[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF55031.1

[Show Plain Result]


## Summary of Sequence Search
    1::365
    1::245     1e-37  46%  260 aa  AG84_MYCTU RecName: Full=Antigen 84;
    1::245     1e-37  46%  260 aa  AG84_MYCBO RecName: Full=Antigen 84;
    1::60      1e-33  60%  266 aa  AG84_MYCLE RecName: Full=Antigen 84;
    8::66      3e-08  54%   98 aa  GPSB_GEOTN RecName: Full=Cell cycle protein gpsB;AltName:
    8::62      5e-08  47%   98 aa  GPSB_GEOKA RecName: Full=Cell cycle protein gpsB;AltName:
    1::57      8e-07  42%  164 aa  DIV4A_BACSU RecName: Full=Septum site-determining protein
  277::380     5e-06  38%  520 aa  K2C8_DANRE RecName: Full=Keratin, type II cytoskeletal 8;AltName:
  271::374     5e-06  38%  520 aa  ION3_CARAU RecName: Full=Intermediate filament protein ON3;
   91::190     6e-06  36%  245 aa  Y1661_MYCLE RecName: Full=Uncharacterized protein ML1661;
    8::85      1e-05  37%  203 aa  VATE_META3 RecName: Full=V-type ATP synthase subunit E;AltName:
   44::116     2e-05  37%  156 aa  ATPF_PSEMY RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    8::87      2e-05  33%  203 aa  VATE_METM5 RecName: Full=V-type ATP synthase subunit E;AltName:
   46::116     2e-05  36%  156 aa  ATPF_ALCBS RecName: Full=ATP synthase subunit b;AltName: Full=ATP
  220::305     4e-05  34%  422 aa  YADA_YERE8 RecName: Full=Adhesin yadA;Flags: Precursor;
    8::62      4e-05  40%  112 aa  GPSB_BACHK RecName: Full=Cell cycle protein gpsB;AltName:
    8::62      4e-05  40%  112 aa  GPSB_BACCZ RecName: Full=Cell cycle protein gpsB;AltName:
    8::62      4e-05  40%  111 aa  GPSB_BACCR RecName: Full=Cell cycle protein gpsB;AltName:
    8::62      4e-05  40%  112 aa  GPSB_BACCQ RecName: Full=Cell cycle protein gpsB;AltName:
    8::62      4e-05  40%  112 aa  GPSB_BACC7 RecName: Full=Cell cycle protein gpsB;AltName:
    8::62      4e-05  40%  111 aa  GPSB_BACC4 RecName: Full=Cell cycle protein gpsB;AltName:
    8::62      4e-05  40%  112 aa  GPSB_BACC3 RecName: Full=Cell cycle protein gpsB;AltName:
    8::62      4e-05  40%  111 aa  GPSB_BACC2 RecName: Full=Cell cycle protein gpsB;AltName:
    8::62      4e-05  40%  111 aa  GPSB_BACC1 RecName: Full=Cell cycle protein gpsB;AltName:
    8::62      4e-05  40%  112 aa  GPSB_BACC0 RecName: Full=Cell cycle protein gpsB;AltName:
    8::62      4e-05  40%  112 aa  GPSB_BACAN RecName: Full=Cell cycle protein gpsB;AltName:
    8::62      4e-05  40%  112 aa  GPSB_BACAH RecName: Full=Cell cycle protein gpsB;AltName:
    8::62      4e-05  40%  112 aa  GPSB_BACAC RecName: Full=Cell cycle protein gpsB;AltName:
    8::62      4e-05  40%  112 aa  GPSB_BACAA RecName: Full=Cell cycle protein gpsB;AltName:
   23::61      5e-05  44%  104 aa  GPSB_BACHD RecName: Full=Cell cycle protein gpsB;AltName:
   74::156     7e-05  27%  171 aa  ATPF_MYCGI RecName: Full=ATP synthase subunit b;AltName: Full=ATP
    8::62      9e-05  38%  111 aa  GPSB_BACWK RecName: Full=Cell cycle protein gpsB;AltName:
   69::133     1e-04  42%  166 aa  ATPF_FLAJ1 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   23::64      2e-04  54%  105 aa  GPSB_BACSK RecName: Full=Cell cycle protein gpsB;AltName:
   61::133     2e-04  25%  309 aa  FLIH_TREPA RecName: Full=Flagellar assembly protein fliH;
   49::116     2e-04  34%  156 aa  ATPF_COLP3 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
  766::819     3e-04  35%  865 aa  SYV_THEMA RecName: Full=Valyl-tRNA synthetase;       
   34::98      3e-04  31%  162 aa  ATPF_THELT RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   44::114     3e-04  27%  156 aa  ATPF_PSEAE RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   44::114     3e-04  27%  156 aa  ATPF_PSEAB RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   44::114     3e-04  27%  156 aa  ATPF_PSEA7 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   43::166     3e-04  27%  167 aa  ATPF_LEUMM RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   55::135     3e-04  28%  175 aa  ATPF_LACS1 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   76::143     3e-04  28%  172 aa  ATPF_BACLD RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   21::59      4e-04  41%  106 aa  GPSB_OCEIH RecName: Full=Cell cycle protein gpsB;AltName:
    7::67      4e-04  48%  117 aa  GPSB_LACBA RecName: Full=Cell cycle protein gpsB;AltName:
   21::62      4e-04  43%  101 aa  GPSB_BACP2 RecName: Full=Cell cycle protein gpsB;AltName:
    8::54      4e-04  43%  111 aa  GPSB_BACCN RecName: Full=Cell cycle protein gpsB;AltName:
   28::152     4e-04  27%  518 aa  CNPD_LEUMM RecName: Full=2',3'-cyclic-nucleotide
  724::874     5e-04  27% 1197 aa  SMC2_HUMAN RecName: Full=Structural maintenance of chromosomes
    6::67      5e-04  45%  114 aa  GPSB_LACS1 RecName: Full=Cell cycle protein gpsB;AltName:
   61::119     5e-04  34%  172 aa  ATPF_TROWT RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   61::119     5e-04  34%  172 aa  ATPF_TROW8 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   64::138     5e-04  31%  170 aa  ATPF_MYCMM RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   60::125     5e-04  31%  157 aa  ATPF1_METCA RecName: Full=ATP synthase subunit b 1;AltName:
