[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF54831.1

[Show Plain Result]


## Summary of Sequence Search
    1::622
  218::610     8e-20  31%  651 aa  PBP2_HAEIN RecName: Full=Penicillin-binding protein 2;       
  133::464     4e-19  34%  491 aa  PBPA_MYCS2 RecName: Full=Penicillin-binding protein A;       
    3::632     2e-18  24%  668 aa  PBPC_BACSU RecName: Full=Penicillin-binding protein 3;       
  181::508     5e-17  28%  646 aa  SP5D_BACSU RecName: Full=Stage V sporulation protein D;AltName:
  109::626     8e-14  24%  670 aa  PBP_STAAU RecName: Full=Beta-lactam-inducible penicillin-binding
   54::519     4e-13  23%  716 aa  PBPB_BACSU RecName: Full=Penicillin-binding protein 2B;       
  133::443     7e-13  31%  491 aa  PBPA_MYCTU RecName: Full=Penicillin-binding protein A;       
  239::569     3e-11  26%  584 aa  PBPI_BACSU RecName: Full=Penicillin-binding protein 4B;       
  210::606     3e-11  27%  633 aa  PBP2_ECOLI RecName: Full=Penicillin-binding protein 2;       
  210::606     3e-11  27%  633 aa  PBP2_ECOL6 RecName: Full=Penicillin-binding protein 2;       
  210::606     3e-11  27%  633 aa  PBP2_ECO57 RecName: Full=Penicillin-binding protein 2;       
  216::555     3e-10  24%  598 aa  FTSI_MESVI RecName: Full=Peptidoglycan synthetase ftsI homolog;    
  206::485     2e-08  27%  623 aa  PBP2_SALTY RecName: Full=Penicillin-binding protein 2;       
   55::499     5e-08  24%  588 aa  FTSI_ECOLI RecName: Full=Peptidoglycan synthetase ftsI;       
   55::499     5e-08  24%  588 aa  FTSI_ECO57 RecName: Full=Peptidoglycan synthetase ftsI;       
   66::481     9e-08  25%  750 aa  PBPX_STRPN RecName: Full=Penicillin-binding protein 2x;       
  193::517     1e-07  23%  610 aa  FTSI_HAEIN RecName: Full=Peptidoglycan synthetase ftsI;       
  421::677     2e-07  27%  798 aa  PBPA_NEILA RecName: Full=Penicillin-binding protein 1A;       
   66::481     3e-07  25%  750 aa  PBPX_STRR6 RecName: Full=Penicillin-binding protein 2X;       
  420::676     6e-07  30%  798 aa  PBPA_NEIFL RecName: Full=Penicillin-binding protein 1A;       
  196::321     2e-05  31%  581 aa  PBP2_NEIMB RecName: Full=Penicillin-binding protein 2;       
  196::321     2e-05  31%  581 aa  PBP2_NEIMA RecName: Full=Penicillin-binding protein 2;       
  196::321     2e-05  31%  581 aa  PBP2_NEIGO RecName: Full=Penicillin-binding protein 2;       
  231::457     2e-05  26%  679 aa  FTSI_CHLAT RecName: Full=Peptidoglycan synthetase ftsI homolog;    
   69::179     5e-05  38%  184 aa  LBP_RENRE RecName: Full=Luciferin-binding protein;       
  638::717     4e-04  34%  817 aa  SYL_HALHL RecName: Full=Leucyl-tRNA synthetase;       
   15::139     4e-04  30%  400 aa  PBP2_NEIFL RecName: Full=Penicillin-binding protein 2;       
  416::542     5e-04  28%  790 aa  PBPA_RICFE RecName: Full=Penicillin-binding protein 1A;       
  346::584     8e-04  25%  624 aa  PBPD_BACSU RecName: Full=Penicillin-binding protein 4;       
    8::65      8e-04  38%  433 aa  MNTH_ACICJ RecName: Full=Probable manganese transport protein mntH;
    1::622

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxRRSLMALCMTVAFAGGSLTACTPRPDTADPIAEEFLQAWASQDFDTIADITDQADLATEMLSTSF
PBP2_HAEIN      ----------------------------------------------------------------------
PBPA_MYCS2      ----------------------------------------------------------------------
