------VKILDARLHEQLPQYATTGSAGLDLRACVDATIEPGTTHLIPTGMAIHLAPGYAALILPRSGMG
DUT_PSYA2       ------------DKAFSLPTRATDGSAGIDLRACIDETIKAGTTHLIGTGLAIYIQPNFAGMILPRSGLG
DUT_DECAR       -------------RETP-PHYATPGSAGLDLRACIEAPVEPGQTTLVPTGMAIHLAPGLAAMILPRSGLG
DUT_CAMPS       ----SPVRFVKETNRAKSPTRQSPYAAGYDLYSAYYYTIPPGERQLIKTDISMSMPKFCYGRIAPRSGLS
DUT_CAMPM       ----SPVRFVKETNRAKSPTRQSPYAAGYDLYSAYYYTIPPGERQLIKTDISMSMPKFCYGRIAPRSGLS
DUT_BURPP       ------LKILDARMRDQLPAYATTGSAGLDLRACLDEALTPGETALVPTGLAIHVDAGYAALILPRSGLG
DUT_BURP8       ------IKILDPRMREQLPAYATTGSAGLDLRACLDATLEPGQTVLVPTGLAIHLAPGYAALILPRSGMG
DUT_BPT5        -----------------MPKIGSEDAAGMDLRATNPAAIAPGKSLMIDTGVAVEIPRGWFGLVVPRSSLG
DUT_XANOM       ----------------PLPAYATESSAGMDLRAALEATLQPGDAALIPSGIAIHLADPQLAVILPRSGLG
DUT_XANC5       ----------------PLPAYATESSAGMDLRAALEATLQPGDAALIPSGIAIHLADPQLAVILPRSGLG
DUT_XANAC       ----------------PLPAYATESSAGMDLRAALEATLQPGDAALIPSGIAIHLADPQLAVILPRSGLG
DUT_RHOFD       ------VKIIDPRMADQLPAYATPGSAGLDLRACLDATLLPNAWQLVPTGIAIYLKDPKAAMILPRSGLG
DUT_BORPA       -----------------LPAYATPGSAGLDLRACTEAVIEPGQTVLVPTGLAIHIDPRYAAMILPRSGLG
DUT_BORBR       -----------------LPAYATPGSAGLDLRACTEAVIEPGQTVLVPTGLAIHIDPRYAAMILPRSGLG
DUT_SODGM       ----------RICDRFPLPAYATTGSAGLDLRACIDEVLAPGETTLIPTGLAIHIAANLAAVILPRSGLG
DUT_BURXL       ------LKILDARMRDQLPAYATTGSAGLDLRACLDETLKPGETALVPTGLAIHVDPGYAALILPRSGLG
DUT_AZOSB       ------------------PAYASAGAAGLDLRACLDALLHPGETTLVPSGLAIHLAPGLAAMVLPRSGLG
DUT_XYLFA       -----PLQIKILDPRLGLPTYATEASAGLDLRAALDATLVPGDAELLSTGVAIHLVDPSLAVVLPRSGLG
DUT_RALSO       -----------------LPQYATPGSAGLDLRACLDATLEPGSTHLIPTGMAIHLAPGYAALILPRSGMG
DUT_NITEU       ------VDIKLLDPRLQFPGYATPGSAGLDLRACIDEEIHPGETLLIPSGIAIHLAPGFAAMVLPRSGLG
DUT_ERWT9       ----------RVGTDFPLPTYATSGSAGLDLRACLNTVLQPGATTLLPTGLAIHIADPQLAVILPRSGLG
438L_IIV6       -TPILQIKFAALTEYAQKPKRGSEFSAGIDLRSAYEYLVPANGNKLIKTDWKIQYPDGYFGKICSRSGLS
DUT_METFK       -----------------LPSYATPGSAGLDLRACTEQTLAPGETIMIPTGMAIHLAPHYAALILPRSGLG
DUT_BURM1       -----------------LPAYATAGSAGLDLRACLDATLKPGDTALVPTGLAIHLAPNYAALILPRSGLG
DUT_PSYWF       ------------DANFPMPTRATDGSAGIDLRACIDETIKAGETKLIGTGMAIYIAPNYAGIILPRSGLG
DUT_NITEC       ------------------PGYATPGSAGLDLRACIDTEIHPGETLLIPSGIAIHLANGFAAVVLPRSGLG
DUT_METPP       -----------------LPAYATPGSAGLDLRACLDALLEPGQTQLIPTGLSIHIDPGLAAVILPRSGLG
DUT_LEPCP       -----------------LPAYATPGAAGLDLRACIDLPIAPGQTTLIPTGIAIHIAPGLAAIILPRSGLG
DUT_HAMD5       ----------------PLPTYTTSGSAGLDLRVCTQAPLSPGETRLLPTGLAVHIAPHLAAMILPRSGLG
DUT_POLSQ       -----------------LPSYGTPGSAGLDLRACIDEAIVPGQTVLVPTGLAIYVEDPRAAFILPRSGLG
DUT_HERAR       ------VKILDPRMQEQMPAYATSGSAGLDLRACIEATIKPGETHLIPTGLAIHIGNPAAAVILPRSGMG
DUT_CHRVO       ----AVIDVKILDARLRLPAYATAGSAGLDLRAATEETIQPGETQLVPTGIAIHLSPGLAAMLLPRSGLG
DUT_BORA1       -----------------LPTYATPGSAGLDLRACIDKAITPGATTLVPTGLAIHVAPGYAAIILPRSGLG
DUT_BAUCH       ------IKILRIGDCFKLPKYATPGSAGIDLRACIDNTISPGETNLISTGLAVHIATGLAGIIIPRSGLG
DUT_AZOSE       ------------------PAYATPGAAGLDLRACLNAPVTPGETTLIPSGLAIHLAPGLAAMVLPRSGLG
DUT_ENCCU       ---VSEIRVRKINPRAKIPKRQSEGAAGYDIHSVESGRIPPNGRKSVRTGLAWDVPQSVVGLVFGRSGLA
DUT_YERE8       ------IKILRVGNEFPLPTYATEGSAGLDLRACLSEAVDXXXXXXXXXXXXXAIHIGDSSLILPRSGLG
DUT_BURPS       -----------------LPKYATTGSAGLDLRACLDAPVTPGDTALVPTGLAIHLAPGYAALILPRSGLG
DUT_BURP6       -----------------LPKYATTGSAGLDLRACLDAPVTPGDTALVPTGLAIHLAPGYAALILPRSGLG
DUT_BURP1       -----------------LPKYATTGSAGLDLRACLDAPVTPGDTALVPTGLAIHLAPGYAALILPRSGLG
DUT_BURP0       -----------------LPKYATTGSAGLDLRACLDAPVTPGDTALVPTGLAIHLAPGYAALILPRSGLG
DUT_BURMS       -----------------LPKYATTGSAGLDLRACLDAPVTPGDTALVPTGLAIHLAPGYAALILPRSGLG
DUT_BURMA       -----------------LPKYATTGSAGLDLRACLDAPVTPGDTALVPTGLAIHLAPGYAALILPRSGLG
DUT_BURM9       -----------------LPKYATTGSAGLDLRACLDAPVTPGDTALVPTGLAIHLAPGYAALILPRSGLG
DUT_BURM7       -----------------LPKYATTGSAGLDLRACLDAPVTPGDTALVPTGLAIHLAPGYAALILPRSGLG
DUT_LEGPH       MHQVIQLKILRIGDTIPLPAYATDGSAGLDLRVSEPMQVAPQQTVLLPTGIAIYIADPKLAVILPRSGLG
DUT_LEGPC       MHQVIQLKILRIGDTIPLPAYATDGSAGLDLRVSEPMQVAPQQAVLLPTGIAIYIADPKLAVILPRSGLG
DUT_LEGPA       MHQVIQLKILRIGDTIPLPAYATDGSAGLDLRVSEPMQVAPQQTVLLPTGIAIYIADPKLAVILPRSGLG
DUT_BUCAT       ------IKILRMKNNFSLPSYATLGSSGLDLRACLDETVKKAHKTIIPTGIAIYIANPNIALILPRSGLG
DUT_BUCAI       ------IKILRMKNNFSLPSYATLGSSGLDLRACLDETVKKAHKTIIPTGIAIYIANPNIALILPRSGLG
DUT_BUCA5       ------IKILRMKNNFSLPSYATLGSSGLDLRACLDETVKKAHKTIIPTGIAIYIANPNIALILPRSGLG
DUT_BORPE       -----------------LPAYATPGSAGLDLRACTEAVIEPGQTVLVPTGLAIHIDPRYAAMILPRSGLG
DUT_BLOFL       -----------------LPQHITPGSAGLDLLACIEKPVSPKETRLIPTGIAIYIEIEVAGIILPRSGLG
DUT_LEGPL       MHQVIQLKILRIGDTISLPAYATDGSAGLDLRVSEPMQVAPQQTVLLPTGIAIYIADPKLAVILPRSGLG
DUT_ENTS8       ----------RVGEQFPLPTYATSGSAGLDLRACLDESVEXXXXXXXXXXIHIADP-SLAAVILPRSGLG
DUT_PSEPF       ----------RIGTEFPLPQYATPGSAGLDLRAMLDIVIKPGETVLIPTGLSVYIDPNLAALILPRSGMG
DUT_POLNS       -----------------LPTYGTPGSAGLDLRACIDEAIAPGQTVLVPTGLAIYVEDPRAAFILPRSGLG
POL_FIVT2       -----------------LEKRSE--DAGYDLLAAAQETFLPGEVRIVPTKTRIMLPKGHWGLIMGKSSIG
POL_EIAVY       -------------------------DAGFDLCVPYDIMIPVSDTKIIPTDVKIQVPPNSFGWVTGKSSMA
POL_EIAVC       -------------------------DAGFDLCVPYDIMIPVSDTKIIPTDVKIQVPPNSFGWVTGKSSMA
POL_EIAV9       -------------------------DAGFDLCVPYDIMIPVSDTKIIPTDVKIQVPPNSFGWVTGKSSMA
DUT_LARHH       ------------------PAYATPGSAGLDLRAAIDAEIRPGETRLIPTGIALHLEDPRAAMILPRSGLG
DUT_BUCBP       ----------RIGTQFSLPSYATSGSSGLDLRACISIILLPNETVLIPTGIAVYIDDPYIAIILPRSGLG
POL_CAEVC       -----------------LPKREE--DAGYDLICPEEVTIEPGQVKCIPIELRLNLKKSQWAMIATKSSMA
DUT_FRAP2       ------IELKLLNKEIEVPEYGTEGSAAVDLRACLSEALSPGECKLIGTGXXXXXXXXXXXXXXPRSGLG
VPRT_SRV2       --------------------RASPGSAGLDLCSTTHTVLTPEGPQTLATGVYGPLPPNTFGLILGR-GST
VPRT_MPMV       -TSLWGSQLCSSQQKQPISKRATPGSAGLDLCSTSHTVLTPEMGQALSTGIYGPLPPNTFGLILGRSSIT
DUT_YMTV        -----------------IPTRSSKKSAGYDLYSAYDYLVRPKSRVLVKTDICLSIPDECYGRIASRSGLS
VPRT_SRV1       --------------------RATPGSAGLDLSSTSHTVLTPEMGQALSTGIYGPLPPNTFGLILGRSSIT
POL_OMVVS       -----------------LPKRAE--DAGYDLICPQEVCIPAGQVRKIPINLRINLKEDQWAMVGTKSSFA
DUT_LACLA       -----------------IPKRSTEHSAGYDIEAAETVSFAPGEIKLIPTGLKAYMQAGEVLYMYDRSSNP
DUT_ICHV1       --------------DVSIPKISSPGSAGFDLSVLEDREFIRGCHYRLPTGLAIAVPRGYVGIITPRSSQA
VPRT_MMTVB      --------------------RGTPGSAGLDLSSQKDLILSEDGVSLVPTLVKGTLPEGTTGLIIGRSS-N
POL_VILVK       -----------------LQKRAE--DAGYDLICPQEISIPAGQVKRIAIDLKINLKKDQWAMIGTKSSFA