  221::305     6e-04  32%  422 aa  YADA2_YEREN RecName: Full=Adhesin yadA;Flags: Precursor;
   80::155     6e-04  24%  245 aa  Y2952_MYCBO RecName: Full=Uncharacterized protein Mb2952c;
   80::155     6e-04  24%  245 aa  Y2927_MYCTU RecName: Full=Uncharacterized protein Rv2927c/MT2997;
   25::71      6e-04  34%  208 aa  VATE_CHLTR RecName: Full=V-type ATP synthase subunit E;AltName:
   25::71      6e-04  34%  208 aa  VATE_CHLTB RecName: Full=V-type proton ATPase subunit E;AltName:
   25::71      6e-04  34%  208 aa  VATE_CHLTA RecName: Full=V-type ATP synthase subunit E;AltName:
   25::71      6e-04  34%  208 aa  VATE_CHLT2 RecName: Full=V-type proton ATPase subunit E;AltName:
   25::71      6e-04  34%  208 aa  VATE_CHLMU RecName: Full=V-type ATP synthase subunit E;AltName:
  817::968     6e-04  29% 1191 aa  CING_MOUSE RecName: Full=Cingulin;
   41::128     6e-04  32%  164 aa  ATPF_AMOA5 RecName: Full=ATP synthase subunit b;AltName: Full=ATP
  241::299     8e-04  41%  432 aa  YADA_YERPS RecName: Full=Adhesin yadA;Flags: Precursor;
    1::45      8e-04  29%  187 aa  VATE_CLOD6 RecName: Full=V-type ATP synthase subunit E;AltName:
  137::202     8e-04  41%  475 aa  TRI62_HUMAN RecName: Full=Tripartite motif-containing protein 62;
   77::132     8e-04  32%  170 aa  ATPF_LISMO RecName: Full=ATP synthase subunit b;AltName: Full=ATP
   77::132     8e-04  32%  170 aa  ATPF_LISMF RecName: Full=ATP synthase subunit b;AltName: Full=ATP
  534::664     8e-04  25% 1738 aa  ACTNB_DICDI RecName: Full=Interaptin;AltName: Full=Alpha-actinin
    1::365

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPLTPADVHNVAFNKPPIGKRGYNEDEVDQFLDLVEDALVQFQEENEDLKQQVEELEAQVXXXXXXXXXX
AG84_MYCTU      MPLTPADVHNVAFSKPPIGKRGYNEDEVDAFLDLVENELTRLIEENSDLRQRINELDQELAAGGGAGVTP
AG84_MYCBO      MPLTPADVHNVAFSKPPIGKRGYNEDEVDAFLDLVENELTRLIEENSDLRQRINELDQELAAGGGAGVTP
AG84_MYCLE      MPLTPADVHNVAFSKPPIGKRGYNEDEVDAFLDLVENELTQLIEENSDLRQRIEELDHEL----------
GPSB_GEOTN      --LTPKDILEKEFK---VSMRGYNQDEVDQFLDIVQQELDELRQENARLKRQVEELQ-------------
GPSB_GEOKA      --LTPKDILEKEFK---VSIRGYNQDEVDQFLDLIIKDYEAFQQEIDELRQENARLKRQV----------
DIV4A_BACSU     MPLTPNDIHNKTFTK---SFRGYDEDEVNEFLAQVRKDYEIVLRKKTELEAKVNELDERI----------
K2C8_DANRE      ----------------------------------------------------------------------
ION3_CARAU      ----------------------------------------------------------------------
Y1661_MYCLE     ----------------------------------------------------------------------
VATE_META3      ----------------------------------------------------------------------
ATPF_PSEMY      ----------------------------------------------------------------------
VATE_METM5      ----------------------------------------------------------------------
ATPF_ALCBS      ----------------------------------------------------------------------
YADA_YERE8      ----------------------------------------------------------------------
GPSB_BACHK      --LTAKDILEKEFKT---GMRGYQQEEVDKFLDMIIKDYEAFHKEFEQLKQQNARLKREL----------
GPSB_BACCZ      --LTAKDILEKEFKT---GMRGYQQEEVDKFLDMIIKDYEAFHKEFEQLKQQNARLKREL----------
GPSB_BACCR      --LTAKDILEKEFKT---GMRGYQQEEVDKFLDMIIKDYEAFHKEFEQLKQQNARLKREL----------
GPSB_BACCQ      --LTAKDILEKEFKT---GMRGYQQEEVDKFLDMIIKDYEAFHKEFEQLKQQNARLKREL----------
GPSB_BACC7      --LTAKDILEKEFKT---GMRGYQQEEVDKFLDMIIKDYEAFHKEFEQLKQQNARLKREL----------
GPSB_BACC4      --LTAKDILEKEFKT---GMRGYQQEEVDKFLDMIIKDYEAFHKEFEQLKQQNARLKREL----------
GPSB_BACC3      --LTAKDILEKEFKT---GMRGYQQEEVDKFLDMIIKDYEAFHKEFEQLKQQNARLKREL----------
GPSB_BACC2      --LTAKDILEKEFKT---GMRGYQQEEVDKFLDMIIKDYEAFHKEFEQLKQQNARLKREL----------
GPSB_BACC1      --LTAKDILEKEFKT---GMRGYQQEEVDKFLDMIIKDYEAFHKEFEQLKQQNARLKREL----------
GPSB_BACC0      --LTAKDILEKEFKT---GMRGYQQEEVDKFLDMIIKDYEAFHKEFEQLKQQNARLKREL----------
GPSB_BACAN      --LTAKDILEKEFKT---GMRGYQQEEVDKFLDMIIKDYEAFHKEFEQLKQQNARLKREL----------
GPSB_BACAH      --LTAKDILEKEFKT---GMRGYQQEEVDKFLDMIIKDYEAFHKEFEQLKQQNARLKREL----------
GPSB_BACAC      --LTAKDILEKEFKT---GMRGYQQEEVDKFLDMIIKDYEAFHKEFEQLKQQNARLKREL----------
GPSB_BACAA      --LTAKDILEKEFKT---GMRGYQQEEVDKFLDMIIKDYEAFHKEFEQLKQQNARLKREL----------
GPSB_BACHD      --------------------RGYSQDEVDKFLDVVIQDYEVFQKKIERLEQEIHQLRTE-----------
ATPF_MYCGI      ----------------------------------------------------------------------
GPSB_BACWK      --LTAKDILEKEFKT---GMRGYQQEEVDKFLDMIIKDYEAFHKEFDQLKQQNARLKREL----------
ATPF_FLAJ1      ----------------------------------------------------------------------
GPSB_BACSK      --------------------RGYNQDEVDKFLDTVQKKIEQLERENELLKQDLKK---------------
FLIH_TREPA      ----------------------------------------------------------------------
ATPF_COLP3      ----------------------------------------------------------------------
SYV_THEMA       ------NIEEVSFEKPPKTATAYVEEEIEAYVDL--GGLIDFEKEKERLKQIMEKIQKEI----------