PBPC_BACSU      -----KKCILLVFLCVGLIG--LIGCS-KTDSPEDRMEAFVKQWNDQQFDDMYQSLTK-DVKKEISKKDF
SP5D_BACSU      ----------------------------------------------------------------------
PBP_STAAU       ----------------------------------------------------------------------
PBPB_BACSU      ----------------------------------------------------------------------
PBPA_MYCTU      ----------------------------------------------------------------------
PBPI_BACSU      ----------------------------------------------------------------------
PBP2_ECOLI      ----------------------------------------------------------------------
PBP2_ECOL6      ----------------------------------------------------------------------
PBP2_ECO57      ----------------------------------------------------------------------
FTSI_MESVI      ----------------------------------------------------------------------
PBP2_SALTY      ----------------------------------------------------------------------
FTSI_ECOLI      ----------------------------------------------------------------------
FTSI_ECO57      ----------------------------------------------------------------------
PBPX_STRPN      ----------------------------------------------------------------------
FTSI_HAEIN      ----------------------------------------------------------------------
PBPA_NEILA      ----------------------------------------------------------------------
PBPX_STRR6      ----------------------------------------------------------------------
PBPA_NEIFL      ----------------------------------------------------------------------
PBP2_NEIMB      ----------------------------------------------------------------------
PBP2_NEIMA      ----------------------------------------------------------------------
PBP2_NEIGO      ----------------------------------------------------------------------
FTSI_CHLAT      ----------------------------------------------------------------------
LBP_RENRE       ----------------------------------------------------------------------
SYL_HALHL       ----------------------------------------------------------------------
PBP2_NEIFL      ----------------------------------------------------------------------
PBPA_RICFE      ----------------------------------------------------------------------
PBPD_BACSU      ----------------------------------------------------------------------
MNTH_ACICJ      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DGLQADSVELTLDSVDSRDTIATANFSVVWKLPRDREVSYDSSMTLTKMRNEWTVRWEPSLVHPKLGANQ
PBP2_HAEIN      ----------------------------------------------------------------------
PBPA_MYCS2      ----------------------------------------------------------------------
PBPC_BACSU      EQAGVKNLKVTAGEVDKDDQDNKTMKHIPYKVSMNTKVSFKNTAVLTDDEESWNIDWDPSFIFKQLADDK
SP5D_BACSU      ----------------------------------------------------------------------
PBP_STAAU       ----------------------------------DRNVQFN----FVKEDGMWKLDWDHSVIIPGMQKDQ
PBPB_BACSU      ---------------------------------------------------------------------Q
PBPA_MYCTU      ----------------------------------------------------------------------
PBPI_BACSU      ----------------------------------------------------------------------
PBP2_ECOLI      ----------------------------------------------------------------------
PBP2_ECOL6      ----------------------------------------------------------------------
PBP2_ECO57      ----------------------------------------------------------------------