POL_VILV2       -----------------LQKRAE--DAGYDLICPQEISIPAGQVKRIAIDLKINLKKDQWAMIGTKSSFA
POL_VILV1       -----------------LQKRAE--DAGYDLICPQEISIPAGQVKRIAIDLKINLKKDQWAMIGTKSSFA
POL_VILV        -----------------LQKRAE--DAGYDLICPQEISIPAGQVKRIAIDLKINLKKDQWAMIGTKSSFA
DUT_FRATW       ------------------PGYATEGSAAIDLRASESIYLKSGECKLVATGXXXXXXXXXXXXXXPRSGLG
DUT_FRATT       ------------------PGYATEGSAAIDLRASESIYLKSGECKLVATGXXXXXXXXXXXXXXPRSGLG
DUT_FRATN       ------------------PGYATEGSAAIDLRASESIYLKSGECKLVATGXXXXXXXXXXXXXXPRSGLG
DUT_FRATM       ------------------PGYATEGSAAIDLRASESIYLKSGECKLVATGXXXXXXXXXXXXXXPRSGLG
DUT_FRAT1       ------------------PGYATEGSAAIDLRASESIYLKSGECKLVATGXXXXXXXXXXXXXXPRSGLG
DUT_FRATO       ------------------PGYATEGSAAIDLRASESIYLKSGECKLIATGXXXXXXXXXXXXXXPRSGLG
DUT_FRATH       ------------------PGYATEGSAAIDLRASESIYLKSGECKLIATGXXXXXXXXXXXXXXPRSGLG
DUT_FRATF       ------------------PGYATEGSAAIDLRASESIYLKSGECKLIATGXXXXXXXXXXXXXXPRSGLG
DUT_BUCAP       ------IKIRILDSNIKLPQYATPGSSGLDLRASIKKKISLPSKEVVPTGIAIHIDNPYIALVLPRSXXX
VPRT_JSRV       --------------------RATRGSAGLDLCATSYTVLTPEMGVQTLAXXXXXXXXXXXXXXXXXRSSA
POK4_HUMAN      ----------------------------VDLCTIQAVSLLPGEPQKIPTGVYGPLPEGTVGLILGRSSLN
DUTP_ASFB7      -----------------------RKDLGVDVYCCSDLVLQPG-LNIVRLHIKVACEMGKCGFIMARSSMC
DUTP_ASFK5      -----------------------RQDLGVDVYCCSDLVLQPG-LNIVRLHIKVACEHRGKKCIMARSSMC
DUTP_ASFWA      -----------------------RKDLGVDVYCCSDLVLQPG-LNIVRLHIKVACEMGKCGFIMARSSMC
DUTP_ASFP4      -----------------------RKDLGVDVYCCSDLVLQPG-LNIVRLHIKVACEMGKCGFIMARSSMC
DCD_METMJ       -------------------------------------VLAPGRFLLAETLEAIELPDDIVASIEGKSSIA
DCD_AQUAE       ----------------------------------------------------ISLPPYVTAFVEGRSSLG
DUTP_ASFM2      -----------------------RKDLGVDVYCCSNLVLQPG-LNIIPLHIKVACEMGKCGFIMARSSMC
DCD_THEAC       ---------------------------------------------LVSTIEILKIPDDVVGMIWTRSSFA
DCD_METB6       --------------------------------------LLPGQFVLAETLECISLPDNIVATIEGKSSIA
GAG_IPMA        ------------------PRKTHK----VDLRAASDFLLMPQMSQPVPVEPIPSLPLGTMGLILGRQGLV
VPRT_SMRVH      -------------------------------------------------GIYGPLPPQTFGLILAEPALP
DCD_AERPE       -----------------------------------EIIVGPGEHMLLHTQEYIRLPGYVAGLVNLRS-TW
DCD_METTH       -------------------------------------IIHPGEFALATTHEYIALPEDLVARVEGRSSI-


                         .         .         *         .         .         .         .:140
query           AREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVRGDQ
DUT_CORGB       AREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVRGDQ
DUT_CORGL       AREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVRGDQ
DUT_COREF       AREGLSIVNAPGTVDADYRGEIKVCLINLDPSTPITITRGDRIAQLIIQRXXXXXXXXXXXXXXTTRGDQ
DUT_CORJK       LKKGLSIVNAPGTIDADYRGEIKVCLINLDPEEPIELARGERIAQLLVQECDVEEVNSVEELGVTVRGES
DUT_CORDI       LKEGLSIVNTPGTIDADYRGEIKVCLINLDPTTPIRIERGERIAQLLVQKVELVDFCEVETLSETERGVN
DUT_RHOE4       AKSGLSIVNAPGTVDAGYRGELKVCLINLDPATAIDIRRGDRIAQLVVQR--------------------
DUT_NOCFA       AKTGLSVVNTPGTVDAGYRGEIKVCLINHDPRTPIELRRGDRIAQLLVQR--------------------
DUT_MYCSK       ARVGLSIVNSPGTIDAGYRGEIKVSLINLDPHAPIVIRRGDRIAQLLVQR--------------------
DUT_MYCSJ       ARVGLSIVNSPGTIDAGYRGEIKVSLINLDPHAPIVIRRGDRIAQLLVQR--------------------
DUT_MYCS2       ARVGLSIVNSPGTIDAGYRGEIKVSLINLDPQTPVVISRGDRIAQLLVQR--------------------
DUT_MYCVP       ARVGLSIVNSPGTVDAGYRGEIKVSLINLDPAAPIAIRRGDRIAQLLVQR--------------------
DUT_MYCGI       ARVGLSIVNTPGTVDAGYRGEIKVCLINLDTSTPITIGRGDRIAQLLVQR--------------------
DUT_MYCPA       ARVGLSIVNSPGTIDAGYRGEIKVALINLDPAEPIVVHRGDRIA--------------------------
DUT_MYCA1       ARVGLSIVNSPGTIDAGYRGEIKVALINLDPAEPIVVHRGDRIA--------------------------
DUT_MYCMM       SRVGLSIVNSPGTIDAGYRGELKVALINLDPATPIVVNRGDRIA--------------------------
DUT_MYCUA       SRVGLSIVNSPGTIDAGYRGELKVVLINLDPATPIVVNRGDRIA--------------------------
DUT_MYCTU       TRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIA--------------------------
DUT_MYCTA       TRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIA--------------------------
DUT_MYCBT       TRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIA--------------------------
DUT_MYCBP       TRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIA--------------------------
DUT_MYCBO       TRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIA--------------------------
DUT_THEFY       ARHGLTVVNAPGTVDAGYRGEIKVPLLNTDPATPVKLTRGDRIAQLVIQR--------------------
DUT_MYCLE       VRVGLSIVNSPGTVDAGYRGEIKVALINLDPVEPLVVHRGDRIA--------------------------
DUT_MYCLB       VRVGLSIVNSPGTVDAGYRGEIKVALINLDPVEPLVVHRGDRIA--------------------------
DUT_STRGG       ARCGVALVNAPGTVDAGYRGEIKVIVVNLDPRESVRFERFDRIAQLVVQQVEKVRFHEVAELPGSARAEG
DUT_BIFLI       AKQGVTVLNAPGTVDAGYRGEIKVPLINLDPKHTAVFHPGDRIAQLVIQRYVEARFIPAETLPGSDRAER
DUT_BIFLO       AKQGVTVLNAPGTVDAGYRGEIKVPLINLDPKHTAVFHPGDRIAQLVIQRYVEARFIPAETLPGSDRAER
DUT_BIFLD       AKQGVTVLNAPGTVDAGYRGEIKVPLINLDPKHTAVFHPGDRIAQLVIQRYVEARFIPAETLPGSDRAER
DUT_STRCO       ARCGVALVNAPGTIDAGYRGEIKVIVVNLDPRESVRFERFDRIAQLXXXXXXXXXXXXXAELPGSARAEG
DUT_PROAC       ARHGLSIVNAPGTIDSGYRGQINVLLVNTDPREPVHLDAGSRIAQLVVVPVVEAIFEPVEDLDDTERGQG
DUT_STRAW       ARCGVALVNAPGTVDAGYRGEIKVIVVNLDPRESVRFERFDRIAXXXXXXXXXXXXXXXAELPDSARAEG
DUT_LEIXX       MKHGLTIVNAPGTVDAGYRGEIRVTVLNTDRSMPYDIAVGDRIAQLIVMPVTRAVFVPVDTLPDSHRGTA
DUT_TROWT       SENGITLVNSPGVIDAGYRGEISVVLINTDLHQAFHISQGDRIAQLVIMPVCHASFIEVDTLPGSARGIS
DUT_TROW8       SENGITLVNSPGVIDAGYRGEISVVLINTDLHQAFHISQGDRIAQLVIMPVCHASFIEVDTLPGSARGIS
DUT_ANASK       ARHGVGMVNAPGTIDADYRGEVGVILVN-HGQAPVAFARGDRIAQLVIAPVVRAELELVDALSDSDRGAG
DUT_ANADE       ARHGVGMVNAPGTIDADYRGEVGVILVN-HGQAPVAFARGDRIAQLVIAPVVRAELELVDALTDSDRGAG
DUT_ANAD2       ARHGVGMVNAPGTIDADYRGEVGVILVN-HGQAPVAFARGDRIAQLVIAPVVRAELELVDALSDSDRGAG
DUT_CLOK5       LAHGITLLNSPGTIDEGYRGEIKVLMINLGQE-GFLIKKGMKIAQMVIKPIEQVLIKEVVELKDTERGEG
DUT_EHRCJ       LKFGITVLNTPGTIDADYRGEIKVILINLGHE-TYTIKYGDRIAQMVIAPHASWNLVKDLDDDTTKRGDQ
DUT_NEOSM       AKFGITVLNSPGTVDQDYRGEIKVCLVNLS-KNEFTINRGDRIAQMVIAKVEQILLVEAEEIGETERASG
DUT_GEOBB       LRHGIALVNSPGTIDADYRGEIGVILINLGSE-PFTVSDGERIAQMVFARCERAEFIEVDELGDTARGAG
DUT_DICTD       AREGISVLNTPGLIDSDYRGEIFVNLINFS-NKPFLGKRGMRIAQLLVLQYSRIIWEEVEQLPQTERGEG
DUT_WOLPP       AKHGITVLNSPGTIDSDYRGEVKVCLINLS-NQPYEIKRGDRIAQILITPEIIWNNIEEFYAKETARNEG
DUT_SPHWW       LKHGVTCLNTPGTIDADYRGEVKVILANLGSE-PFEVKRGERIAQLVPAAVQRAAFAEVSDLDETARGAG