ATPF_THELT      ----------------------------------------------------------------------
ATPF_PSEAE      ----------------------------------------------------------------------
ATPF_PSEAB      ----------------------------------------------------------------------
ATPF_PSEA7      ----------------------------------------------------------------------
ATPF_LEUMM      ----------------------------------------------------------------------
ATPF_LACS1      ----------------------------------------------------------------------
ATPF_BACLD      ----------------------------------------------------------------------
GPSB_OCEIH      ------------------GIRGYSQEEVDEFLDVIIQDYDNFKQEIDRLKAENEKLK-------------
GPSB_LACBA      ---TPKEILQKQFRQK---MRGYDPDDVDSFLDNVYDAFVRLQDENERLLAKVDELTRQV----------
GPSB_BACP2      ------------------GVRGYKQEEVDKFLDMVIKDYETFNQEIEKLQQENLHLSKQL----------
GPSB_BACCN      --LTAKDILEKEFKT---GMRGYQQEEVDKFLDMIIKDYEVFHKELEQLQQQ------------------
CNPD_LEUMM      ----------------------------------------------------------------------
SMC2_HUMAN      ----------------------------------------------------------------------
GPSB_LACS1      --LTPKDIVNKHFKQK---MRGYDSIEVDEFLDVIQDYETRLQMENDRLLKKVDELTKQV----------
ATPF_TROWT      ----------------------------------------------------------------------
ATPF_TROW8      ----------------------------------------------------------------------
ATPF_MYCMM      ----------------------------------------------------------------------
ATPF1_METCA     ----------------------------------------------------------------------
YADA2_YEREN     ----------------------------------------------------------------------
Y2952_MYCBO     ----------------------------------------------------------------------
Y2927_MYCTU     ----------------------------------------------------------------------
VATE_CHLTR      ----------------------------------------------------------------------
VATE_CHLTB      ----------------------------------------------------------------------
VATE_CHLTA      ----------------------------------------------------------------------
VATE_CHLT2      ----------------------------------------------------------------------
VATE_CHLMU      ----------------------------------------------------------------------
CING_MOUSE      ----------------------------------------------------------------------
ATPF_AMOA5      ----------------------------------------------------------------------
YADA_YERPS      ----------------------------------------------------------------------
VATE_CLOD6      ----------------------------------------------------------------------
TRI62_HUMAN     ----------------------------------------------------------------------
ATPF_LISMO      ----------------------------------------------------------------------
ATPF_LISMF      ----------------------------------------------------------------------
ACTNB_DICDI     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXKSVDEAALRKEIEEKLRSEYASKLDDASKAAQKAQNDAKSAQDQLXXXXXXXXXXXXXX
AG84_MYCTU      QATQAIPAYEPEKPAPAAVSAGMNEEQALKAARVLSLAQDTADRLTNTAKAESDKML-------------
AG84_MYCBO      QATQAIPAYEPEKPAPAAVSAGMNEEQALKAARVLSLAQDTADRLTNTAKAESDKML-------------
AG84_MYCLE      ----------------------------------------------------------------------
GPSB_GEOTN      ----------------------------------------------------------------------
GPSB_GEOKA      ----------------------------------------------------------------------
DIV4A_BACSU     ----------------------------------------------------------------------
K2C8_DANRE      ----------------------------------------------------------------------
ION3_CARAU      ----------------------------------------------------------------------
Y1661_MYCLE     ----------------------------------------------------------------------
VATE_META3      ----------------------------------------------------------------------
ATPF_PSEMY      ----------------------------------------------------------------------
VATE_METM5      ----------------------------------------------------------------------
ATPF_ALCBS      ----------------------------------------------------------------------
YADA_YERE8      ----------------------------------------------------------------------
GPSB_BACHK      ----------------------------------------------------------------------
GPSB_BACCZ      ----------------------------------------------------------------------
GPSB_BACCR      ----------------------------------------------------------------------
GPSB_BACCQ      ----------------------------------------------------------------------
GPSB_BACC7      ----------------------------------------------------------------------
GPSB_BACC4      ----------------------------------------------------------------------
GPSB_BACC3      ----------------------------------------------------------------------
GPSB_BACC2      ----------------------------------------------------------------------
GPSB_BACC1      ----------------------------------------------------------------------