FTSI_MESVI      ----------------------------------------------------------------------
PBP2_SALTY      ----------------------------------------------------------------------
FTSI_ECOLI      ----------------------------------------------------------------KEGDMR
FTSI_ECO57      ----------------------------------------------------------------KEGDMR
PBPX_STRPN      ----------------------------------------------------------------------
FTSI_HAEIN      ----------------------------------------------------------------------
PBPA_NEILA      ----------------------------------------------------------------------
PBPX_STRR6      ----------------------------------------------------------------------
PBPA_NEIFL      ----------------------------------------------------------------------
PBP2_NEIMB      ----------------------------------------------------------------------
PBP2_NEIMA      ----------------------------------------------------------------------
PBP2_NEIGO      ----------------------------------------------------------------------
FTSI_CHLAT      ----------------------------------------------------------------------
LBP_RENRE       ----------------------------------------------------------------------
SYL_HALHL       ----------------------------------------------------------------------
PBP2_NEIFL      ----------------------------------------------------------------------
PBPA_RICFE      ----------------------------------------------------------------------
PBPD_BACSU      ----------------------------------------------------------------------
MNTH_ACICJ      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           HLELRAIEAQRANVISSDGAPVLAPGSIYRVLADPSAGDADVVVKRVADYLNEAHATDENVNTLDVEDIM
PBP2_HAEIN      ----------------------------------------------------------------------
PBPA_MYCS2      ----------------------------------------------------------------------
PBPC_BACSU      TVQIMSIEPKRGQIYDKNGKGLAVNTDVPEIGIVPGEGDXDLTEDDIKKKLDQGWVKDDSFVPLDQEKLV
SP5D_BACSU      ----------------------------------------------------------------------
PBP_STAAU       SIHIENLKSERGKILDRNNVELANTGTHMRLGIVPSKKDYKAIAKELSDYINNGYKMIPSFHFKTVKKMD
PBPB_BACSU      HEKKRTIEASRGSILDRKGKVIAEDTATYKLIADKKMTTDVKHPQHVVNKEKTAEALSKVIN-LDKADIL
PBPA_MYCTU      ----------------------------------------------------------------------
PBPI_BACSU      ----------------------------------------------------------------------
PBP2_ECOLI      ----------------------------------------------------------------------
PBP2_ECOL6      ----------------------------------------------------------------------
PBP2_ECO57      ----------------------------------------------------------------------
FTSI_MESVI      ----------------------------------------------------------------------
PBP2_SALTY      ----------------------------------------------------------------------
FTSI_ECOLI      SLRVQQVSTSRGMITDRSGRPLAVSVPVKAIWADPKAGGISVGDRWKA----LANALNIPLDQLSARINA
FTSI_ECO57      SLRVQQVSTSRGMITDRSGRPLAVSVPVKAIWADPKAGGISVGDRWKA----LANALNIPLDQLSARINA
PBPX_STRPN      HQTTRTVPAKRGTIYDRNGVPIAEDATSYNVYAKSATGKILYVEKTQFNKVAEVFHKYLDMEESYVREQL
FTSI_HAEIN      ----------------------------------------------------------------------
PBPA_NEILA      ----------------------------------------------------------------------
PBPX_STRR6      HQTTRTVPAKRGTIYDRNGVPIAEDATSYNVYAKSATGKILYVEKTQFNKVAEVFHKYLDMEESYVREQL