DUT_PELLD       LRNLISLPNSPATIDADYRGEVKVILVN-HGRDPFKVSHGDRIAQMVVARVEQVSFVEVDTLGDTERGEG
DUT_CLOTE       LKNGVTVLNTPGTIDAGYRGEIGIILIN-HGEKNFQVEKGMKIAQMVIKPIVKVNIEEVKMLSESQRGKG
DUT_GEOSM       LRHGIALVNSPGTIDADYRGEIGVILINLG-SAPFTVSDGERIAQMVFARCERAEFIEVEELGDTARGAG
DUT_AQUAE       WKKGLTVLNAPGTIDADYRGEVKVILVNLGNEE-VVIERGERIAQLVIAPVQRXXXXXXXXXSQTQRGEG
DUT_GEOSF       LKHGISLVNSPGTIDADYRGEIGVIVINHGNE-PFVISNNERIAQMVFAPFTRAVFQDVAELGETARGEG
DUT_GLUOX       LKHGITLPNSPGTIDEDYRGELRIIVMNAGTE-PFTVERGTRIAQGVLAPVSRLRWTEVETLDETARGEG
DUT_ACAM1       LKHSITVLNSPGTIDAGYRGEIGVILIN-HGQETFQVVEGMKIAQMVIAPIMRAEIEEVTELSATQRGEG
DUT_THETN       LNYGITLLNTPGTVDSDYRGEIKLIVINLG-KQPVTIKRGQRIAQMVINQVVRPKIIEVEELSETERMDR
DUT_DICT6       AKEGISILNTPGLIDSDYRGEIFVNLINFS-NKTFYGKRGMRIAQLLVLQYAHVMWEEVSQLPQTERGEG
DUT_PELCD       LHHGVTLVNTPGTIDADYRGELGIIIIN-HGDEDFVVSPGDRIAQLVIAPVHRAVLETVEELDETDRNEG
DUT_WOLTR       AKYGITVLNSPGTIDSDYRGEVKVCLINLS-NQPYEIKRGDRIAQILIAPRVIWDDAERLCTEETERSAG
DUT_WOLPM       AKHGITVLNSPGTIDSDYRGEVKICLINLS-NQPYEIKRGDRIAQILISSQVIWDDREEFCAEETGRNAG
DUT_WOLWR       AKHGITVLNSPGTIDSDYRGEVKICLINLS-NQPYEIKRGDRIAQILISSQVIWDDREEFCAEETGRNAG
DUT_RHOPS       AKHGVTVLNAPGTIDADYRGEIGVLLIN-HGDAPFTIRRGERIAQMVIAPVVRAELIGVETLSETARGVG
DUT_SYNAS       LKHGVTLVNAPGTIDADYRGEIGVLLIN-HGNDPFVVARGSRVAQMVIAPVCRVAWSESGSLETTTRGDG
DUT_ANAMM       ANFGICVLNAPGTIDSDYRGEITVVLSNFGSE-DYVISRGDRVAQMVIAPVERVEWEEVNSITATSRGEG
DUT_ANAMF       ANFGICVLNAPGTIDSDYRGEITVVLSNFGSE-DYVISRGDRVAQMVIAPVERVEWEEVNSITATSRGEG
DUT_OLICO       VKHGVTVLNAPGTIDADYRGEIGVPLINHGRE-TFIIRRGERIAQMVVAPVVQIAFEPVAELPMSARGAG
DUT_NITWN       ARHGVTVLNSPGTVDADYRGEINVLLVNLGSE-AFTIRRGERIAQMIVAPVTRVELVRAAALPATPRGSG
DUT_ANADF       VRHGVGMVNAPGTIDSDYRGEVGVVLVN-HGQEPVTFARGDRIAQLVI----------------------
DUT_SYNWW       LKYGITLLNTPGTIDADYRGEIKVIVINLG-DKDYILKRGERIAQMVFSRVEKAEFMEVKSLDETLRGAG
DUT_PROA2       LKYAISLPNAPATIDADYRGEVKVILVNLGQE-PFCVNHGDRIAQMVIARYEHAELQEVEELSRTPRGSG
DUT_RHIL3       FKNGITCLNSPGTVDSDYRGEVKVLLANLG-EEAFVISRGMRIAQMVIAPVTQMRVAEITEASETMRGAG
DUT_ZYMMO       LKHGIACPNAPGTIDSDYRGEVKILLINLGSE-AFEIKRGDRIAQLILASVTQAVFCEVTDLDDTQRGHN
DUT_RHOP2       AKHGVTVLNAPGTIDADYRGEIGVLLINHGKE-PFTIRRGERIAQMIIAPVVRAELISVETLSETARGVG
DUT_ACICJ       LKHGIVIPNSPGTIDSDYRGEIQVIVLNAGTE-AFEVTRGMRIAQAVLAPVSRLVWQETDDLDRTAREAG
DUT_HYDS0       LKKGVTVLNSPGTIDHDYRGEIKVILINLS-DKEVIIEKGERIAQMXXXXXXXXXXXXXXXXSNTQRQDG
DUT_THEPX       LNYGITLLNTPGTIDSDYRGEIKLIVINLGKE-AVKIARGQRIAQMVINQIVRPTIVEAEILSETKRDEG
DUT_THEP3       LNYGITLLNTPGTIDSDYRGEIKLIVINLGKE-AVKIARGQRIAQMVINQIVRPTIVEAEILSETKRDEG
DUT_RICBR       AKNGITVANSPGTIDADYRGEIKVILINLGKD-DFVIEKGMRIAQMVISKYERISWKESETLEETARGSG
DUT_RICB8       AKNGITVANSPGTIDADYRGEIKVILINLGKD-DFVIEKGMRIAQMVISKYERISWKESETLEETARGSG
DUT_RICAH       VKHGITVANSPGTIDADYRGEIKVILINLGTQ-DFVIEKGMRIAQIIISKYERILWEESSILTETMRGSG
DUT_RICTY       IKHGITVANSPGTIDADYRGEIKVLLINLG-KKDFLIERGMRIAQMIIAKYERVLWAETSILTETMRGRG
DUT_RICPR       VKHGITVANSPGTIDADYRGEIKVLLINLG-NKDFIIEKGMRIAQMIIAKYERVLWAETSILTETMRGRG
DUT_TRIEI       LKHQITVLNTPGTIDETYRGEIGIILIN-HGKNSFQVTKRMKIAQMVITSVLSVKVEEVNQLSTTQRDIN
DUT_RICFE       VKHGITVANSPGTIDADYRGEIKVILINLGKE-DFVIEKGMRIAQMIIAKYERILWEESSSLTETMRGSG
DUT_RHIEC       FKHGITCLNSPGTVDSDYRGEVKVLLANLG-EEAFVIERGMRIAQMVIAPVTQARVTEIAAASETARGAG
DUT_PORGI       LRHGITLVNSPGTIDADYRGEIGIIMINLS-NTPFTIADGERICQLVIARHEQAEWVLTDELADTERGAG
DUT_PORG3       LRHGITLVNSPGTIDADYRGEIGIIMINLS-NTPFTIADGERICQLVIARHEQAEWVLTDELADTERGAG
DUT_CLONN       LKHGITVLNTPGTIDEGYRGEIGIILINLGSEE-FKVEEGMKIAQMVIKPXXXXXXXXXXXXXXXXRGEN
DUT_CLODI       LKHSVTVLNTPGTIDEGYRGELKIILIN-HGKNDFKVEKHMKIAQMIVKPIYDINIEEVKELSDSERGKG
DUT_CLOD6       LKHSVTVLNTPGTIDEGYRGELKIILIN-HGKNDFKVEKHMKIAQMIVKPIYDINIEEVKELSDSERGKG
DUT_RICM5       VKHGITVANSPGTIDADYRGEIKVILINLGKE-DFIIEKGMRIAQMIIAKYERILWEESSSLMETMRGSG
DUT_AGRRK       FKNGITCLNSPGTVDSDYRGEVKVLLIN-HGDEPFEITRGMRIAQVVIAPVTQVRVAEITEVSDTARGAG
DUT_RICCK       VKHGITVANSPGTIDSDYRGEIKVILINLGKE-DFIIEKGMRIAQMIISKYERILWKESNTLEETVRGSG
DUT_RHOCS       LKHGITLLNSPGTIDADYRGEVGVILANLGAD-PFTVERGMRIAQMVIAR--------------------
DUT_CLOAB       LKHSITVLNSPGTIDEGYRGEVKIILINHGKE-DFKVEKSMKIAQMVIKPXXXXXXXXXXXXXXXDRGTG
DUT_CHLP8       LRHLISLPNSPATIDADYRGEVGVILINHGRE-PFTVNHGDRIAQMVVSKVDRVAFEEVDSLSDTERGEG
DUT_RHIE6       FKHGITCLNSPGTVDSDYRGEVKVLLANLG-EEAFVIERGMRIAQMVIAPVTQARVAEITAASETARGAG
DUT_PROVI       LRSMITLANSPATIDADYRGEVKVILINHGPQ-PFTVNNGDRIAQMXXXXXXXXXXXXXXXLGETVRGDG
DUT_HELHP       LHNGVSVLNTPGTIDSDYRGEIKVILINHSNE-DFHIHRGDRIAQAVVSEVTQAVFTEVQELGQSVRGER
DUT_FLAJ1       AKKGVTVLNSPGTVDADYRGEIGVILVNLSNEE-FVIENGERIAQLIIAKHERAEWIEVEELSETSRGEG
DUT_RHILW       FKHGITCLNSPGTVDSDYRGEVKVLLANLGDE-AFTVERGMRIAQMVIAPVTQMRVAESAAASETTRGAG
DUT_DESPS       IKHGLTVVNAPGTIDADYRGEVGVGLINLG-RQAVTIHHGDRIAQLVLAPVLQARWTVVTELEATERGAG
DUT_PARL1       AKNGVTVLNSPGTVDCDYRGEVKVILINHGAD-AFTIERGTRIAQMVV----------------------
DUT_DEBHA       VKHGIS--TGAGVIDADYRGEVKVVLFN-HAQKDFTIQKGDRIAQLVLEKMADIKQITAEELDITARGEG
DUT_CAUCR       LKNGVTVVNAPGTVDSDYRGQVCVLLINLG-EEDFTIRRGDRIAQGVIAAAPQWPLVEVEDLDATERGAG
DUT_CAUCN       LKNGVTVVNAPGTVDSDYRGQVCVLLINLG-EEDFTIRRGDRIAQGVIAAAPQWPLVEVEDLDATERGAG
DUT_RICRS       VKHGITVANSPGTIDADYRGEIKVILINLGKE-DFIIEKGMRIAQMIIAKYERILWEESISLMETMRGSG
DUT_RICRO       VKHGITVANSPGTIDADYRGEIKVILINLGKE-DFIIEKGMRIAQMIIAKYERILWEESISLMETMRGSG
DUT_RICCN       VKHGITVANSPGTIDADYRGEIKVILINLGKE-DFIIEKGMRIAQMIIAKYERILWEESSSLMETMRGSG
DUT_RICAE       VKHGITVANSPGTIDADYRGEIKVILINLGKE-DFIIEKGMRIAQMIIAKYERILWEESSSLMETMRGSG
DUT_GLOVI       ARHGISVLNTPGLIDCGYRGEIQVLLIN-HGEVPVVVSRGDRIA--------------------------
DUT_BACV8       IKKGIGVLNSPGTIDADYRGEICIILVNLSSE-DFMIEDGERIAQMVVARHEHAEWQEVEVLDETERGAG
DUT_CHLTE       LRHCISLPNSPATIDADYRGEVGVILINHGRE-PFTVSHGDRIAQMVVAKVDHVVFEEVESLSETARGEG
DUT_CHLCH       LRSMISLPNTPATIDADYRGEVKVILINYGKE-PFMVQHGDRIAQMVIARVEQVQFEEVAELSATVRGEG
DUT_NAUPA       FKHGITVLNTPGTIDSDYRGEIKVLLINHSNE-AFEIKKEERXXXXXXXXXXXXXXXXXXXLSDTERGAG
DUT_CYAP7       LKHQITVLNTPGTVDEGYRGEIGVILIN-HGKNSFKVTRGMKIAQMVI----------------------
DUT_ALKMQ       LKNSITVLNTPGTIDEGYRGEIGVILINHGKES-FKVEKHMKVAQMVIKPVLKVKILEVDELSDTQRAEG
DUT_RHOSK       LKHGISLPNSPGTIDSDYRGPLGVILVNLGAE-PFRVAHGDRIAQMVVAPVVQAGFELVEGLGATARGAG
DUT_FINM2       IKHGITLINCVGTIDSDYRGEIKIPVVNLSNEE-YTISTGDRICQMILQKYENIEFAEVEVLDETDRNDG
DUT_CHLL2       LKHLISLPNSPATIDADYRGEVRVILVNFGKE-PFSVAHGDRIAQMVVSRVERVDFDEAEELSMTQRGEG
DUT_RICPU       VKHGITVANSPGTIDADYRGEIKVILINLGKE-DFIIEKGMRIAQMIIAKYERILWEESISLMETMRGSG