GPSB_BACC0      ----------------------------------------------------------------------
GPSB_BACAN      ----------------------------------------------------------------------
GPSB_BACAH      ----------------------------------------------------------------------
GPSB_BACAC      ----------------------------------------------------------------------
GPSB_BACAA      ----------------------------------------------------------------------
GPSB_BACHD      ----------------------------------------------------------------------
ATPF_MYCGI      ----------------------------------------------------------------------
GPSB_BACWK      ----------------------------------------------------------------------
ATPF_FLAJ1      ----------------------------------------------------------------------
GPSB_BACSK      ----------------------------------------------------------------------
FLIH_TREPA      ----------------------------------------------------------------------
ATPF_COLP3      ----------------------------------------------------------------------
SYV_THEMA       ----------------------------------------------------------------------
ATPF_THELT      ----------------------------------------------------------------------
ATPF_PSEAE      ----------------------------------------------------------------------
ATPF_PSEAB      ----------------------------------------------------------------------
ATPF_PSEA7      ----------------------------------------------------------------------
ATPF_LEUMM      ----------------------------------------------------------------------
ATPF_LACS1      ----------------------------------------------------------------------
ATPF_BACLD      ----------------------------------------------------------------------
GPSB_OCEIH      ----------------------------------------------------------------------
GPSB_LACBA      ----------------------------------------------------------------------
GPSB_BACP2      ----------------------------------------------------------------------
GPSB_BACCN      ----------------------------------------------------------------------
CNPD_LEUMM      ----------------------------------------------------------------------
SMC2_HUMAN      ----------------------------------------------------------------------
GPSB_LACS1      ----------------------------------------------------------------------
ATPF_TROWT      ----------------------------------------------------------------------
ATPF_TROW8      ----------------------------------------------------------------------
ATPF_MYCMM      ----------------------------------------------------------------------
ATPF1_METCA     ----------------------------------------------------------------------
YADA2_YEREN     ----------------------------------------------------------------------
Y2952_MYCBO     ----------------------------------------------------------------------
Y2927_MYCTU     ----------------------------------------------------------------------
VATE_CHLTR      ----------------------------------------------------------------------
VATE_CHLTB      ----------------------------------------------------------------------
VATE_CHLTA      ----------------------------------------------------------------------
VATE_CHLT2      ----------------------------------------------------------------------
VATE_CHLMU      ----------------------------------------------------------------------
CING_MOUSE      ----------------------------------------------------------------------
ATPF_AMOA5      ----------------------------------------------------------------------
YADA_YERPS      ----------------------------------------------------------------------
VATE_CLOD6      ----------------------------------------------------------------------
TRI62_HUMAN     ----------------------------------------------------------------------
ATPF_LISMO      ----------------------------------------------------------------------
ATPF_LISMF      ----------------------------------------------------------------------
ACTNB_DICDI     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNVDTHMQAAKVLGLAQEMADRLTSEARSESKSM
AG84_MYCTU      --------------------------------------ADARANAEQILGEARHTADATVAEARQRADAM
AG84_MYCBO      --------------------------------------ADARANAEQILGEARHTADATVAEARQRADAM
AG84_MYCLE      ------------------------------------------MKATRVLSLAQDTADQLTSTAKVESDKM
GPSB_GEOTN      ----------------------------------------------------------------------
GPSB_GEOKA      ----------------------------------------------------------------------
DIV4A_BACSU     ----------------------------------------------------------------------
K2C8_DANRE      -------------------------------------NLDMDAIVAEVRAQYEDIANRSRAEAEMWYKSK
ION3_CARAU      -------------------------------------NLDMDAIVAEVRAQYEDIANRSRAEAEMWYKSK
Y1661_MYCLE     -------------------------------------------EADRILSDAKSQVDRMASEARQHSERM
VATE_META3      ---------------------------------------------SKILDDANNTASKIKSEAQKEADLI
ATPF_PSEMY      --------------------------------------LDAAGRAERDLQLAQERAAQMLRETKEQAAEI