PBPA_NEIFL      ----------------------------------------------------------------------
PBP2_NEIMB      ----------------------------------------------------------------------
PBP2_NEIMA      ----------------------------------------------------------------------
PBP2_NEIGO      ----------------------------------------------------------------------
FTSI_CHLAT      ----------------------------------------------------------------------
LBP_RENRE       ----------------------------------------------------------------------
SYL_HALHL       ----------------------------------------------------------------------
PBP2_NEIFL      ----------------------------------------------------------------------
PBPA_RICFE      ----------------------------------------------------------------------
PBPD_BACSU      ----------------------------------------------------------------------
MNTH_ACICJ      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           SNLGDSTYSLTTVDANLGARMEQDLAGIPGLTFNEEASMVATDPGFAPDIVSRVARIVEDELEGSNGWRA
PBP2_HAEIN      -----------------------------------------------------IERYYEDILQGTTGFEE
PBPA_MYCS2      ----------------------------------------------------------------------
PBPC_BACSU      SE-ATSLQGVTRTNVSYGEKTAHLTGYVRAITAEELKKKKEGTYSDTSNIIAGLENVYEDKLRGTTGWKI
SP5D_BACSU      ----------------------------------------------------------DDDLKGEKGSVK
PBP_STAAU       EYLSDKKFHLTTNETELG-KATSHLLGYVG-PINSEELKQKEYKGYKDDAVKGLEKLYDKKLQHEDGYRV
PBPB_BACSU      DILNKDAFGSAGRDITYSQKQKIEKMKLPGISFLRDTKRYYPNGVFASNLIGGLEKVLDKYLKERDGYVT
PBPA_MYCTU      ----------------------------------------------------------------------
PBPI_BACSU      ----------------------------------------------------------------------
PBP2_ECOLI      -----------------------------------------------------IERYYEDVLHGQTGYEE
PBP2_ECOL6      -----------------------------------------------------IERYYEDVLHGQTGYEE
PBP2_ECO57      -----------------------------------------------------IERYYEDVLHGQTGYEE
FTSI_MESVI      ----------------------------------------------------------------------
PBP2_SALTY      -----------------------------------------------------IERYYENDLHGKTGYQE
FTSI_ECOLI      NPKGRFIYLARQVNPDMADYIKK--LKLPGIHLREESEVTAHLIGFTSQGIEGVEKSFDKWLTGQPGERI
FTSI_ECO57      NPKGRFIYLARQVNPDMADYIKK--LKLPGIHLREESEVTAHLIGFTSQGIEGVEKSFDKWLTGQPGERI
PBPX_STRPN      SNLKQVSFGAKTYANMMSIKKELEAAEVKGIDFTTSPNRSYPNGQFASSFIG-LAQLHENELLGTSGMES
FTSI_HAEIN      ----------------------------------EEAAHVVGYTDIDGNGIEGIEKSFNSLLVGKDGSRT
PBPA_NEILA      ----------------------------------------------------------------------
PBPX_STRR6      SNLKQVSFGAKTYANMMSIKKELEAAEVKGIDFTTSPNRSYPNGQFASSFIG-LAQLHENELLGTSGMES
PBPA_NEIFL      ----------------------------------------------------------------------
PBP2_NEIMB      ---------------------------------------------------------LEDSLHGEDGAEV
PBP2_NEIMA      ---------------------------------------------------------LEDSLHGEDGAEV
PBP2_NEIGO      ---------------------------------------------------------LEDSLYGEDGAEV
FTSI_CHLAT      ----------------------------------------------------------------------
LBP_RENRE       ----------------------------------------------------------------------
SYL_HALHL       ----------------------------------------------------------------------
PBP2_NEIFL      ----------------------------------------------------------EDSLRGEDGAKV
PBPA_RICFE      ----------------------------------------------------------------------