DUT_GEOSL       LKHGIALVNSPGTIDPDYRGEIGVIIVNHGAD-AFVVRRGERIAQMVFAPFVRAELLDVDELDETARGDG
DUT_CYTH3       FKHGITVLNSPGTIDADYRGEIKVLLVNLSNE-AFTIQSGERIAQIVIAKVEHAHFVEVEELSDSLRAAA
DUT_CHLPB       LKHMISLPNAPATIDADYRGEVMVILVNYG-KTPFIVCHGDRIAQMVVARYEHVRLEEVKALSETDRGDG
DUT_BRUSU       FKNGITCLNTPGTIDSDYRGEVKVLLINLG-DDDFRIERGMRIAQAVFAPVIQPKIEERAKISETARGAG
DUT_BRUSI       FKNGITCLNTPGTIDSDYRGEVKVLLINLG-DDDFRIERGMRIAQAVFAPVIQPKIEERAKISETARGAG
DUT_BRUME       FKNGITCLNTPGTIDSDYRGEVKVLLINLG-DDDFRIERGMRIAQAVFAPVIQPKIEERAKISETARGAG
DUT_BRUMB       FKNGITCLNTPGTIDSDYRGEVKVLLINLG-DDDFRIERGMRIAQAVFAPVIQPKIEERAKISETARGAG
DUT_BRUC2       FKNGITCLNTPGTIDSDYRGEVKVLLINLG-DDDFRIERGMRIAQAVFAPVIQPKIEERAKISETARGAG
DUT_BRUAB       FKNGITCLNTPGTIDSDYRGEVKVLLINLG-DDDFRIERGMRIAQAVFAPVIQPKIEERAKISETARGAG
DUT_BRUA2       FKNGITCLNTPGTIDSDYRGEVKVLLINLG-DDDFRIERGMRIAQAVFAPVIQPKIEERAKISETARGAG
DUT_BRUA1       FKNGITCLNTPGTIDSDYRGEVKVLLINLG-DDDFRIERGMRIAQAVFAPVIQPKIEERAKISETARGAG
DUT_RHOS4       LKHGISLPNSPGTIDSDYRGPLGVILVNLGDE-PFRVAHGDRIAQMVVAPVVQARFELADGLGATARGAG
DUT_GEOMG       LKHGIALVNSPGTIDPDYRGEIGVILINHGSE-PFVVRRGERIAQMVFAPFARAELVEVDELDETARGEG
DUT_BRAJA       AKHGVTVLNSPGTIDADYRGEIKVILIN-HGAAAFVIKRGERIAQMXXXXXXXXXXXXXXTLSATDRGAG
DUT_RHILO       FKHGLTVLNSPGTVDSDYRGEVKVLLINLGDE-DFAVTRGMRIAQIV-----------------------
DUT_CHLPD       LRHLISLPNTPATIDADYRGEVKIILINYGQE-PFVVHHGDRVAQMVVAKVERVFFDEVLTLASSSRADG
DUT_SOLUE       LKHAITIPNAPGTIDPGYRGEVRVIMLNLGRD-AYTVHAGDRIAQMIVTRYEAVEWLEGSLADST-RGAG
DUT_ORITI       SKFGVIVLNSPGTIDSDYRGELKIIMINLG-QKDFQLTPAMRIAQMVIAKYEVISWEIVDDLDETERGEK
DUT_BEII9       RKHGVTVLNTPGTIDADYRGEIGVILINMGDE-PFEIVRGTRIAQLVVAPCVQAELIETHTLSDTERGED
DUT_MARMM       AKHGISCVNTPGTVDADYRGEIRVNLIN-HGQANFVVNRGDRIAQMII----------------------
DUT_PELPB       LRSMISLPNTPATIDADYRGEVKVILINYGKE-PFLVSHGDRIAQMVVAK--------------------
DUT_AGRT5       IKNGITCLNSPGTVDSDYRGEVKVILANLG-QDDFTIERGMRIAQMVIAPXXXXXXXXXXXXXXXARGAG
DUT_SYNP2       LKQSVTVLNSPGTIDANYRGEIGVILIN-HSDTVFEVKAGMRIAQMVM----------------------
DUT_ORITB       SKFGVIVLNSPGTIDSDYRGELKIIMINLG-QKDFQLTPAMRIAQMVIAKYEVVSWELVDDLDETERGKN
DUT_BRASO       ARHGVTVLNSPGTIDADYRGEVCVLLINHGKE-PFTIQRGERIAQMVIASVVRAELAITTTLSETARGSG
DUT_AZOC5       LKFGVTVLNAPGTIDADYRGEVGVILINHGRE-PFTVSRGMRIAQMVIAGVQQITLVETGNLGETARGVG
DUT_RHOPB       ARHGVTVLNAPGTIDADYRGEIGVLLIN-HGSQPFTVRRGERIAQMVVARVARVDLTVAASLETTERGSG
DUT_NITHX       AKHGVTVLNSPGTVDADYRGEINVLLVNLG-NAPFTIRRGERIAQMIV----------------------
DUT_BACTN       IKKGITVLNSPGTIDADYRGEVCIILVNLSSE-PFVIEDGERIAQMVIAR--------------------
DUT_SCHPO       SKH--SIDTGAGVIDADYRGHVRVLLFNYDVDFPIKV--GDRIAQLILERIVNPPVILVESLEATVRGAN
DUT_CYAA5       LKHQITVLNTPGTIDEGYRGEIGVILIN-HGKRSFKVTEGMRIAQMVIAPVIRVKIQEVEQLSDTIRGQG
DUT_SINMW       FKHGITCLNTPGTVDSDYRGEVKVLLVNLGSD-DFVVERGMRIAQMVI----------------------
DUT_RHOPT       AKHGVTVLNAPGTIDADYRGEIGVLLINHGTE-PFAIRRGERIAQMVI----------------------
DUT_RHOPA       AKHGVTVLNAPGTIDADYRGEIGVLLINHGTE-PFAIRRGERIAQMVI----------------------
DUT_FUSNN       IKHGITMLNTPGTVDSDYRGELKVIVVNLSNE-AYTIEPNERIGQFVLNKIEQIEFVEVEELDSTERGES
DUT_BDEBA       AKSGLTVLNTPGTIDADYRGEVKIIVINLGNE-AVTINDQERCAQLVLAPVIQAQFELVNELSDTERGAG
DUT_WOLSU       LKHGITVLNTPGTVDSDYRGEIKVILINLGAES-FSIQAGDRIAQGVVSRLSIAELCEVESLDETARGAG
DUT_HUMAN       AKHFIDV--GAGVIDEDYRGNVGVVLFNFGKEK-FEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSG
DUT_TREPS       LEYGVTVLNSPGTIDADYRGEIRVLLVNLG-LAAFVVSHGDRIAQAVISSVLRVEYVRSGSISLTERGKG
DUT_TREPA       LEYGVTVLNSPGTIDADYRGEIRVLLVNLG-LAAFVVSHGDRIAQAVISSVLRVEYVRSGSISLTERGKG
DUT_HALHL       LKHGLRVAQGIGVIDSDYHGEIGVILAH-DGTEPYTITPGERIAQLLFQPVVQVTLDYVSAFSATTRGEG
DUT_BACFR       LKKGITVLNSPGTIDADYRGEICIILVNLSAE-TFVIEDGERIAQMVIAR--------------------
DUT_BACFN       LKKGITVLNSPGTIDADYRGEICIILVNLSAE-TFVIEDGERIAQMVIAR--------------------
DUT_RHIME       FKHGITCLNTPGTVDSDYRGEVKVLLVNLGAE-DFAVERGMRIAQMVI----------------------
DUT_BARHE       LKHGITCLNTPGTIDSDYRGEVKVLLINCGQE-DFAIKRGMRIAQTVIANVCALEPQQNESTKNTVRGAG
DUT_RAT         VKHFIDV--GAGVIDEDYRGNVGVVLFNFGKEK-FEVKKGDRIAQLICERILYPDLEEVQTLDNTERGSG
DUT_HELMI       LRHGITLLNSPGTVDADYTGDVGVILINLG-DKHVDIRKKDRVAQLVFQPFHQVXXXXXXXXXXXXXGDG
DUT_HELAH       LNHQVMVLNSPGTVDNDYRGEIKVILANLS-DKDFTIQVGDRIAQGVVQK--------------------
DUT_CHLTR       SKYGVIVLQSPGTVDADYRGEIRVILANLG-EATFIVEPGMRIAQLVVAKEQVSFVETQEELTATARGTG
DUT_CHLTB       SKYGVIVLQSPGTVDADYRGEIRVILANLG-EATFIVEPGMRIAQLVVAKEQVSFVETQEELTATARGTG
DUT_CHLTA       SKYGVIVLQSPGTVDADYRGEIRVILANLG-EATFIVEPGMRIAQLVVAKEQVSFVETQEELTATARGTG
DUT_CHLT2       SKYGVIVLQSPGTVDADYRGEIRVILANLG-EATFIVEPGMRIAQLVVAKEQVSFVETQEELTATARGTG
DUT_CANAL       VKHGIS--TGAGVIDADYRGEVKVVLFN-HSEKDFEIKEGDRIAQLVLEQNADIKEISLEELDNTERGEG
DUT_SILPO       LKHGITLPNTPGTIDSDYRGPLGVILLNAGAE-PFEVVHGERIAQLVV----------------------
DUT_CHLMU       VKYGVIVLQSPGTVDADYRGEIRVILANLG-ESTFIVEPGMRIAQLVVAKEQVSFVETQEELTATARGTG
DUT_HELPJ       LNHQVMVLNSPGTVDNDYRGEIKVILANLS-DKDFKVQVGDRIAQGVVQK--------------------
DUT_CHLPN       LKHGITVLNSPGTIDSDYRGEIRVILINFG-DSTFIIEPKMRIAQVVLSPVQATFVVKQESLAETARGSG
DUT_BARBK       LKNGITCLNTPGTIDSDYRGEVKVLLINLGQE-DFIIERGMRIAQTVI----------------------
DUT_ROSDO       LRHGITLVNSPGTIDSDYRGAVGVIMQNLG-DAAFEITHGMRIAQMVV----------------------
DUT_DESHY       SKYGLALANGVGVIDSDYRGEILVAVINQGSE-PFVVKDGDRIAQMV-----------------------
DUT_DESHD       SKYGLALANGVGVIDSDYRGEILVAVINQGSE-PFVVKDGDRIAQMV-----------------------
DUT_TREDE       LKHGITVLNTPGTVDSDYRGELAVLLINLGNE-DFKIENGDRXXXXXXXXXXXXDFLQKDELSNTERGAG
DUT_HELPH       LNHQVMVLNSPGTVDNDYRGEIKVILANLS-DKDFKVQVGDRIAQGVVQK--------------------
DUT_HELP2       LNHQVMVLNSPGTVDNDYRGEIKVILANLS-DKDFKVQVGDRIAQGVVQK--------------------
DUT_HELPY       LNHQVMVLNSPGTVDNDYRGEIKVILANLS-DKDFKVQVGDRIAQGVVQK--------------------
DUT_HELPS       LNHQVVVLNSPGTVDNDYRGEIKVILANLS-DKDFKVQVGDRIAQGVVQK--------------------
DUT_ADEG8       VKFFIDV--GAGVIDSDYRGIVSVLLFNFS-DHNFNVRRGDRIAQLILERHLTPDLEERSGLDETARGAA
DUT_ACTPJ       HKNGIVLGNLVGLIDSDYQGPLMVSLWNRS-DKPFTVEVGDRIAQLVFVPVVQASFNIVNDFAQTERGEG
DUT_ACTP7       HKNGIVLGNLVGLIDSDYQGPLMVSLWNRS-DKPFTVEVGDRIAQLVFVPVVQASFNIVNDFAQTERGEG
DUT_ACTP2       HKNGIVLGNLVGLIDSDYQGPLMVSLWNRS-DKPFTVEVGDRIAQLVFVPVVQARFNIVNDFAQTERGEG
DUT_IDILO       HKHGLVLGNLVGLIDSDYQGELKVSCWNRS-NQAYTIEPGDRIAQLVILPVVQAQMSIVEEFHETDRGEG
DUT_SOLLC       WKYSIDV--GAGVIDADYRGPVGVVLFN-HSEVDFEVKVGDRIAQLIVQKIVTPEVEQVDDLDSTVRGSG
DUT_METSB       LKAGVTVLNAPGTIDSDYRGEVGVLLINFGAE-PFEIARGERIAQLII----------------------