VATE_METM5      ---------------------------------------------SKIVEDANKNAEKILAEALNEKEAI
ATPF_ALCBS      ---------------------------------------------------AADRAERDLELAQEKATAN
YADA_YERE8      --------------------------------------VNANKKSAEVLGIANNYTDSKSAEARKEAFDL
GPSB_BACHK      ----------------------------------------------------------------------
GPSB_BACCZ      ----------------------------------------------------------------------
GPSB_BACCR      ----------------------------------------------------------------------
GPSB_BACCQ      ----------------------------------------------------------------------
GPSB_BACC7      ----------------------------------------------------------------------
GPSB_BACC4      ----------------------------------------------------------------------
GPSB_BACC3      ----------------------------------------------------------------------
GPSB_BACC2      ----------------------------------------------------------------------
GPSB_BACC1      ----------------------------------------------------------------------
GPSB_BACC0      ----------------------------------------------------------------------
GPSB_BACAN      ----------------------------------------------------------------------
GPSB_BACAH      ----------------------------------------------------------------------
GPSB_BACAC      ----------------------------------------------------------------------
GPSB_BACAA      ----------------------------------------------------------------------
GPSB_BACHD      ----------------------------------------------------------------------
ATPF_MYCGI      -------------------------------------------KSAEQVAAARADYDKTLAEARGEASSI
GPSB_BACWK      ----------------------------------------------------------------------
ATPF_FLAJ1      ---------------------------------------------------------RILNEARAERDAM
GPSB_BACSK      ----------------------------------------------------------------------
FLIH_TREPA      ----------------------------------------------------EEEQVQLRARAEREAQDL
ATPF_COLP3      -------------------------------------------RAAKDLELAQEKATAQLKEAKVQAASI
SYV_THEMA       ----------------------------------------------------------------------
ATPF_THELT      -----------------------------------------------------QIADKRREKIQSDLASA
ATPF_PSEAE      --------------------------------------LDAANRAARDLELAHEKAGQQLREAKAQAAEI
ATPF_PSEAB      --------------------------------------LDAANRAARDLELAHEKAGQQLREAKAQAAEI
ATPF_PSEA7      --------------------------------------LDAANRAARDLELAHEKAGQQLREAKAQAAEI
ATPF_LEUMM      -----------------------------------------------------ERADKISSDIDGAEVAR
ATPF_LACS1      -------------------------------------DIDSAEQARQKAEELVEKRDLALKNSRSEASQI
ATPF_BACLD      ----------------------------------------------------------LLKEAREESQSL
GPSB_OCEIH      ----------------------------------------------------------------------
GPSB_LACBA      ----------------------------------------------------------------------
GPSB_BACP2      ----------------------------------------------------------------------
GPSB_BACCN      ----------------------------------------------------------------------
CNPD_LEUMM      --------------------------------------------AHKVIS-AEQMATNILEQANNEAKSL
SMC2_HUMAN      -----------------------------------------------------EEADLLQTKLQQSSYHK
GPSB_LACS1      ----------------------------------------------------------------------
ATPF_TROWT      -----------------------------------------HARALETLELRKQQLD----EAKSEASQI
ATPF_TROW8      -----------------------------------------HARALETLELRKQQLD----EAKSEASQI
ATPF_MYCMM      ---------------------------------------------AKTLADNKKSAEQFAA-AQADYEKA
ATPF1_METCA     -------------------------------------------RATAALKEAKDQAAEIVNQAQKRANAL
YADA2_YEREN     ---------------------------------------NANKKSAEVLGIANNYTDSKSAEARKEAFDL
Y2952_MYCBO     -------------------------------------------EAESILNHARTEADRILSDAKAQADRM
Y2927_MYCTU     -------------------------------------------EAESILNHARTEADRILSDAKAQADRM
VATE_CHLTR      ---------------------------------------------------AEEEAGSIVHNAREQAKRI
VATE_CHLTB      ---------------------------------------------------AEEEAGSIVHNAREQAKRI
VATE_CHLTA      ---------------------------------------------------AEEEAGSIVHNAREQAKRI
VATE_CHLT2      ---------------------------------------------------AEEEAGSIVHNAREQAKRI
VATE_CHLMU      ---------------------------------------------------AEEEAGSIVHNAREQAKRI
CING_MOUSE      ----------------------------------------------------QREALRRSKAELEEQKRL
ATPF_AMOA5      ---------------------------------------ETHIEEALK---GAEEAKQLLAQLKSEQEKL
YADA_YERPS      --------------------------------------------AVNVAQLKKEMAETLEN-ARKETLAQ
VATE_CLOD6      ------------------------------------------------MGNEQKMIDRIIADAKQEAQEI
TRI62_HUMAN     ----------------------------------------------------------------------
ATPF_LISMO      -------------------------------------------------------------QARVESQTM