PBPD_BACSU      ----------------------------------------------------------------------
MNTH_ACICJ      -----------------------------------------------PGLSERTARAVADRLAGRAGWRN


                         .         *         .         .         .         .         +:350
query           SIVTSNGAVIDDIAYDAPELAPSVRISLDHNVQRAAEEAVDLRAEMKAMMVVMRPSTGEILAVAQTDEAD
PBP2_HAEIN      VEINNRGKVIRTLRSRPAVAGKSIHLTIDLALQRYITE---LLSGLKGAVVVLDPKDSSVLAMVSTPSYD
PBPA_MYCS2      ----------------------NVDTTIKPQVQQAAWDAMQNGCDCRGSVVALEPSTGKILAMAQADAWE
PBPC_BACSU      YVPQTGEVIAEKKAKDGEDL----HLTIDIKTQM---KLYDELKDDSGAAVALQPKTGETLALVSAPSYD
SP5D_BACSU      FYTDAKGKKMPDEAYTPPKDGLDMKLTVDSKVQTIMERELD-NAEAKMIAVAMNPKNGEILGMSSRPDFD
PBP_STAAU       TIVDNSNTIAHTLIEKKKKDGKDIQLTIDAKVQKS------IYNNMKGSGTAIHPQTGELLALVSTPSYD
PBPB_BACSU      YESDKSGWELPNSKITAPKNGDNVYLTIDQKIQTFLEDSMTKVAQKKIMAAVVDPKTGKVLAMGQRPSFD
PBPA_MYCTU      ----------------------NVDTTINPRIQQAGWDAMQCYGPCKGAVVALEPSTGKILALVSSPSYD
PBPI_BACSU      -----------------------IKTTIDQSIQKAMEEVLDEQGLKKGGAVLLDIENSSVLGIVSKPDAD
PBP2_ECOLI      VEVNNRGRVIRQLKEVPPQAGHDIYLTLDLKLQQYIET---LLAGSRAAVVVTDPRTGGVLALVSTPSYD
PBP2_ECOL6      VEVNNRGRVIRQLKEVPPQAGHDIYLTLDLKLQQYIET---LLAGSRAAVVVTDPRTGGVLALVSTPSYD
PBP2_ECO57      VEVNNRGRVIRQLKEVPPQAGHDIYLTLDLKLQQYIET---LLAGSRAAVVVTDPRTGGVLALVSTPSYD
FTSI_MESVI      -----------------------LQLTIDLDLQKASYDGIKKCNAKRGTVIILDPYTGAILALVTAPSYD
PBP2_SALTY      VEVDNHGRIVRLLKDVPPIAGKNIHLTLDLHLQEYIES---LLAGQRAAVLVEDPHDGSVLAMVSMPSYD
FTSI_ECOLI      VRKDRYGRVIEDISSTDSQAAHNLALSIDERLQRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYN
FTSI_ECO57      VRKDRYGRVIEDISSTDSQAAHNLALSIDERLQRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYN
PBPX_STRPN      SLNSILAGTDGIITYEKDRLGKDVYTTISSPLQSFMETQMDAFQEMTATLVSAK--TGEILATTQTFDAD
FTSI_HAEIN      VRKDKRGNIVDEKKYDAQDVTLSIDEKLQSMVYREIKKAVSENNAESGTAVLVDVRTGEVLAMATAPSYN
PBPA_NEILA      ---------------------------------------------LQGALVSLDAKTGAVRAVGGYDFHS
PBPX_STRR6      SLNSILAGTDGIITYEKDRLGKDVYTTISSPLQSFMETQMDAFQEMTATLVSAK--TGEILATTQTFDAD
PBPA_NEIFL      ---------------------------------------------LQGALVSLDAKTGAVRAVGGYDYHS
PBP2_NEIMB      VLRDRQGNIVDSLRNKAPKNGKDIILSLDQRIQTLAYEAVEYHQAKAGTVVVLDARTGEILALANTPDSE
PBP2_NEIMA      VLRDRQGNIVDSLRNKAPKNGKDIILSLDQRIQTLAYEAVEYHQAKAGTVVVLDARTGEILALANTPDSE
PBP2_NEIGO      VLRDRQGNIVDSLRNKAPQNGKDIILSLDQRIQTLAYEAVEYHQAKAGTVVVLDARTGEILALANTPDSE
FTSI_CHLAT      ---------------------------------KALKQGLENCKGKRGTVLILDPKTGGILTLVALPSYD
LBP_RENRE       -------------------LAPGVRISVEEAAVNATDSLLKMKAEEKAMAVI------QSLIMYDCIDTD
SYL_HALHL       ----------------------------------------------------------------------
PBP2_NEIFL      VLRDNKGNIVDSLRNSVPKNGQDMILSLDQRIQTLANKAVAYHKAKAGAVVVLDAQTGEILALVNSPAYD
PBPA_RICFE      --------------------------------------------EVNGAIMVMNPNTGQVLAVGGYDFST
PBPD_BACSU      -------------------------------------------ADVQGGAAVINHQTHQIIALSGGKNYQ
MNTH_ACICJ      PLIFAGPAVVASIAYMDPG-------NFATNIQAGARYGYDL----------------------------


                         .         .         .         .         *         .         .:420
query           KDGDVALMGQYPPGSTFKIITAAAGLAHEGLTPDSIVPCPGTMNIYGRIVTNYNSFSLGNTSLDDAFANS
PBP2_HAEIN      NNLFVATQGAYPPASTVKPFIAVAAQTENVITPNTTIFDPGYWVLPNKRFRDWKKTGHGDTDLNKAITES
PBPA_MYCS2      KLRDDAISETYPPGSTFKVITTAAALQAGARPQTQLTSAPRTLPDSTATLENFGGAPCGTVSLQEAFAKS