DUT_LEPBL       TKNQILIPNSPGTIDSDYRGELMIPLFNLG-NIPFVIEHGMRIAQLLIRETHYTNWELVSEFTDTTRGTG
DUT_LEPBJ       TKNQILIPNSPGTIDSDYRGELMIPLFNLG-NIPFVIEHGMRIAQLLIRETHYTNWELVSEFTDTTRGTG
DUT_BARQU       LKHGITCLNTPGTIDSDYRGEIKILLINLGQEN-FSIQRGMRIAQTVI----------------------
DUT_PROMH       HKHGVVLGNLVGLIDSDYQGQLMVSVWNRG-QQAFTIEPGERIAQMVIVPVVQAEFNIVEDFTATERGTG
DUT_LEPIN       TKNRILIPNSPGTIDSDYRGELMIPLLNLG-DSSFIIEHGMRIAQLLIRKWYADWELVSEFADRTERGAN
DUT_LEPIC       TKNRILIPNSPGTIDSDYRGELMIPLLNLG-DSSFIIEHGMRIAQLLIRKWYADWELVSEFADRTERGAN
DUT_PBCV1       YKYGIDVL--AGVIDSDYRGELKAILYN-TTERDYIIKKGDRIAQLILEQ--------------------
DUT_ADEG1       AKFFIDV--GAGVIDPDYRGNVSVVLFNFS-ESSFNIRRGDRVAQLILERIMVPELSELTQLGETDRGAS
DUT_PARUW       LKHQVTVLNTPGTIDADYRGEIKIILIN-HGTNAFIVEPGMRIAQLVLAQVLRANFVLSEELESTQRGVG
DUT_CHLT3       LKHLISLPNAPATIDADFRGELKVILIN-HGKDAFEVKHGDRIAQMVI----------------------
DUT_ACIBY       HKHGIVLGNLVGLIDSDYQGELMVSVWNRG-QTTFRLEPGERLAQYVLVPXXXXXXXXXXXXXXTLRGAG
DUT_ACIBT       HKHGIVLGNLVGLIDSDYQGELMVSVWNRG-QTTFRLEPGERLAQYVLVPXXXXXXXXXXXXXXTLRGAG
DUT_ACIBS       HKHGIVLGNLVGLIDSDYQGELMVSVWNRG-QTTFRLEPGERLAQYVLVPXXXXXXXXXXXXXXTLRGAG
DUT_ACIBC       HKHGIVLGNLVGLIDSDYQGELMVSVWNRG-QTTFRLEPGERLAQYVLVPXXXXXXXXXXXXXXTLRGAG
DUT_ACIB5       HKHGIVLGNLVGLIDSDYQGELMVSVWNRG-QTTFRLEPGERLAQYVLVPXXXXXXXXXXXXXXTLRGAG
DUT_ACIB3       HKHGIVLGNLVGLIDSDYQGELMVSVWNRG-QTTFRLEPGERLAQYVLVPXXXXXXXXXXXXXXTLRGAG
DUT_ASHGO       VKHG--IQTGAGVVDRDYTGEVKIVLFN-HSDRDYAVKRGDRVAQLVLERXXXXXXXXXXXXXXXXRGEG
DUT_NEUCR       AKNFIDV--GAGVIDADYRGQVKVLLFN-HSDVDFVVNEGDRVAQLVLER--------------------
DUT_COXBN       HKHGIVLGNLVGLIDSDYQGPLMVSCWNRGKE-PYTINPGDRIAQLVVLPILKAQFAVVEEFELTERGAG
DUT_PSYIN       HKHGIVLGNLVGLIDSDYQGPLMVSCWNRSTES-FRLEPGERLAQLVFLPVVQATFEIVDEFKSSERGEG
DUT_YARLI       VKNGLS--TGAGVIDYDYRGPVKVMLFNHSTE-DFNVTIGDRVAQMILERTPEVQVVQTNDLESTERGAG
DUT_PSEAE       HKHGIVLGNLVGLIDSDYQGELMVSCWNRG-ESPFTIAVGERIAQLVLVPVVQAHFELVEAFDESQRGAG
DUT_PSEA8       HKHGIVLGNLVGLIDSDYQGELMVSCWNRG-ESPFTIAVGERIAQLVLVPVVQAHFELVEAFDESQRGAG
DUT_HAES2       HKNGIVLGNLVGLIDSDYQGPLMVSLWNRS-DKPFKIEIGDRIAQLVFVPVVQAEFNIVEEFQQTDRGNG
DUT_HAES1       HKNGIVLGNLVGLIDSDYQGPLMVSLWNRS-DKPFKIEIGDRIAQLVFVPVVQAEFNIVEEFQQTDRGNG
DUT_SHEON       HKHGIVLGNLVGLVDSDYQGPLMVSCWNRS-DTPFTLEIGDRLAQLVFVPVVQAQFKLVDEFDSSDRGEG
DUT_PSEAB       HKHGIVLGNLVGLIDSDYQGELMVSCWNRG-ESPFTIAVGERIAQLVLVPVVQAHFELVEQFDESQRGAG
DUT_NITOC       HKQGIVLGNLVGLIDSDYQGEILVSCWNRGAE-PFTLAVGERIAQMIFVPVVQMEFEQVETFTATLRGEG
DUT_COXBU       HKHGIVLGNLVGLIDSDYQGPLMVSCWNRGKE-PYTINPGDRIAQLVVLPILKAQFAVVEEFELTERGAG
DUT_COXBR       HKHGIVLGNLVGLIDSDYQGPLMVSCWNRGKE-PYTINPGDRIAQLVVLPILKAQFAVVEEFELTERGAG
DUT_ACTSZ       HKHGVVLGNLVGLIDSDYQGPLMVSMWNRS-DKPFKVEVGDRIAQLVFVPVVQAEFNIVAEFEQTDRGEG
DUT_PSEE4       HKHGVVLGNLVGLIDSDYQGELMVSCWNRG-NTPFTITIGERIAQLILVPVVQAHFDIVEQFDETQRGTG
DUT_PSEA7       HKHGIVLGNLVGLIDSDYQGELMVSCWNRG-ESPFTIAVGERIAQLVLVPVVQAHFELVEQFDESQRGAG
DUT_KLULA       VKHG--IQTGAGVVDRDYTGEVGIVLFN-HSDKDFQINKGDRVAQLILEKVEDAEIVVVESLEETQRGAG
DUT_HAEDU       HKNGIVLGNLVGLIDSDYQGPLMVSIWNRS-DKPFTIEVGDRIAQLVFVPVVQASFNIVTDFEQTSRGEG
DUT_CHLFF       LKHGIMVVNSPGTIDADYRGEVCIILANFGESTFIIKMRXXXXXXXXXXXXKFIVVDQEEGLTTTSRGSR
DUT_YEAST       VKNG--IQTGAGVVDRDYTGEVKVVLFN-HSQRDFAIKKGDRVAQLILEKVDDAQIVVVDSLEESARGAG
DUT_PSEMY       HKHGIVLGNLVGLIDSDYQGELMVSCWNRG-HTPFTIAIGERIAQLVLVPVVQAHFELVEQFDETQRGAG
DUT_HAEIN       HKHGIVLGNLVGLIDSDYQGPLMVSMWNRGNE-PFKIEVGDRIAQLVFVPVVQAEFNIVEDFQQTERGEG
DUT_HAEIG       HKHGIVLGNLVGLIDSDYQGPLMVSMWNRGNE-PFKIEVGDRIAQLVFVPVVQAEFNIVEDFQQTERGEG
DUT_HAEIE       HKHGIVLGNLVGLIDSDYQGPLMVSMWNRGNE-PFKIEVGDRIAQLVFVPVVQAEFNIVEDFQQTERGEG
DUT_HAEI8       HKHGIVLGNLVGLIDSDYQGPLMVSMWNRGNE-PFKIEVGDRIAQLVFVPVVQAEFNIVEDFQQTERGEG
DUT_CANGA       VKHG--IQTGAGVVDRDYTGEVKIILFN-HSQKDFEIKRGDRVAQLILEKVDDAEVVVVESLEDSQRGAG
DUT_SHESM       HKHGIVLGNLVGLIDSDYQGPLMVSCWNRS-DTPFTLEIGDRLAQLVFVPVVQAQFKLVDEFDSSDRGEG
DUT_SHESA       HKHGIVLGNLVGLIDSDYQGPLMVSCWNRS-DTPFTLEIGDRLAQLVFVPVVQAQFKLVDEFDSSDRGEG
DUT_PASMU       HKHGIVLGNLVGLIDSDYQGPLMVSLWNRSTE-PFKVEVGDRIAQLVFVPVVQAEFNVVSDFAQTERGEG
DUT_METCA       HKHGIVLGNLVGLIDSDYQGQVLVSCWNRGPE-PFEIAVGERIAQMVFVPVVQVSFEQVEAFAESRRAEG
DUT_CHLCV       LKHGIMVVNSPGTIDADYRGEVCIILANFG-ESTFIIEPKMRIXXXXXXXXKFIVVDQEEGLTATSRGSR
DUT_SWPVK       LNYNIDI--GGGVIDSDYRGEIGIVFIN-NGCSDFNIKVGDRIAQIIFERVEYPIMEEVKCLEDTERGNS
DUT_SHESW       HKHGIVLGNLVGLIDSDYQGPLMVSCWNRS-NSPFTLDIGDRLAQLVFVPVVQAQFKLVDEFDSSDRGEG
DUT_SHEPC       HKHGIVLGNLVGLIDSDYQGPLMVSCWNRS-NSPFTLDIGDRLAQLVFVPVVQAQFKLVDEFDSSDRGEG
DUT_SHEB5       HKHGIVLGNLVGLIDSDYQGPLMVSCWNRS-DSPFALEIGDRLAQLVFVPVVQAQFKLVDEFDSSDRGEG
DUT_DICDI       WKNFIDC--GAGVIDSDYRGNVGVVLFN-HSDVDFKVAVGDRVAQLIFERIVTPEPLEVDEIDETQRGAG
DUT_BLOPB       HKYGIVLGNLVGLIDSDYQGELIVSLWNRGPKKYI-VYPGKRIAQLVFMPIIQVRFSIVKSFIPTERGPH
DUT_SHEB9       HKHGIVLGNLVGLIDSDYQGPLMVSCWNRS-DSPFALEIGDRLAQLVFVPVVQAQFKLVDEFDSSDRGEG
DUT_SHEB8       HKHGIVLGNLVGLIDSDYQGPLMVSCWNRS-DSPFALEIGDRLAQLVFVPVVQAQFKLVDEFDSSDRGEG
DUT_SHEB2       HKHGIVLGNLVGLIDSDYQGPLMVSCWNRS-DSPFALEIGDRLAQLVFVPVVQAQFKLVDEFDSSDRGEG
DUT_PSEPW       HKHGIVLGNLVGLIDSDYQGELMVSCWNRG-NTPFTIAVGERIAQLVLVPVVQAHFEVVEAFDESQRGTG
DUT_HAHCH       HKHGIVLGNLVGLIDSDYQGEVMVSCWNRGNE-AFTISVGERIAQMVIVPVVQVGFEIVDDFDDSSRGAG
DUT_BRASB       ARHGVTVLNAPGTVDADYRGEICVLLINHGKE-PFTIRRGEXXXXXXXXXXXXXXXXXXXXXXXXXXGSG
DUT_ALCBS       HKHGIVLGNLVGLIDSDYQGELMVSCWNRG-QQPFTLEPGERVAQLVIVPVMQVELKQVESFSASKRGEG
DUT_SHESR       HKHGIVLGNLVGLIDSDYQGPLMVSCWNRS-DIPFTLEIGDRLAQLVFVPVVQAQFKLVDEFDSSDRGEG
DUT_SHEHH       HKHGIVLGNLVGLIDSDYQGPLMVSCWNRGSE-PFTIEIGDRLAQLVFVPVVQAEFKLVDEFNQSDRGTG
DUT_MANSM       HKHGIVLGNLVGLIDSDYQGPLMVSMWNRG-EQPFRIEVGDRIAQLVFVPVVQAEFNIVTDFTQTERGEG
DUT_VACCP       LK---XXXXXXXXXXXXYRGNIGVILIN-NGKCTFNVNTGDRIAQLIYQRIYYPELEEVQSLDSTNRGDQ
DUT_VACCC       LK---XXXXXXXXXXXXYRGNIGVILIN-NGKCTFNVNTGDRIAQLIYQRIYYPELEEVQSLDSTNRGDQ
DUT_VACCA       LK---XXXXXXXXXXXXYRGNIGVILIN-NGKCTFNVNTGDRIAQLIYQRIYYPELEEVQSLDSTNRGDQ
DUT_SHEPA       HKHGIVLGNLVGLIDSDYQGPLMVSCWNRGSE-PFTIEIGDRLAQLVFVPVVQAEFKLVDEFNQSDRGAG
DUT_SHEWM       HKHGIVLGNLVGLIDSDYQGPLMVSCWNRG-DKPYTIEIGDRLAQLVFVPVVQAEFKLVDEFDNSLRGEG
DUT_PSEPG       HKHGIVLGNLVGLIDSDYQGELMVSCWNRS-NTPFTIAVGERIAQLVLVPVVQAHFDIVEAFDESQRGAG
DUT_CHLAB       LKHGIMVVNSPGTIDADYRGEVCIILANFG-ESTFIIEPKMRIXXXXXXXXKFIAVDQEEGLTTTSRGSR
DUT_THIDA       HKHGIVLGNLVGLIDSDYQGQLMVSAWNRS-EQSFELVPLERLAQLVIVPVVQARFNIVEAFETTARGEG
DUT_SERP5       HKHGVVLGNLVGLIDSDYQGQLMVSVWNRG-QKSFTIEPGERIAQMVFVPVVQAEFNLVEEFDSSERGAG
DUT_PSEPK       HKHGIVLGNLVGLIDSDYQGELMVSCWNRG-NTPFTIAVGERIAQLVLVPVVQAHFEIVEAFDESQRGAG
