[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF54857.1

[Show Plain Result]


## Summary of Sequence Search
    1::314
   55::318     2e-23  31%  325 aa  YFIY_BACSU RecName: Full=Probable siderophore-binding lipoprotein
   77::302     6e-19  28%  315 aa  YFMC_BACSU RecName: Full=Fe(3+)-citrate-binding protein
   38::283     5e-16  27%  300 aa  FECB_ECOLI RecName: Full=Fe(3+) dicitrate-binding periplasmic
   95::284     6e-14  27%  317 aa  FEUA_BACSU RecName: Full=Iron-uptake system-binding protein;Flags:
   80::315     3e-12  24%  317 aa  YCLQ_BACSU RecName: Full=Uncharacterized ABC transporter
   36::294     3e-12  24%  305 aa  CBRA_DICD3 RecName: Full=Achromobactin-binding periplasmic
   82::316     2e-09  27%  322 aa  FATB_VIBAN RecName: Full=Ferric anguibactin-binding protein;Flags:
  104::294     4e-05  27%  321 aa  YXEB_BACSU RecName: Full=Iron(3+)-hydroxamate-binding protein
  324::505     5e-05  26%  529 aa  YBBB_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
  106::224     5e-04  23%  318 aa  FEPB_ECOLI RecName: Full=Ferrienterobactin-binding periplasmic
  106::224     5e-04  23%  318 aa  FEPB_ECOL6 RecName: Full=Ferrienterobactin-binding periplasmic
    1::314

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQRIVAXXXXXXXXXX
YFIY_BACSU      -------------------------------------------------------KRIVVLTNEGTEALL
YFMC_BACSU      ----------------------------------------------------------------------
FECB_ECOLI      -------------------------------------------------------QRIVVLELSFADALA
FEUA_BACSU      ----------------------------------------------------------------------
YCLQ_BACSU      ----------------------------------------------------------------------
CBRA_DICD3      -------------------------------------------------------QRVITLFQGATDTAV
FATB_VIBAN      ----------------------------------------------------------------------
YXEB_BACSU      ----------------------------------------------------------------------
YBBB_BACSU      ----------------------------------------------------------------------
FEPB_ECOLI      ----------------------------------------------------------------------
FEPB_ECOL6      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXITPVGVAAAKNSDLIPQFLKDRFSADMDLDSIADCGLRQSPDIEAIANLNPTLICANSRADEEVLNK
YFIY_BACSU      ALGIKPVGAVKSWKGDPWYDYLKD------DMKGVKNVGLETEPNVEAIAELKPDLIIGNKVRQEKIYDQ
YFMC_BACSU      ---ITPVGIADDNKKDMIKKLV----GSSIDYTSV---GTRSEPNLEVISSLKPDLIIADAERHKNIYKQ
FECB_ECOLI      AVDVIPIGIADDNDAKRILPEVRAH------LKPWQSVGTRAQPSLEAIAALKPDLIIADSSRHAGVYIA
FEUA_BACSU      --------------------------------DKAEPTGEKMEPNIEKILEMKPDVILASTKFPEKTLQK
YCLQ_BACSU      -----------------LPKQVLPKYLSKFKDDKYADVGSLKEPDFDKVAELDPDLIIISARQSES-YKE
CBRA_DICD3      ALGITPAGVVDSWSEKPMYRYLRQA------LAGVPHVGLETQPSLEDIVLLKPDAIVASRFRHQRLEPL
FATB_VIBAN      ---------------DFVPHFL-EKYKNTPD---ISDLGAIVQPNMEKIYALKPDLVLMTPLHANQY-EE
YXEB_BACSU      ---------------------------------------------VEKVMELQPDLIVV---MNEENVDK
YBBB_BACSU      --------------------------------------------NLYTLSQAEPDVIVSMDSISPEEQDR
FEPB_ECOLI      -------------------------------------------PSAEAVAAQMPDLILISATGGDSALDQ
FEPB_ECOL6      -------------------------------------------PSAEAVAAQMPDLILISATGGDSALDQ