PBPC_BACSU      PNGSAKFNKTYAPGSTIKPIAAAIGIKNGTLKADEKKTIKGKESSWGGYSVTRVSERLQQVDLENALITS
SP5D_BACSU      PNRNLPVWSTYEPGSTFKIITLAAALEEQNLKRDQFYD-KGHAEVDGARLRCWKRGGHGLQTYLEVVQNS
PBP_STAAU       EDKKEPLLNKFSPGSTQKILTAMIGLNNKTLDDKTSYKIDGDKSWGGYNVTRYEVVN-GNIDLKQAIESS
PBPB_BACSU      PNRDVTISYAYEPGSTMKIFTLAAAMQENVFNANEKYK-SGTFEVGGAPVKDHNNVGWGPTTYHDGVLRS
PBPA_MYCTU      PNGDNAISETYPPGSTFKVIXXXXXXXXXXXXXXXXIPLPGST----AQLENYGGAPCGDVSLREAFVKS
PBPI_BACSU      VSRQNTLQNYMLPGSVFKTVIAAAAIENNMVKPSQTFNC--NLNLYGE-----PGDDKGTLSFDESFAQS
PBP2_ECOLI      PDGNRATQGVYPPASTVKPYVAVSALSAGVITRNTTLFDPGWWQLPGKRYRDWKKWGHGRLNVTRSLEES
PBP2_ECOL6      PDGNRATQGVYPPASTVKPYVAVSALSAGVITRNTTLFDPGWWQLPGKRYRDWKKWGHGRLNVTRSLEES
PBP2_ECO57      PDGNRATQGVYPPASTVKPYVAVSALSAGVITRNTTLFDPGWWQLPGKRYRDWKKWGHGRLNVTRSLEES
FTSI_MESVI      PNKNWPVIDLYEPGSTFKPINMAIALEAKAIKKNDFFYDEGCIQISDTIITNNNYYNKSHLNITDVLSNS
PBP2_SALTY      PNPFVVTQGLYPPASTVKPYMAMSALLCGIITPQTTFTLPGTQRHY----RDWKKTGHGMLDVTKAIEES
FTSI_ECOLI      PNNNRTITDVFEPGSTVKPMVVMTAL-QRGVVRENSVLNTIPYRINGHEIKDVARYS--ELTLTGVLQKS
FTSI_ECO57      PNNNRTITDVFEPGSTVKPMVVMTAL-QRGVVRENSVLNTIPYRINGHEIKDVARYS--ELTLTGVLQKS
PBPX_STRPN      KEGDILYQSNYEPGSTMKVMMLAAAIDNNTF-PGGEVFNSSELKIADATIRDWDGLTGGRTTFSQGFAHS
FTSI_HAEIN      PNNRVAITDTFEPGSTVKPFVVLTALQRGVVKRDEIIDTT-SFKLSGKEIVDV--APRAQQTLDEILMNS
PBPA_NEILA      KTFNRATQAMRQPGSTFKPFVYSAALS-KGMTADAPISLPGK-GPNGSVWTPKNSDGRGYITLRQALTAS
PBPX_STRR6      KEGDILYQSNYEPGSTMKVMMLAAAIDNNTF-PGGEVFNSSELKIADATIRDWNEGLTGGMTFSQGFAHS
PBPA_NEIFL      KTFNRATQAMRQPGSTFKPFIYSAALA-KGMTADAPISLPGK-GANGKAWNPKNSDGAGYITLRQALTAS
PBP2_NEIMB      QRRNRAVTDMIEPGSAIKPFVIAKAL--------------------------------------------
PBP2_NEIMA      QRRNRAVTDMIEPGSAIKPFVIAKAL--------------------------------------------
PBP2_NEIGO      QRRNRAVTDMIEPGSAIKPFVIAKAL--------------------------------------------
FTSI_CHLAT      PNKPWPVTDLYEPGSTFKPLNIAIALETKAISPEDSFYDEGCIRVGDSIITNYNSYKLPNTKIVKLLANS
LBP_RENRE       KDGYVSL-------PEFKAFLQAVG---PDITDDKAITCFNTLNKNGQITVNDFLFGLEETALANAF---
SYL_HALHL       ----------------------------------------------------------------------
PBP2_NEIFL      PNRNRAVTDMIEPGSAMKPFTIAKAL--------------------------------------------
PBPA_RICFE      SKFDRVTQALRQPGSLSKTFVYLAALEN-GIKPNQIFQGPGMPSWRPK---NYEGKFLGEITMRTGLEKS
PBPD_BACSU      KDFNRAYQAYRQPGSSIKLLDYGPYIEQTGATTSSTIDASKFCS-KDYCPQNYNNRTYGTVTLDTAFKNS
MNTH_ACICJ      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           CNTTFADISTNLEPGQLKNVAKQFGLGIDYQIPGLDTMTGSVPAGDIVLDRTESGYGQGLDLASPFGMAL
PBP2_HAEIN      SDTYFYQVAYNMGIDRLSNWMKDFGFGMPTGIEIQEETAANIPTREVQGDTISVGIGQGYWTATPLQVAK
PBPA_MYCS2      CNTAFVELGLSTGTDKLKAMAQAFGL--DTPPPAIPLQVAESTTGPIVAALGMSSIGQRDVALTPLQNAQ
PBPC_BACSU      DNIYFAQNALDMGADTFTKGLKTFGFSEDYEFPQKSSIANDKLDSDILL--ADTGYGQGQMQMSPLHLAT
SP5D_BACSU      CNPGFVELGERLGKEKLFKYIKDFGFGIDLQGEGTGILFPLERVGPV--EQATTAFGQGVSVTPIQQVAA
PBP_STAAU       DNIFFARVALELGSKKFEKGMKKLGVGEDIDYPFYNAQISNKNLDNEIL-LADSGYGQGEILINPVQLSI
PBPB_BACSU      SNVAFAKLAEKLGYDRLNQYLHKFNF---YQKTGID-LPGEVSSKKYEFDKASTAYGQASAVTPXXXXXX
PBPA_MYCTU      CNTAFVQLGIRTGADALRSMARAFGLDSPPRPTPLESTVGPIP-DSAALGMT--SIGQKDVALTPLANAE
PBPI_BACSU      CNYTFTSLAEQLDSSVIEDMSEKLALTHETDFRQLYNEKSGVIWGDVKKAIAQTAIGQKNVKVTPLEVAN
PBP2_ECOLI      ADTFFYQVAYDMGIDRLSEWMGKFGYGHYTGIDLAEERSGNMPTREWKQKRFKKGIGQGYWTATPIQMSK
PBP2_ECOL6      ADTFFYQVAYDMGIDRLSEWMGKFGYGHYTGIDLAEERSGNMPTREWKQKRFKKGIGQGYWTATPIQMSK
PBP2_ECO57      ADTFFYQVAYDMGIDRLSEWMGKFGYGHYTGIDLAEERSGNMPTREWKQKRFKKGIGQGYWTATPIQMSK