ATPF_LISMF      -------------------------------------------------------------QARVESQTM
ACTNB_DICDI     -----------------------------------------------------------TSQLQDRIKQL


                         .         .         .         +         .         .         .:280
query           LDEAREAAEKQIEEANSTSNRTLEDARANAEKQIAEAQNRADTLVNEADAKAKNLIXXXXXXXXXXXXXX
AG84_MYCTU      ----------------------LADAQSRSEAQLRQAQEKADAL--QADA--------------------
AG84_MYCBO      ----------------------LADAQSRSEAQLRQAQEKADAL--QADA--------------------
AG84_MYCLE      LADARVNADQ-----------ILGEARLTAEATVAEAQQRADAMLADAQTRSE-----------------
GPSB_GEOTN      ----------------------------------------------------------------------
GPSB_GEOKA      ----------------------------------------------------------------------
DIV4A_BACSU     ----------------------------------------------------------------------
K2C8_DANRE      YEEMQTSANKYGDDLRSTKNRMIQDARANLENQIAEAEERGEMAVRDAKGRIKDL---------------
ION3_CARAU      YEEMQTSATKYGDDLRSTKNRMIQDARSNLENQIAEAEERGELAVRDAKARIKDL---------------
Y1661_MYCLE     LGDAREESEASLNRAQSECDRLIENGNISYEKAIQEGIKEQQRLVSQANAESTRLI--------------
VATE_META3      LEKAKIEAEEQTQEAETTYNRILAEARLNSKKKMLKER---ENLINMA----------------------
ATPF_PSEMY      LDRANKTANAIVEEAKA-------QARSEGEKLIAGAKAEIDLEVNRA----------------------
VATE_METM5      LTEAKEEAKKGEKDAEMTKNRILAEARLSAKKKLLEEREKTIQLTLE-----------------------
ATPF_ALCBS      LKESKEKAAEIIDQANRRANQIVEEARAEGERLIAKAHSEIDQEVNQA----------------------
YADA_YERE8      SNDALDMAKKH---SNSVARTTLETAEEHTNKKSAETLARANVY---ADSKSSHTL--------------
GPSB_BACHK      ----------------------------------------------------------------------
GPSB_BACCZ      ----------------------------------------------------------------------
GPSB_BACCR      ----------------------------------------------------------------------
GPSB_BACCQ      ----------------------------------------------------------------------
GPSB_BACC7      ----------------------------------------------------------------------
GPSB_BACC4      ----------------------------------------------------------------------
GPSB_BACC3      ----------------------------------------------------------------------
GPSB_BACC2      ----------------------------------------------------------------------
GPSB_BACC1      ----------------------------------------------------------------------
GPSB_BACC0      ----------------------------------------------------------------------
GPSB_BACAN      ----------------------------------------------------------------------
GPSB_BACAH      ----------------------------------------------------------------------
GPSB_BACAC      ----------------------------------------------------------------------
GPSB_BACAA      ----------------------------------------------------------------------
GPSB_BACHD      ----------------------------------------------------------------------
ATPF_MYCGI      RDEARVAGRQVVDEKRATANGEVAETVKTADEKLTQQGSAAQSLQSSVDALSATL---------------
GPSB_BACWK      ----------------------------------------------------------------------
ATPF_FLAJ1      LKEAREMKEKMINEAQEAGQKMIEQAKAAIESEMAELKSQVSTL--------------------------
GPSB_BACSK      ----------------------------------------------------------------------
FLIH_TREPA      KERVEEEITAYREQCTQEADRILAQAKEQSELQISEAQQQAERMIAEAETSRQKI---------------
ATPF_COLP3      VDAAKKHEAKIVDEAAGKAQVEKERILASGHAEIETERNRA-----------------------------
SYV_THEMA       ----------------------------------------------------------------------
ATPF_THELT      EKELKEA-----QEMKKQAHDALESARKSADGIISEARQKSEEIINQAKVKAR-----------------
ATPF_PSEAE      VEQAKKRANQIVDEARDQARTEGERLKAQAQAEIEQELN-------------------------------
ATPF_PSEAB      VEQAKKRANQIVDEARDQARTEGERLKAQAQAEIEQELN-------------------------------
ATPF_PSEA7      VEQAKKRANQIVDEARDQARAEGERLKAQAQAEIEQELN-------------------------------
ATPF_LEUMM      QEAEKLASQRQAELAETRQNATVNDAKASAQKQVSAANDRAASVSQQAQTDAQKL---------------
ATPF_LACS1      IDRAKKNGEQQKANIVSSAHEEVQTMKANAKKDIQERQEALDSVKND-----------------------
ATPF_BACLD      IENAKKLGEQQKDEIIKAARQEAERMKESARSEIVKERDQAVTALREQVASLSVMI--------------
GPSB_OCEIH      ----------------------------------------------------------------------
GPSB_LACBA      ----------------------------------------------------------------------
GPSB_BACP2      ----------------------------------------------------------------------
GPSB_BACCN      ----------------------------------------------------------------------
CNPD_LEUMM      ----KRAAEVDAKDLAQTYRNQVNDSYNDRQKHLQQQEQRLEDRINNLDKKDAAL---------------
SMC2_HUMAN      QQEELDALKKTIEESEETLKNTKENAEAERERELKDAQKKLDCAKTKADASSKKM---------------
GPSB_LACS1      ----------------------------------------------------------------------
ATPF_TROWT      RQEARDDAQLILQQARETADETAERVMLHAREQI------------------------------------
ATPF_TROW8      RQEARDDAQLILQQARETADETAERVMLHAREQI------------------------------------
ATPF_MYCMM      MAEARVQASSYRDNARAEGRKVVEDARAHAEQEVASTLQQAEQLKRERDA--------------------
ATPF1_METCA     VDESKEAAERILANARSEIDRELENAKEELRKQVS-----------------------------------