                         +         .         .         .         .         *         .:210
query           LRTIAPVVTGEGGGENWKQDLLTIAEAAGQKEKAETLLKSYEDSAAEIAANQPANPPTVSFLRTKDQEFQ
YFIY_BACSU      LNAIAPTVFAESLAGNWKDNLTLYANAVNKADKGKEVIADFDKRVSDLKNKGDQTNKTVSVVRFLSGESR
YFMC_BACSU      LKKIAPTISREATYDETIDSFTTIAKALNKEDEGKEKLAEHKKVINDLKAELPKDENRNIVLGARADSFQ
FECB_ECOLI      LQQIAPVLLLKSRNETYAENLQSIGEMVGKKREMQARLEQHKERMAQWASQLPKG-TRVAFGTSREQQFN
FEUA_BACSU      ISTAGTTIPVSHISSNWKENMMLLAQLTGKEKKAKKIIADYEQDLKEIKTNDKAKDSKALVIRIRQGNIY
YCLQ_BACSU      FSKIAPTVDTAKYMESFKSDAETIGKIFDKEDKVKDELANIDHSIADVKKTAEKLNKNGLVIMANDGKIS
CBRA_DICD3      LSQIAPVVMLDEIYQ-FKKTVQVMGQALQRQAVADQLLQNWQLRVNGLREQLQRKPPTVSILDIREDHIR
FATB_VIBAN      LSKLAPTVHFDIDFRNSKQHVIDLGEIFNKQTLAQKKVAEIDAKVDEVQALTAERSEKALVVMHNNGSFS
YXEB_BACSU      LKKIAPVVIPYNTAKNVEDTVSMFGDIAGAKDQAKSFMADFNXXXXXXXXXXXGKDATFGIYENTDKEFW
YBBB_BACSU      LNRIAEVMYLPSE-ESWRTHFLQTASFLKEESEAEKWLADYDQTTAAKKTLQHVQGLRFLFLRLHKQNFY
FEPB_ECOLI      LSTIAPTLIINYDDKSWQSLLTQLGEITGHEKQAAERIAQFDKAAAKEQIKLPPQPVTAIVYTAAAHSAN
FEPB_ECOL6      LSTIAPTLIINYDDKSWQSLLTQLGEITGHEKQAAERIAQFDKAAAKEQIKLPPQPVTAIVYTAAAHSAN


                         .         .         .         +         .         .         .:280
query           MYGAQSMAGTVAADCGYARPENQQFTDTAGQDLSAELIAQADADWLFYGMKEGNINPEDTPLWTSLKAVQ
YFIY_BACSU      IYYTDSFPGIILDQLGFKRPEKQQFTFSTD---SKESIPDMDADVLFYFTYKADNAKENSSLWKNLKAVK
YFMC_BACSU      LHTSSSYDGEIFKMLGFTHAVK---SDNAYQEVSLEQLSKIDPDILFISANEGKTIVDENPLWKNLKAVK
FECB_ECOLI      LHTQETWTGSVLASLGLNVP--AAMAGASMPSIGLEQLLAVNPAWLLVAYREESIRWQQDPLWQMLTAAQ
FEUA_BACSU      IYPEQYFNSTLYGDLGLKAP-NEVKAAKAQELSSLEKLSEMNPDHIFFSDDENADKPEKNPIWKSLKAVK
YCLQ_BACSU      AFGPKSRYGLIHDVFGVAPADQNIKASTHGQSVSYEYISKTNPDYLFIGETSSTKQVVENDYVKNVNAVK
CBRA_DICD3      SYLPGSFPGSVLSELGFGWSDASRAQPGVSLKLTKESIPVVDADIFFIFLRSESPSVQRNPLWQQLRAPR
FATB_VIBAN      SFGIESRYGFVFDVLGVKPASTEIAASLHGQPISSEFINQANPDILYIAVMEGKIDAEHNPLLRQTKAWK
YXEB_BACSU      VFNDNGGRGGQAVALGLKAPEKEQDVIKKGEQLSQEVIPEYAADYMFIGESKTLDKLENSSIWKNLDAVK
YBBB_BACSU      LAHNRSVREVFFGDLGFSSATT---ADTPSQAISLENIAQADCMMLFLFKEPETIQLQQTEAWQNLSAVR
FEPB_ECOLI      LWTPESAQGQMLEQLGF-----------------------------------------------------
FEPB_ECOL6      LWTPESAQGQMLEQLGF-----------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SNQAIPVDGDSWYLNASLVSAEIILQGLKDNVxx
YFIY_BACSU      SGNAHEVDDVVWTTAGGIKAANYLLDDIE-----
YFMC_BACSU      NGQVYDADRDTWTRFRGIKSSE------------
FECB_ECOLI      KQQVASVDSNTWARMRGIFAAERI----------
FEUA_BACSU      ED--------------------------------
YCLQ_BACSU      NGHVIYLDSATWYLSGGLESMTQMIKEVKDGL--
CBRA_DICD3      RNQVWVVNGVTWSLSGGILGANMMLDDI------
FATB_VIBAN      NGKVIFVDADAWYISASITSLKIVIDDI------
YXEB_BACSU      HNRVFINDFDSFY---------------------
YBBB_BACSU      DNRVYLLSLDPW----------------------
FEPB_ECOLI      ----------------------------------
FEPB_ECOL6      ----------------------------------