DUT_NEIG2       HKHGIVLGNLVGLIDSDYQGELKVSLWNRGSE-PFTVKPFERIAQMVIVPVVQAGFKRVEEFVGSSRGEG
DUT_ACIAD       HKHGIVLGNLVGLIDSDYQGELMISVWNRG-QNTFTLEPGERLAQYVLVPVIQAEFEQVEEFVATDRGAG
DUT_FOWPV       YNYFIDV--GAGVIDSDYRGNVGVLLFNFGSTQ-FNVCKGDRIAQIIFEKPKIIEVTTLEEINITDRGNS
DUT_THICR       HKHGIVLGNLVGLIDSDYQGPLMVSCWNRS-EEAYNVTVGERIAQMVIPVLQPVFTQVEEFGDATERGEG
DUT_SHISS       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_SHIDS       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_SHIBS       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_SHIB3       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_SHEDO       HKHGIVLGNLVGLIDSDYQGPLMVSCWNRS-DTPFTLTLGERLAQLVFVPVVQAQFTLVDEFERSDRGEG
DUT_SHEAM       HKHGIVLGNLVGLIDSDYQGPLMVSCWNRGNE-PYTLQIGDRLAQLVFVPVVQAEFKLVDEFDTSMRGEG
DUT_PHOLL       HKHGVVLGNLVGLIDSDYQGQLMVSVWNRG-DKAFTIQPGERIAQIVFVPVVQAEFNLVEDFETSERGSG
DUT_ESCF3       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_ECOUT       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDN-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_ECOSM       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_ECOSE       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_ECOLU       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_ECOLC       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_ECOL6       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_ECOL5       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_ECOK1       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDN-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_ECOHS       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_ECO8A       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_ECO81       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDN-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_ECO7I       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQIIFVPVVQAEFNLVEDFDATDRGEG
DUT_ECO5E       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_ECO57       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_ECO55       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_ECO45       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDN-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_ECO27       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_ECO24       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_SHIFL       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_SHIF8       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_SALAR       HKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFNLVEAFDATERGEG
DUT_PSEU5       HKHGIVLGNLVGLIDSDYQGELMVSCWNRG-QSAFTIAVGERIAQLMLVPVVQARFELVDSFDSSDRGAG
DUT_PSEP1       HKHGIVLGNLVGLIDSDYQGELMVSCWNRG-NTPFTIAVGERIAQLVLVPVVQAHFDIVEAFDESQRGAG
DUT_PSEFS       HKHGIVLGNLVGLIDSDYQGELMVSCWNRG-QTAFNIAVGERIAQLVLVPVVQAHFELVEEFDETQRGAG
DUT_NEIMA       HKHGIVLGNLVGLIDSDYQGELKVSLWNRSSE-PFTVKPFERIAQMVIVPIVQARFKRVEEFVGSSRGEG
DUT_HAEPS       HKNGIVLGNLIGLIDSDYQGPLMVSLWNRS-DKPFTVEVGDRIAQLVFVPVVQAQFNIVEEFTATDRGEG
DUT_ECOLI       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_ECODH       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_ECOBW       HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEG
DUT_NEIM0       HKHGIVLGNLVGLIDSDYQGELKVSLWNRGSE-PFAVKPFERIAQMVIVPVVQAGFKRVEEFVGSSRGEG
DUT_NEIG1       HKHGIVLGNLVGLIDSDYQGELKVSLWNRGSE-PFAVKPFERIAQMVIVPVVQAGFKRVEEFVGSSRGEG
DUT_YERPS       HKHGIVLGNLVGLIDSDYQGQLMVSVWNRG-QQPFTIEPGERIAQMVFVPVVQAEFNLVEDFTDSERGTG
DUT_YERPG       HKHGIVLGNLVGLIDSDYQGQLMVSVWNRG-QQPFTIEPGERIAQMVFVPVVQAEFNLVEDFTDSERGTG
DUT_YERPE       HKHGIVLGNLVGLIDSDYQGQLMVSVWNRG-QQPFTIEPGERIAQMVFVPVVQAEFNLVEDFTDSERGTG
DUT_YERP3       HKHGIVLGNLVGLIDSDYQGQLMVSVWNRG-QQPFTIEPGERIAQMVFVPVVQAEFNLVEDFTDSERGTG
DUT_VARV        LK---XXXXXXXXXXXXYRGNIGVILIN-NGKYTFNVNTGDRIAQLIYQRIYYPELKEVQSLDSTDRGDQ
DUT_SHEFN       HKHGIVLGNLVGLIDSDYQGQLMVSCWNRS-DKPFTLEIGDRLAQLMFVPVIQATFAVVDEFNSSDRGEG
DUT_SALTY       HKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFNLVEAFDATERGEG
DUT_SALTI       HKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFNLVEAFDATERGEG
DUT_SALSV       HKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFNLVEAFDATERGEG
DUT_SALPK       HKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFNLVEAFDATERGEG
DUT_SALPC       HKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFNLVEAFDATERGEG
DUT_SALPB       HKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFNLVEAFDATERGEG
DUT_SALPA       HKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFNLVEAFDATERGEG
DUT_SALNS       HKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFNLVEAFDATERGEG
DUT_SALHS       HKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFNLVEAFDATERGEG
DUT_SALG2       HKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFNLVEAFDATERGEG
DUT_SALEP       HKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFNLVEAFDATERGEG
DUT_SALDC       HKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFNLVEAFDATERGEG
DUT_SALCH       HKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFNLVEAFDATERGEG
DUT_SALA4       HKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFNLVEAFDATERGEG
DUT_CWPXG       LK---XXXXXXXXXXXXYRGNIGVILIN-NGKCTFNVNTGDRIAQLIYQRIYYPELEEVQSLDSTDRGAQ
DUT_ANTLO       LKYCIEIFGV--NIGPGETKDIVVDIYN-HGKMPFNVAKGDRIAQIVFIKLFGGDLHEVSELSDTKRGSC
DUT_XYLFM       HRHGIVLGNGTGLIDSDYQGPLLVSLWNRGRE-AFTIEPGDRIAQXXXXXXXXXXXXXXDTFVESGRGAG
DUT_VACCW       LK---XXXXXXXXXXXXYRGNIGVILIN-NGKCTFNVNTGDRIAQLIYQRIYYPELEEVQSLDSTNRGDQ
DUT_SHELP       HKHGIVLGNLVGLIDSDYQGPLMVSCWNRSNE-PFTLEIGDRLAQLVFVPVVQAEFKLVDEFDTSDRGEG
DUT_RABPU       LK---XXXXXXXXXXXXYRGNIGVILIN-NGKCTFNVNTGDRIAQLIYQRIYYPELEEVQSLDSTDRGDQ
DUT_PRB01       SKHGIVLGNLVGLIDSDYQGELMVPAWNRS-DTDFEINPGDRIAQMIIVPVIQADFEIVDEFNETQRGEK
DUT_NEIMB       HKHGIVLGNLVGLIDSDYQGELKVSLWNRSSE-PFTVKPFERIAQMVVVPIVQAGFKRVEEFVGSSRGEG
DUT_CITK8       HKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFNLVEEFEATDRGEG
DUT_TOLAT       HKHGIVLGNLVGLIDSDYQGQLMVSVWNRG-NTTFTIQPGERIAQLV-----------------------
DUT_SHEPW       HKHGIVLGNLVGLIDSDYQGPLMVSCWNRGSE-PFTIEIGDRLAQLVFVPVVQAEFKLVDEFDSSDRGAG
DUT_PSE14       HKHGIVLGNLVGLIDSDYQGELMVSCWNRG-QTAFNIAVGERIAQLVLVPVVQAHFELVEAFDESQRGAG
DUT_PSESM       HKHGIVLGNLVGLIDSDYQGELMVSCWNRG-QTAFTIAVGERIAQLVLVPVVQARFELVEEFDESQRGTG
DUT_PSEF5       HKHGIVLGNLVGLIDSDYQGELMVSCWNRG-QTAFNIAVGERIAQLVLVPVVQAHFEVVEAFDESQRGAG