YADA2_YEREN     SNDALDMAKKH---SNSVARTTLETAEEHTNKKSAETLASANVY---ADSKSSHTL--------------
Y2952_MYCBO     VSEARQHSERMVXXXXXXXXXXXXXXXXXYEASVSRAQAECDRLIENGN---------------------
Y2927_MYCTU     VSEARQHSERMVXXXXXXXXXXXXXXXXXYEASVSRAQAECDRLIENGN---------------------
VATE_CHLTR      VEEAKEEAQRIIRSAEETADQTLKKGEA------------------------------------------
VATE_CHLTB      VEEAKEEAQRIIRSAEETADQTLKKGEA------------------------------------------
VATE_CHLTA      VEEAKEEAQRIIRSAEETADQTLKKGEA------------------------------------------
VATE_CHLT2      VEEAKEEAQRIIRSAEETADQTLKKGEA------------------------------------------
VATE_CHLMU      VEEAKEEAQRIIRSAEETASQTLKKGEA------------------------------------------
CING_MOUSE      LNRTVDRLNKELEQIGDDSKLALEDYKEKARKEVADAQRQAKDWASEAEKNSGGL-------------SR
ATPF_AMOA5      LEKSNREREKIISDAVATKNDILEEARQLSDKVLKEAREVINTEKEIAFGKLKHEI--------------
YADA_YERPS      SNDVLDAAKKH---SNSVARTTLETAEEHANKKSAEA---------------------------------
VATE_CLOD6      LDKAKSEADLKVNSANEKAEKEM-----------------------------------------------
TRI62_HUMAN     ----------------------------------------------------------------------
ATPF_LISMO      IENAKQLGEKEREEIVKTARRESERIKEEAKSDIAREKEDAISALRE-----------------------
ATPF_LISMF      IENAKQLGEKEREEIVKTARRESERIKEEAKSDIAREKEDAISALRE-----------------------
ACTNB_DICDI     INELQERDDKFIEFTNS-SNQSLADNQRVIDQLTNEKQSITLQLQDQQDIKEKEF-----QFEKQQLLSQ


                         .         *         .         .         .         .         +:350
query           XXXXXXQIRQAEDKANALQADAERKHTETMAAVKEQQNALETRIAELQTFEREYRTRLKSLLEGQLEELN
AG84_MYCTU      ----------------------ERKHSEIMGTINQQRAVLEGRLEQLRTFEREYRTRLKTYLESQLEELG
AG84_MYCBO      ----------------------ERKHSEIMGTINQQRAVLEGRLEQLRTFEREYRTRLKTYLESQLEELG
AG84_MYCLE      -----VQSRQAQEKADALQAEAERKHSEIMGAISQQRTVLEGRLEQLRTFEREYRTRLKTYLESQLEELG
GPSB_GEOTN      ----------------------------------------------------------------------
GPSB_GEOKA      ----------------------------------------------------------------------
DIV4A_BACSU     ----------------------------------------------------------------------
K2C8_DANRE      ----------------------------------------------------------------------
ION3_CARAU      ----------------------------------------------------------------------
Y1661_MYCLE     ----------------------------------------------------------------------
VATE_META3      ----------------------------------------------------------------------
ATPF_PSEMY      ----------------------------------------------------------------------
VATE_METM5      ----------------------------------------------------------------------
ATPF_ALCBS      ----------------------------------------------------------------------
YADA_YERE8      ----------------------------------------------------------------------
GPSB_BACHK      ----------------------------------------------------------------------
GPSB_BACCZ      ----------------------------------------------------------------------
GPSB_BACCR      ----------------------------------------------------------------------
GPSB_BACCQ      ----------------------------------------------------------------------
GPSB_BACC7      ----------------------------------------------------------------------
GPSB_BACC4      ----------------------------------------------------------------------
GPSB_BACC3      ----------------------------------------------------------------------
GPSB_BACC2      ----------------------------------------------------------------------
GPSB_BACC1      ----------------------------------------------------------------------
GPSB_BACC0      ----------------------------------------------------------------------
GPSB_BACAN      ----------------------------------------------------------------------
GPSB_BACAH      ----------------------------------------------------------------------
GPSB_BACAC      ----------------------------------------------------------------------
GPSB_BACAA      ----------------------------------------------------------------------
GPSB_BACHD      ----------------------------------------------------------------------
ATPF_MYCGI      ----------------------------------------------------------------------
GPSB_BACWK      ----------------------------------------------------------------------
ATPF_FLAJ1      ----------------------------------------------------------------------
GPSB_BACSK      ----------------------------------------------------------------------
FLIH_TREPA      ----------------------------------------------------------------------
ATPF_COLP3      ----------------------------------------------------------------------
SYV_THEMA       ----------------------------------------------------------------------
ATPF_THELT      ----------------------------------------------------------------------
ATPF_PSEAE      ----------------------------------------------------------------------
ATPF_PSEAB      ----------------------------------------------------------------------
ATPF_PSEA7      ----------------------------------------------------------------------