FTSI_MESVI      SNVGMVHILQRLAPEIYYQWIQKLGLGTDFPLSSYSSLKNILEFTSYNIESAVTSFGQGLAM-TPIKLAL
PBP2_SALTY      ADTFFYQVAYMMGIDRIDTMLSQFGYGKPTGIDLNEEYDGLLPSGDTI----SVGIGQGYWIATPIQMVA
FTSI_ECOLI      SNVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSGLYPQKQSDIERATFSFGYGL-MVTPLQLAR
FTSI_ECO57      SNVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSGLYPQKQSDIERATFSFGYGL-MVTPLQLAR
PBPX_STRPN      SNVGMTLLEQKMGDATWLDYLNRFKFGVPTRFGLTDEYAGQLPADNIV-NIAQSSFGQGISVTQTQMIRA
FTSI_HAEIN      SNRGVSRLALRMPPSALMETYQNAGLSKPTDLGLIGEQVGILNANRADIERATVAYGYGI-TATPLQIAR
PBPA_NEILA      KNMVSIRILMSIGVGYAQQYIRRFGFKPSELPVSLSMALGTGETTPLRIAEAYSVFANGGYRVSSYVIDK
PBPX_STRR6      SNVGMTLLEQKMGDATWLDYLNRFKFGVPTRFGLTDEYAGQLPADNIV-NIAQSSFGQGISVTQTQMIRA
PBPA_NEIFL      KNMVSIRILMSIGIGYAQQYIQRFGFKPS-EIPA--SLSMALGAGETTPLRIAEGYSVGYKVSAHVIDKI
PBP2_NEIMB      ----------------------------------------------------------------------
PBP2_NEIMA      ----------------------------------------------------------------------
PBP2_NEIGO      ----------------------------------------------------------------------
FTSI_CHLAT      SNVGMVHILERIAPEIYHSWLSKLDLGLETDLPWA-SESSLKDINEFVIEPAAASFGQGLAM-TPIKLAL
LBP_RENRE       ----------------------------------------------------------------------
SYL_HALHL       ----------------------------------------------------------------------
PBP2_NEIFL      ----------------------------------------------------------------------
PBPA_RICFE      CNLITVRVATAVGLTKIVDIIKRFGI--------------------------------------------
PBPD_BACSU      YNTPAIRMLDRV------GIQKAFSYIEPYHF-------AKLVDSDYLLPAALGGFTNGM---TPLEMTK
MNTH_ACICJ      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           VASTAATGSVPTPTLISGHETVASEEVPALDPEVLANVQRMMKSVVNDGTARGMRQTGGQIYAKTGEAEI
PBP2_HAEIN      ATTILVNGKVNTPHLMKAIEGAVLEEDPLLYPDIWEAAKRGMYNVVNNGTGRAFADANYRVAGKSGTAQV
PBPA_MYCS2      VAATIANDSLKGPDLATISTTTPEQERRAVSPQVAATLTDLMVAAEQVTQQKG-AIAGVQIASKTGTAER
PBPC_BACSU      AYTPVDNGDLVKPTLIKDSQTADVWHKQVVTKEGAADITKGLKGVVEDGSAYQPVVKGITVAGKTGTAEL
SP5D_BACSU      VSAAVNGGTLYTPYIVKKQSPIAKKQV--ISEETSKQIRYALESVVAEGTGRNAFVEGYRVGGKTGTAQV
PBP_STAAU       YSALENNGNINAPHLLKDTKNKVWKK-NIISKENINLLNDGMQQVVNKTHKEDIYRSYANLIGKSGTAEL
PBPB_BACSU      XXXXXNDGKMMKPYVIDKDKTIYQNKPESAGTPISASTAKKVRDILGEGTGQAYKIEGFDVAGKTGTAQI
PBPA_MYCTU      IAATIAVGSLKGPDLANISTTVGYQQRRAVSPQVAAKLTELMVGAEKVAQQKG-AIPGVQIASKTGTAER
PBPI_BACSU      MMATIARGGEKRQVKINGTTLVTFKDQETIDKYTSQQLQKILRRVVESGTGRRFQDLPYTVAGKSGTAQT
PBP2_ECOLI      ALMILINGIVKVPHLLMS-TAEDGKQVPWVQPHPVGDIHSGYWELAKDGMYGVANRPNGKIAAKSGTAQV
PBP2_ECOL6      ALMILINGIVKVPHLLMS-TAEDGKQVPWVQPHPVGDIHSGYWELAKDGMYGVANRPNGKIAAKSGTAQV
PBP2_ECO57      ALMILINGIVKVPHLLMS-TAEDGKQVPWVQPHPVGDIHSGYWELAKDGMYGVANRPNGKIAAKSGTAQV
FTSI_MESVI      YACLSNGGNIIRPYIVDGLFDIQNEKLFTLNPSTTEIVLDMLEEVIFNGTGSSCFLPGYRIGGKTGTSQ-
PBP2_SALTY      MVALINNGKVIAPHLLLNEES-------------------------------------------------
FTSI_ECOLI      VYATIGSYGIYRPLSITKVDPVPGERV--FPESIVRTVVHMMESVALPG-GGGVKAAGYRIAIKTGTAK-
FTSI_ECO57      VYATIGSYGIYRPLSITKVDPVPGERV--FPESIVRTVVHMMESVALPG-GGGVKAAGYRIAIKTGTAK-
PBPX_STRPN      FTAIANDGVMLEPKFIS-----------------------------------------------------
FTSI_HAEIN      AYATLGSFGVYRPLSITKSEKITKDIVGILEKVAIKNKRAMVEGYVKTGTAR------------------
PBPA_NEILA      IYDSEGRLRAQMQPLVAGQNAPQ-----AIDPRNAYIMYKIMQDVVRVGTARGASALGSDIAGKTGTT--
PBPX_STRR6      FTAIANDGVMLEPKFIS-----------------------------------------------------