DUT_NITMU       HKHGIVMGNLVGLIDSDYQGQIFVSCWNRG-QAPFLLNPLERIAQLXXXXXXXXXXXXXDDFEQSERGAN
DUT_KLEP7       HKHGVVLGNLVGLIDSDYQGQLMVSVWNRG-QQSFIIEPGERIAQMVFVPVVQAEFNLVESFDATDRGEG
DUT_KLEP3       HKHGVVLGNLVGLIDSDYQGQLMVSVWNRG-QQSFIIEPGERIAQMVFVPVVQAEFNLVEEFDATDRGEG
DUT_ENT38       HKHGIVLGNLVGLIDSDYQGQLMVSVWNRGQDS-FTIEPGERIAQMVFVPVVQAEFNLVDDFDATDRGEG
DUT_DINSH       LKHGLSLPNTPGTIDSDYRGPLGVLLTVIGTE-AVTLHHGDR----------------------------
DUT_DICNV       YKHGIVLGNLVGLIDSDYQGELKIPLWNRS-QTPYTVTLGERIAQLLFLAQAQLFPVESFDQKQSTRGSG
DUT_XYLFT       HRHGIVLGNGTGLIDSDYQGPLLVSVWNRGRE-AFTIEPGDRIAQXXXXXXXXXXXXXXDTFVESGRGAG
DUT_XYLF2       HRHGIVLGNGTGLIDSDYQGPLLVSVWNRGRE-AFTIEPGDRIAQXXXXXXXXXXXXXXDTFVESGRGAG
DUT_SHESH       HKHGIVLGNLVGLIDSDYQGPLMVSCWNRGSE-PFTLEIGDRLAQLVFVPVVQAEFKLVDEFDNSSRGEG
DUT_PSYCK       HKHGIVLGNLVGLIDADYQGELMVSIWNRSQE-DFVLTPAERMAQYVVVPVARPEFEVVTEFSDTARGAG
DUT_ORFN2       VKHFIDV--GAGVIDEDYRGNVGVVLFNFG-NSDFEVKKGDRIAQLICERISCPAVQEVNCLDNTDRGD-
DUT_BURTA       HKHGIVLGNLVGLIDSDYQGELMISTWNRG-QTEFVLNPFERLAQLVIVPVVQATFNIVGDFAQSDRGAG
DUT_BURS3       HKHGIVLGNLVGLIDSDYQGQLMISTWNRG-QTEFVLNPFERLAQLVIVPVVQAQFNIVDDFAESDRGDG
DUT_AZOVD       HKHGIVLGNLVGLIDSDYQGELMISCWNRG-QSTFRIAVGERIAQLVLVPVMQAHFQLVESFDESQRGAG
DUT_PSEU2       HKHGIVLGNLVGLIDSDYQGELMVSCWNRG-HTAFNIAVGERIAQLVLVPVVQAHFELVEAFDESQRGAG
DUT_PECCP       HKHGVVLGNLVGLIDSDYQGQLMVSVWNRG-QQTFTVEPGERIAQMVFVPVVQAEFNLVEDFVSSERGEG
DUT_ERWCT       HKHGVVLGNLVGLIDSDYQGQLMVSVWNRG-QQTFTVEPGERIAQMVFVPVVQAEFNLVEDFVGSERGEG
DUT_BURVG       HKHGIVLGNLVGLIDSDYQGQLMVSTWNRG-QSEFVLNPFERLAQLVIVPVVQAQFNIVDDFAQSERGEG
DUT_XANCP       HRHGIVLGNGTGLIDADYQGPLLISTWNRGRE-AFTIEPGDRIAQLVILPIVRVSLQVVDTFVDSARGAG
DUT_XANCB       HRHGIVLGNGTGLIDADYQGPLLISTWNRGRE-AFTIEPGDRIAQLVILPIVRVSLQVVDTFVDSARGAG
DUT_XANC8       HRHGIVLGNGTGLIDADYQGPLLISTWNRGRE-AFTIEPGDRIAQLVILPIVRVSLQVVDTFVDSARGAG
DUT_AERHH       HKHGIVLGNLVGLIDSDYQGQLMVSVWNRGNDN-FTMQPGERIAQLVI----------------------
POL_FIVSD       SK-GLDVLG--GVIDEGYRGEIGVIMINLS-KKSITLLEQQKIAQLIILPHKHEALEQGKVVMDSERGEK
DUT_BURCJ       HKHGIVLGNLVGLIDSDYQGQLMVSTWNRG-QTEFVLNPFERLAQLVIVPVVQAQFNIVDEFTESDRGEG
DUT_BURCH       HKHGIVLGNLVGLIDSDYQGQLMVSTWNRG-QTAFVLNPFERLAQLVIVPVVQAQFNIVDEFTESDRGEG
DUT_BURCC       HKHGIVLGNLVGLIDSDYQGQLMVSTWNRG-QTAFVLNPFERLAQLVIVPVVQAQFNIVDEFTESDRGEG
DUT_BURCA       HKHGIVLGNLVGLIDSDYQGQLMVSTWNRG-QTAFVLNPFERLAQLVIVPVVQAQFNIVDEFTESDRGEG
POL_FIVPE       SK-GLDVLG--GVIDEGYRGEIGVIMINVS-RKSITLMERQKIAQLIILPCKHEVLEQGKVVMDSERGDN
DUT_WIGBR       HKYGIILSNTIGLIDSDYQGPIMISMLNRS-NKNFLISIGDRIAQIIVPLIQIEWNIVNKFVKITNRKDM
DUT_JANMA       HKHGIVLGNLVGLIDSDYQGQLMVSTWNRG-QTEFTLNPMERLAQLVIVPVLQVGFNVVEEFDTSERGIG
DUT_BURA4       HKHGIVLGNLVGLIDSDYQGQLMVSTWNRG-QTEFVLNPFERLAQLVIVPVVQAQFNIVDDFAQSERGEG
DUT_AERS4       HKHGIVLGNLVGLIDSDYQGQLMVSVWNRGNDS-FTMQPGERIAQLVI----------------------
DUT_XANOR       HRHGIVLGNGTGLIDADYQGPLLISTWNRGRE-AFTIEPGDRIAQLVILPIVRAGLQVVDTFVDSARGAG
DUT_XANOP       HRHGIVLGNGTGLIDADYQGPLLISTWNRGRE-AFTIEPGDRIAQLVILPIVRAGLQVVDTFVDSARGAG
DUT_BURCM       HKHGIVLGNLVGLIDSDYQGQLMVSTWNRG-QTEFVLNPFERLAQLVIVPVVQAQFNIVDDFAQSDRGEG
DUT_RALPJ       HKHGIVLGNLVGLIDSDYQGQLMVSTWNRG-STAFVLNPMERLAQLVIVPVVQAELNIVDDFAESERGAG
DUT_PSYA2       HKHGIVLGNLVGLIDADYQGELMVSIWNRSLE-DFVLNPAERMAQYVVVPVARPEFEVVTEFSDTARGAG
DUT_DECAR       HKHGIVLGNLVGLIDSDYQGELMVSVWNRG-HASFTLNPLDRIAQLIIVPVLQVGFNIVDDFDASHRGEG
DUT_CAMPS       LK---XXXXXXXXXXXXYRGNIGVILIN-NGKCTFNVNTGDRIAQLIYQRIYYPELKEVQSLDSTDRGDQ
DUT_CAMPM       LK---XXXXXXXXXXXXYRGNIGVILIN-NGKCTFNVNTGDRIAQLIYQRIYYPELKEVQSLDSTDRGDQ
DUT_BURPP       HKHGIVLGNLVGLIDSDYQGQLMISTWNRG-ETTFVLNPMERLAQLVIVPVVQAEFNIVDDFETSDRGAG
DUT_BURP8       HKHGIVLGNLVGLIDSDYQGQLMISTWNRG-TTTFTLNPMERLAQLVIVPVVQATFNIVDEFDTSERGEG
DUT_BPT5        KRH-LMIANTAGVIDSDYRGTIKMNLYNYGSEMQ-TLENFERLCQLVVPHYSTHNFKIVDELEETIRGEG
DUT_XANOM       HRHGIVLGNGTGLIDADYQGPLLISTWNRGRE-AFTIEPGDRIAQLVILPIVRAGLQVVDTFVDSARGAG
DUT_XANC5       HRHGIVLGNGTGLIDADYQGPLLISTWNRGRE-AFTIEPGDRIAQLVILPIVRMGLQVVDTFVDSARGAG
DUT_XANAC       HRHGIVLGNGTGLIDADYQGPLLISTWNRGRE-AFTIEPGDRIAQLVILPIVRMGLQVVDTFVDSARGAG
DUT_RHOFD       HKHGIVLGNLVGLIDSDYQGQLMVSAWNRS-DVAFTIEPMERIAQLVIVPVLQAQFNVVSEFPASARGEG
DUT_BORPA       HKHGIVLGNLVGLIDSDYQGQLMVSTWNRGTQ-PFTLDPMERLAQLVIVPVQQVAFNVVEDFDASERGAG
DUT_BORBR       HKHGIVLGNLVGLIDSDYQGQLMVSTWNRGTQ-PFTLDPMERLAQLVIVPVQQVAFNVVEDFDASERGAG
DUT_SODGM       HKHGIVLGNLVGLIDSDYQGPLMVSVWNRG-QDIFTIEPGERMAQMVFVPVVQAEFNLVESFDTSERGEG
DUT_BURXL       HKHGIVLGNLVGLIDSDYQGQLMISTWNRG-ETTFVLNPMERLAQLVIVPVVQAEFNIVDDFETSERGAG
DUT_AZOSB       HKHGIVLGNLVGLIDSDYQGQVFVSVWNRGRD-VFTIQPMERIAQLVVVPVLQVGFNVVDDFAASERGEG
DUT_XYLFA       HRHGIVLGNGTGLIDSDYQGPLLVSVWNRGRE-AFTIEPGDRIAQXXXXXXXXXXXXXXDTFVESGRGAG
DUT_RALSO       HKHGIVLGNLVGLIDSDYQGQLMISTWNRG-DTAFVLNPMERLAQLVIVPVVQAELNIVDAFAESERGAG
DUT_NITEU       HKHGIVLGNLVGLIDSDYQGQILVSCWNRG-QAGFTLDPMERIAQLVIVPVVQAGFNVVENFQPSQRGEQ
DUT_ERWT9       HKHGVVLGNLVGLIDSDYQGPLMVSVWNRGQDS-FTIEPGERIAQMVFVPVVQAEFNLVNDFDASVRGEG
438L_IIV6       LNHNLEV--GAGIVDADYREGVSVVLNNLSP-RDFHVAPGDRIAQLVCTPTPEIVFCKPSDIPDTVRGKN
DUT_METFK       HKHGIVLGNLVGLIDSDYQGQLLVSCWNRGKES-FILNPLERIAQLVIVPVMQANFNIVDDFQASERGTG
DUT_BURM1       HKHGIVLGNLVGLIDSDYQGQLMVSTWNRG-QTEFVLNPFERLAQLVIVPVVQAQFNIVDDFAQSERGAG
DUT_PSYWF       HKHGIVLGNLVGLIDADYQGELMVSVWNRS-DTDFVLNPAERMAQMXXXXXXXXXXXXEEFNELSARGAG
DUT_NITEC       HKHGIVLGNLVGLIDSDYQGQILVSCWNRG-QTTFALEPLERIAQLVIVPVIQASFNVVNDFQHSQRGER
DUT_METPP       HKHGIVLGNLVGLIDSDYQGPLMVSCWNRG-LAAFTVQPLERIAQLVIVPVVQASFRVVDDFGASERGEG
DUT_LEPCP       HKHGIVLGNLVGLIDSDYQGQLMVSCWNRG-SVAYAVQPLERIAQLVIVPVVQAQFRQVDEFEASDRGVA
DUT_HAMD5       HKNGIVLGNLVGLIDSDYQGELMLSVWNRS-QIDFLINPGDRLAQMVFVPVVQVELNIVSEFTSSQRGSG
DUT_POLSQ       HKHGIVLGNLVGLIDSDYQGQLMVSTWNRG-SNPFKLEPMERLAQLVVMPIQQVELKVVEEFTESSRGAG
DUT_HERAR       HKHGIVLGNLVGLIDSDYQGQLMVSTWNRG-QAEFVLNPMERLAQLVIVPVLQVGFNIVDDFDSSERGAG
DUT_CHRVO       HKHGIVLGNLVGLIDSDYQGQMFVSVWNRG-QQPFRLEPMERIAQMVI----------------------
DUT_BORA1       HKHGIVLGNLVGLIDSDYQGQLMVSTWNRG-QTAFTLEPMERLAQLVIVPVQQVSFNVVDEFGASERGAG
DUT_BAUCH       -HHGIVLGNLVGLIDSDYQGSIMVSLWNRGKE-IFTIQPNERIAXXXXXXXXXXXXXXXDNFQKSKRGER
DUT_AZOSE       HKHGIVLGNLVGLIDSDYQGQIFVSAWNRGRE-TFTVQPMERIAQLVVVPVLQVGFNIVDEFPQSDRGAA
DUT_ENCCU       LRNWIEVVET--CVHPGEDKELVITLVN-NGREVFEYEESSRIAQLVFVPVLSCEIDLVESLDLTERGCL
DUT_YERE8       HKHGVVLGNLVGLIDSDYQGQLMVSVWNRG-QQPFTIEPGERIAQMVFVPVIQAEFNLVEDFDLSERGTG
DUT_BURPS       HKHGIVLGNLVGLIDSDYQGELMISTWNRG-QTEFALNPFERLAQLVI----------------------