ATPF_LEUMM      ---KEDAISGAKNDVAALSVAIASKLMQKELSLNDQQALIDAYISDLET---------------------
ATPF_LACS1      ----------------------------------------------------------------------
ATPF_BACLD      ----------------------------------------------------------------------
GPSB_OCEIH      ----------------------------------------------------------------------
GPSB_LACBA      ----------------------------------------------------------------------
GPSB_BACP2      ----------------------------------------------------------------------
GPSB_BACCN      ----------------------------------------------------------------------
CNPD_LEUMM      -NQRDASLIQKENQVQTRLDDADKKEVLAQKLLTTQQDKLE-EIAQLSPDE-------------------
SMC2_HUMAN      ------KEKQQEVEAITLEEELKREHTSYKQQLEAVNEAIKSYESQIEVMAAEVAKNKESVNKAQEE---
GPSB_LACS1      ----------------------------------------------------------------------
ATPF_TROWT      ----------------------------------------------------------------------
ATPF_TROW8      ----------------------------------------------------------------------
ATPF_MYCMM      ----------------------------------------------------------------------
ATPF1_METCA     ----------------------------------------------------------------------
YADA2_YEREN     ----------------------------------------------------------------------
Y2952_MYCBO     ----------------------------------------------------------------------
Y2927_MYCTU     ----------------------------------------------------------------------
VATE_CHLTR      ----------------------------------------------------------------------
VATE_CHLTB      ----------------------------------------------------------------------
VATE_CHLTA      ----------------------------------------------------------------------
VATE_CHLT2      ----------------------------------------------------------------------
VATE_CHLMU      ----------------------------------------------------------------------
CING_MOUSE      LQDELQRLRQALQTSQA-ERDTARLDKELLA---QRLQGLEQEAENKKRFQDDKARQLKSLLEAELDE--
ATPF_AMOA5      ----------------------------------------------------------------------
YADA_YERPS      ----------------------------------------------------------------------
VATE_CLOD6      ----------------------------------------------------------------------
TRI62_HUMAN     --------RELKDQLQALQ-DSEREHTEALQLLKRQLAETKSSTKSLRTFERLHRL-LRERQKAMLEELE
ATPF_LISMO      ----------------------------------------------------------------------
ATPF_LISMF      ----------------------------------------------------------------------
ACTNB_DICDI     IDSITTNIQEYQDKFNNLQQEFNTQQTLN----QQETHRLTQQLYQINTDYNEKQTQLQS----------


                         .         .         .         .         *         .         .:420
query           ARGSSAPTNNxxxxx
AG84_MYCTU      QRGSAAPVDS-----
AG84_MYCBO      QRGSAAPVDS-----
AG84_MYCLE      QRGSAAPVDS-----
GPSB_GEOTN      ---------------
GPSB_GEOKA      ---------------
DIV4A_BACSU     ---------------
K2C8_DANRE      ---------------
ION3_CARAU      ---------------
Y1661_MYCLE     ---------------
VATE_META3      ---------------
ATPF_PSEMY      ---------------
VATE_METM5      ---------------
ATPF_ALCBS      ---------------
YADA_YERE8      ---------------
GPSB_BACHK      ---------------
GPSB_BACCZ      ---------------
GPSB_BACCR      ---------------
GPSB_BACCQ      ---------------
GPSB_BACC7      ---------------
GPSB_BACC4      ---------------
GPSB_BACC3      ---------------
GPSB_BACC2      ---------------
GPSB_BACC1      ---------------
GPSB_BACC0      ---------------
GPSB_BACAN      ---------------
GPSB_BACAH      ---------------
GPSB_BACAC      ---------------
GPSB_BACAA      ---------------
GPSB_BACHD      ---------------
ATPF_MYCGI      ---------------
GPSB_BACWK      ---------------
ATPF_FLAJ1      ---------------
GPSB_BACSK      ---------------
FLIH_TREPA      ---------------
ATPF_COLP3      ---------------
SYV_THEMA       ---------------
ATPF_THELT      ---------------
ATPF_PSEAE      ---------------
ATPF_PSEAB      ---------------
ATPF_PSEA7      ---------------
ATPF_LEUMM      ---------------
ATPF_LACS1      ---------------
ATPF_BACLD      ---------------
GPSB_OCEIH      ---------------
GPSB_LACBA      ---------------
GPSB_BACP2      ---------------
GPSB_BACCN      ---------------
CNPD_LEUMM      ---------------
SMC2_HUMAN      ---------------
GPSB_LACS1      ---------------
ATPF_TROWT      ---------------
ATPF_TROW8      ---------------
ATPF_MYCMM      ---------------
ATPF1_METCA     ---------------
YADA2_YEREN     ---------------
Y2952_MYCBO     ---------------
Y2927_MYCTU     ---------------
VATE_CHLTR      ---------------
VATE_CHLTB      ---------------
VATE_CHLTA      ---------------
VATE_CHLT2      ---------------
VATE_CHLMU      ---------------
CING_MOUSE      ---------------
ATPF_AMOA5      ---------------
YADA_YERPS      ---------------
VATE_CLOD6      ---------------
TRI62_HUMAN     A--------------
ATPF_LISMO      ---------------
ATPF_LISMF      ---------------
ACTNB_DICDI     ---------------