PBPA_NEIFL      YDSQGRLRAQMQPL-------VAGENAPAIDPRNAYIMYKIMQDVVRVGTARGAATLGSDIAGKTGTT--
PBP2_NEIMB      ----------------------------------------------------------------------
PBP2_NEIMA      ----------------------------------------------------------------------
PBP2_NEIGO      ----------------------------------------------------------------------
FTSI_CHLAT      YASLANGGILVKPYLVTGLANAAED---------------------------------------------
LBP_RENRE       ----------------------------------------------------------------------
SYL_HALHL       ---------------------VAAGPAPALDPQALSDTQRDLRRKVHETIAKASDDVGKRLTFNTAIAAV
PBP2_NEIFL      ----------------------------------------------------------------------
PBPA_RICFE      ----------------------------------------------------------------------
PBPD_BACSU      AYTTFGNSGSYTPTDLKGKTLYKWNDKATQIFSVRTNMQKLMSSVVKSGTGKKAYFNAPYIGGKTGTS--
MNTH_ACICJ      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           NEGSHAWFTGYREDDIAFATLVVLGGGSEAAAAVTDQFFxxxxxxxxxxxxxxxxxxxxxxx
PBP2_HAEIN      NEHDHAWFTAYAPYDNPKLVVTVIGGGSSNAA------------------------------
PBPA_MYCS2      NTPPHAWYIAFQDPKVAVAVLVEDGG------------------------------------
PBPC_BACSU      KTSENGWFVGY---------------------------------------------------
SP5D_BACSU      KDGKY---------------------------------------------------------
PBP_STAAU       KQGETGWFISYDKDN-----------------------------------------------
PBPB_BACSU      --------------------------------------------------------------
PBPA_MYCTU      HTPPHAWY------------------------------------------------------
PBPI_BACSU      GKLSEKWFAGYFPADKPKYALVVLHMDTPGDKALTNSVF-----------------------
PBP2_ECOLI      NETYNAHFAPYNNPQVAVAMILENGGAGPAVGTLMRQ-------------------------
PBP2_ECOL6      NETYNAHFAPYNNPQVAVAMILENGGAGPAVGTLMRQ-------------------------
PBP2_ECO57      NETYNAHFAPYNNPQVAVAMILENGGAGPAVGTLMRQ-------------------------
FTSI_MESVI      ---KHAEQGGYSTKHISFAAIFPINNPQYVILSVIDE-------------------------
PBP2_SALTY      --------------------------------------------------------------
FTSI_ECOLI      --------------------------------------------------------------
FTSI_ECO57      --------------------------------------------------------------
PBPX_STRPN      --------------------------------------------------------------
FTSI_HAEIN      --------------------------------------------------------------
PBPA_NEILA      NDNKDAWFVGFNPDVV---TAVYIG-------------------------------------
PBPX_STRR6      --------------------------------------------------------------
PBPA_NEIFL      NDNKDAWFVGFNPNVV---TAVYIG-------------------------------------
PBP2_NEIMB      --------------------------------------------------------------
PBP2_NEIMA      --------------------------------------------------------------
PBP2_NEIGO      --------------------------------------------------------------
FTSI_CHLAT      --------------------------------------------------------------
LBP_RENRE       --------------------------------------------------------------
SYL_HALHL       MELCNA--LGKAQDDSA-AGRAVMQEGLEAAVLI----------------------------
PBP2_NEIFL      --------------------------------------------------------------
PBPA_RICFE      --------------------------------------------------------------
PBPD_BACSU      NDYHDMWFVG----------------------------------------------------
MNTH_ACICJ      --------------------------------------------------------------