DUT_BURP6       HKHGIVLGNLVGLIDSDYQGELMISTWNRG-QTEFALNPFERLAQLVI----------------------
DUT_BURP1       HKHGIVLGNLVGLIDSDYQGELMISTWNRG-QTEFALNPFERLAQLVI----------------------
DUT_BURP0       HKHGIVLGNLVGLIDSDYQGELMISTWNRG-QTEFALNPFERLAQLVI----------------------
DUT_BURMS       HKHGIVLGNLVGLIDSDYQGELMISTWNRG-QTEFALNPFERLAQLVI----------------------
DUT_BURMA       HKHGIVLGNLVGLIDSDYQGELMISTWNRG-QTEFALNPFERLAQLVI----------------------
DUT_BURM9       HKHGIVLGNLVGLIDSDYQGELMISTWNRG-QTEFALNPFERLAQLVI----------------------
DUT_BURM7       HKHGIVLGNLVGLIDSDYQGELMISTWNRG-QTEFALNPFERLAQLVI----------------------
DUT_LEGPH       HKNGIVLGNLVGLIDSDYQGELKISCWNRSQEH-FTVNPGDRIAQLV-----------------------
DUT_LEGPC       HKNGIVLGNLVGLIDSDYQGELKISCWNRSQEH-FTVNPGDRIAQLV-----------------------
DUT_LEGPA       HKNGIVLGNLVGLIDSDYQGELKISCWNRSQEH-FTVNPGDRIAQLV-----------------------
DUT_BUCAT       HKKGIVLGNLVGLIDSDYQGQLMISLWNRS-DQDFYVNPHDRVAQIIFVPIIRPCFLLVKNFNETSRSKK
DUT_BUCAI       HKKGIVLGNLVGLIDSDYQGQLMISLWNRS-DQDFYVNPHDRVAQIIFVPIIRPCFLLVKNFNETSRSKK
DUT_BUCA5       HKKGIVLGNLVGLIDSDYQGQLMISLWNRS-DQDFYVNPHDRVAQIIFVPIIRPCFLLVKNFNETSRSKK
DUT_BORPE       HKHGIVLGNLVGLIDSDYQGQLMVSTWNRGTQ-PFTLDPMERLAQLVI----------------------
DUT_BLOFL       HYYGIVLGNTIGLIDSDYQGEIMISLWNRGSNKFILYP-GKRIAQLLILRVKLSLVKSFDPFMKTIRGVK
DUT_LEGPL       HKNGIVLGNLVGLIDSDYQGELKISCWNRSQEH-FTVNPGDRIAQLV-----------------------
DUT_ENTS8       HKHGVVLGNLVGLIDSDYQGQLMVSVWNRG-QQSFTIEPGERIAQMVFVPVVQAEFNLVEDFTATDRGEG
DUT_PSEPF       HKHGIVLGNLVGLIDSDYQGPLMVSCWNRG-QTEFTMPVGERXXXXXXXXXXXXHFEMVEEFVETERGTG
DUT_POLNS       HKHSIVLGNLVGLIDSDYQGQLMVSTWNRG-STTFKLEPMERLAQLVVMPVQQVELKVVEEFTESSRGAG
POL_FIVT2       SK-GVDVLG--GVIDEGYRGELGVIMINL-TKKSITILEKQKIAQLIILPCRHEGLQQGEIQMNSERGEK
POL_EIAVY       -KQGL-LING-GIIDEGYTGEIQVICTNIGKSN-IKLIEGQKFAQLIILQHHSNSRQPWDENKISQRGDK
POL_EIAVC       -KQGL-LING-GIIDEGYTGEIQVICTNIGKSN-IKLIEGQKFAQLIILQHHSNSRQPWDENKISQRGDK
POL_EIAV9       -KQGL-LING-GIIDEGYTGEIQVICTNIGKSN-IKLIEGQKFAQLIILQHHSNSRQPWDENKISQRGDK
DUT_LARHH       HKHGIVLGNLVGLIDSDYQGQVFVSVWNRGHE-TFRLAPLDRIAQM------------------------
DUT_BUCBP       HVQGIVLGNLVGLIDSDYQGQVMVSLWNRG-SRNFSVKVGMRIAQIVIPIIRPIFEIVTNFVVDTERKVQ
POL_CAEVC       AK---GVFTQGGIIDSGYQGQIQVIMYNSN-KIAVVIPQGRKFAQLILMDKKHGKLEPWGESRKTERGEK
DUT_FRAP2       HKKGLVLGNGTGLIDSDYQGELMVSCFNRSQE-VIEIEPMMRFAQLVVPVVQAKFDIVEEFSQRTIRSAG
VPRT_SRV2       TVKGLQIY--PGVIDNDYTGEFKIMARAI--SSIITIPQGERIAQLVL----LPLLRTAHKIQHPYRGDK
VPRT_MPMV       MK-GLQVY--PGVIDNDYTGEIKIMAKAVN--NIVTVSQGNRIAQLIL----------------------
DUT_YMTV        LNN--SXXXXXXXXXXXXXXXXXXXFIN-NGNSPHYIKRGDRIAQIVFERLANVEIKEISNLDCTCRGDC
VPRT_SRV1       IK-GLQVY--PGVIDNDYTGEIKIMAKAVN--NIVTVPQGNRIAQLIL----------------------
POL_OMVVS       SK---GVFVQGGIIDSGYQGIIQVVVYNSN-DKEVIIPQGRKFAQLILMPLIHEDLEAWGETRRTERGNQ
DUT_LACLA       RKKGLVLINSVGVIDKDYEGHMFMQMRNFTDEE-VVIEKGERVVQ-------------------------
DUT_ICHV1       KN-----FVSTGIIDSDFRGHIHIMVSAI---ADFSVKKNQRIAQLVV----------------------
VPRT_MMTVB      YKKGLEVL--PGVIDSDFQGEIKVMV--KAAKNAVIIHKGERIAQXXXXXXXXXXXXVIKEE----RGSE
POL_VILVK       NK---GVFVQGGIIDSGYQGTIQVVIYNSN-NKEVVIPQGRKFAQLILMPLIHEELEPWGETRKTERGEQ
POL_VILV2       NK---GVFVQGGIIDSGYQGTIQVVIYNSN-NKEVVIPQGRKFAQLILMPLIHEELKPWGETRKTERGEQ
POL_VILV1       NK---GVFVQGGIIDSGYQGTIQVVIYNSN-NKEVVIPQGRKFAQLILMPLIHEELEPWGETRKTERGEQ
POL_VILV        NK---GVFVQGGIIDSGYQGTIQVVIYNSN-NKEVVIPQGRKFAQLILMPLIHEELEPWGETRKTERGEQ
DUT_FRATW       HKKGLVLGNGTGLIDSDYQGELMVSCFNRSQEEPLM-----RFAQLVIPVVQANFEIVEDFSQQSVRATG
DUT_FRATT       HKKGLVLGNGTGLIDSDYQGELMVSCFNRSQEEPLM-----RFAQLVIPVVQANFEIVEDFSQQSVRATG
DUT_FRATN       HKKGLVLGNGTGLIDSDYQGELMVSCFNRSQEEPLM-----RFAQLVIPVVQANFEIVEDFSQQSVRATG
DUT_FRATM       HKKGLVLGNGTGLIDSDYQGELMVSCFNRSQEEPLM-----RFAQLVIPVVQANFEIVEDFSQQSVRATG
DUT_FRAT1       HKKGLVLGNGTGLIDSDYQGELMVSCFNRSQEEPLM-----RFAQLVIPVVQANFEIVEDFSQQSVRATG
DUT_FRATO       HKKGLVLGNGTGLIDSDYQGELMVSCFNRSQEEPLM-----RFAQLVIPVVQANFEIVEDFSQQSVRATG
DUT_FRATH       HKKGLVLGNGTGLIDSDYQGELMVSCFNRSQEEPLM-----RFAQLVIPVVQANFEIVEDFSQQSVRATG
DUT_FRATF       HKKGLVLGNGTGLIDSDYQGELMVSCFNRSQEEPLM-----RFAQLVIPVVQANFEIVEDFSQQSVRATG
DUT_BUCAP       XXXXXXXXXXXXXXDSDYQGELMISLWNRS-KNIFFINPYDRIAQMIFVPIIRPTFSIVDDFEETVRFGK
VPRT_JSRV       SLKGILI--HPGVIDSDYTGEIKI--LASAPNKIIVINAGQRIAQLLL----------------------
POK4_HUMAN      LK-GVQIHTS--VVDSDYKGEIQLV---ISSSVPWSASPGDRIAQLLL----------------------
DUTP_ASFB7      THERLLILNGIGLIDPGYVGELMLKIINLG-DTPVQIWAKECLVQLVAQGNILKRNQIFPLFAPTPRGEG
DUTP_ASFK5      THERLLILNSIGLIDPGYVGELMLKIINLG-DTPVQIWAKECLVQLVAQGNILKRNQIFPLFAPTPRGEG
DUTP_ASFWA      TYERLLILNGIGLIDPGYVGELMLKIINLG-DTPVQIWAKECLVQLVAQGNILKRNQIFPLFAPTPRGEG
DUTP_ASFP4      TYERLLILNGIGLIDPGYVGELMLKIINLG-DTPVQIWAKECLVQLVAQGNILKRNQIFPLFAPTPRGEG
DCD_METMJ       -RLGVELHQTGGWIDAGFRGTITLEMCNVN-SRPVKVYAGMPIGQLVFYR--------------------
DCD_AQUAE       -RLGLFIENA-GWVDAGFEGQITLELFNAN-DRPIRLYRGMRICQLVFAR--------------------
DUTP_ASFM2      THERLLILNGIGLIDPGYVGELMLKIINLG-DIPVQIWAKECLVQLVAQGNILKRNEIFPLFAPTPRGEG
DCD_THEAC       RK---GIFGSFGAIDAGYHGNLTLSFFNAG--SAVNLRRGERIAQIVFVK--------------------
DCD_METB6       -RLGVTLHQTGGWIDAGFRGSITLEMANVN-ARPVRVYAGMPIGQLV-----------------------
GAG_IPMA        VHPELWIVNIPQ----------KYQVLCSSPKGVFSISKGDRIPQLLL----------------------
VPRT_SMRVH      SK-GIQVL--PGILDNDFEGEIHIILST--TKDLVTIPKGTRLAQIVI----------------------
DCD_AERPE       ARTGIYI---PATVDAGFEGQLTIEVVG--SGFPVKLYPGDRFLHLVLVK--------------------
DCD_METTH       GRLGITMHVTAGYIDPGFHGRITLEISNIG-KMPVALYPRQRVCQIVFE---------------------


                         +         .         .         .         .         *         .:210
query           GYGSTGKTA
DUT_CORGB       GYGSTGKTA
DUT_CORGL       GYGSTGKTA
DUT_COREF       GHGSTGR--
DUT_CORJK       GYGSTG---
DUT_CORDI       GYGSTG---
DUT_RHOE4       ---------
DUT_NOCFA       ---------
DUT_MYCSK       ---------
DUT_MYCSJ       ---------
DUT_MYCS2       ---------
DUT_MYCVP       ---------
DUT_MYCGI       ---------
DUT_MYCPA       ---------
DUT_MYCA1       ---------
DUT_MYCMM       ---------
DUT_MYCUA       ---------
DUT_MYCTU       ---------
DUT_MYCTA       ---------
DUT_MYCBT       ---------
DUT_MYCBP       ---------
DUT_MYCBO       ---------
DUT_THEFY       ---------
DUT_MYCLE       ---------
DUT_MYCLB       ---------
DUT_STRGG       GFGSTG---
DUT_BIFLI       GFGSTG---
DUT_BIFLO       GFGSTG---
DUT_BIFLD       GFGSTG---
DUT_STRCO       GFGSTG---
DUT_PROAC       GYGSTGVSA
DUT_STRAW       GFGSTG---