[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF55227.1

[Show Plain Result]


## Summary of Sequence Search
    1::106
  510::615     4e-56  99%  615 aa  LEPA_CORGL RecName: Full=GTP-binding protein lepA;
  510::614     2e-54  94%  615 aa  LEPA_COREF RecName: Full=GTP-binding protein lepA;
  510::614     9e-54  96%  615 aa  LEPA_CORDI RecName: Full=GTP-binding protein lepA;
  510::613     3e-52  93%  615 aa  LEPA_CORA7 RecName: Full=GTP-binding protein lepA;
  511::614     3e-51  91%  616 aa  LEPA_CORJK RecName: Full=GTP-binding protein lepA;
  511::613     1e-49  89%  617 aa  LEPA_CORU7 RecName: Full=GTP-binding protein lepA;
  542::647     1e-48  87%  653 aa  LEPA_MYCTU RecName: Full=GTP-binding protein lepA;
  542::647     1e-48  87%  653 aa  LEPA_MYCTA RecName: Full=GTP-binding protein lepA;
  542::647     1e-48  87%  653 aa  LEPA_MYCBT RecName: Full=GTP-binding protein lepA;
  542::647     1e-48  87%  653 aa  LEPA_MYCBP RecName: Full=GTP-binding protein lepA;
  542::647     1e-48  87%  653 aa  LEPA_MYCBO RecName: Full=GTP-binding protein lepA;
  535::640     4e-48  87%  646 aa  LEPA_MYCLE RecName: Full=GTP-binding protein lepA;
  535::640     4e-48  87%  646 aa  LEPA_MYCLB RecName: Full=GTP-binding protein lepA;
  503::606     1e-47  86%  616 aa  LEPA_NOCFA RecName: Full=GTP-binding protein lepA;
  549::654     3e-47  85%  660 aa  LEPA_MYCPA RecName: Full=GTP-binding protein lepA;
  500::602     2e-46  85%  614 aa  LEPA_THEFY RecName: Full=GTP-binding protein lepA;
  503::607     3e-46  84%  626 aa  LEPA_BIFA0 RecName: Full=GTP-binding protein lepA;
  503::607     2e-45  82%  626 aa  LEPA_BIFLO RecName: Full=GTP-binding protein lepA;
  503::607     2e-45  82%  626 aa  LEPA_BIFLI RecName: Full=GTP-binding protein lepA;
  503::607     2e-45  82%  626 aa  LEPA_BIFLD RecName: Full=GTP-binding protein lepA;
  519::622     6e-45  82%  630 aa  LEPA_RHOSR RecName: Full=GTP-binding protein lepA;
  519::622     6e-45  82%  630 aa  LEPA_RHOOB RecName: Full=GTP-binding protein lepA;
  502::607     3e-44  81%  611 aa  LEPA_PROAC RecName: Full=GTP-binding protein lepA;
  511::616     2e-42  72%  624 aa  LEPA_STRGG RecName: Full=GTP-binding protein lepA;
  509::609     8e-42  78%  622 aa  LEPA_STRCO RecName: Full=GTP-binding protein lepA;
  509::609     8e-42  78%  622 aa  LEPA_STRAW RecName: Full=GTP-binding protein lepA;
  528::633     7e-41  75%  639 aa  LEPA_MYCSS RecName: Full=GTP-binding protein lepA;
  528::633     7e-41  75%  639 aa  LEPA_MYCSK RecName: Full=GTP-binding protein lepA;
  528::633     7e-41  75%  639 aa  LEPA_MYCSJ RecName: Full=GTP-binding protein lepA;
  506::603     1e-40  78%  622 aa  LEPA_KINRD RecName: Full=GTP-binding protein lepA;
  497::601     2e-40  73%  601 aa  LEPA_HELMI RecName: Full=GTP-binding protein lepA;
  502::606     2e-40  75%  609 aa  LEPA_GEOKA RecName: Full=GTP-binding protein lepA;
  502::606     3e-40  74%  609 aa  LEPA_GEOTN RecName: Full=GTP-binding protein lepA;
  502::606     3e-40  73%  609 aa  LEPA_BACHD RecName: Full=GTP-binding protein lepA;
  495::599     3e-40  70%  599 aa  LEPA_GEOMG RecName: Full=GTP-binding protein lepA;
  502::606     3e-40  74%  608 aa  LEPA_ANOFW RecName: Full=GTP-binding protein lepA;
  495::599     4e-40  70%  600 aa  LEPA_GEOSL RecName: Full=GTP-binding protein lepA;
  502::606     4e-40  72%  608 aa  LEPA_BACCN RecName: Full=GTP-binding protein lepA;
  496::599     1e-39  70%  603 aa  LEPA_SYMTH RecName: Full=GTP-binding protein lepA;
  502::606     1e-39  72%  607 aa  LEPA_STRZT RecName: Full=GTP-binding protein lepA;
  502::606     1e-39  72%  607 aa  LEPA_STRZP RecName: Full=GTP-binding protein lepA;
  502::606     1e-39  72%  607 aa  LEPA_STRZJ RecName: Full=GTP-binding protein lepA;
  502::606     1e-39  72%  607 aa  LEPA_STRR6 RecName: Full=GTP-binding protein lepA;
  502::606     1e-39  72%  607 aa  LEPA_STRPN RecName: Full=GTP-binding protein lepA;
  502::606     1e-39  72%  607 aa  LEPA_STRPJ RecName: Full=GTP-binding protein lepA;
  502::606     1e-39  72%  607 aa  LEPA_STRPI RecName: Full=GTP-binding protein lepA;
  502::606     1e-39  72%  607 aa  LEPA_STRP7 RecName: Full=GTP-binding protein lepA;
  502::606     1e-39  72%  607 aa  LEPA_STRP4 RecName: Full=GTP-binding protein lepA;
  502::606     1e-39  72%  607 aa  LEPA_STRP2 RecName: Full=GTP-binding protein lepA;
  498::602     1e-39  70%  602 aa  LEPA_CLOBM RecName: Full=GTP-binding protein lepA;
  498::602     1e-39  70%  602 aa  LEPA_CLOBL RecName: Full=GTP-binding protein lepA;
  498::602     1e-39  70%  602 aa  LEPA_CLOBK RecName: Full=GTP-binding protein lepA;
  498::602     1e-39  70%  602 aa  LEPA_CLOBJ RecName: Full=GTP-binding protein lepA;
  498::602     1e-39  70%  602 aa  LEPA_CLOBH RecName: Full=GTP-binding protein lepA;
  498::602     1e-39  70%  602 aa  LEPA_CLOB6 RecName: Full=GTP-binding protein lepA;
  498::602     1e-39  70%  602 aa  LEPA_CLOB1 RecName: Full=GTP-binding protein lepA;
  503::608     1e-39  72%  612 aa  LEPA_BACLD RecName: Full=GTP-binding protein lepA;
  502::606     1e-39  72%  610 aa  LEPA_STRU0 RecName: Full=GTP-binding protein lepA;
  503::608     1e-39  72%  612 aa  LEPA_BACSU RecName: Full=GTP-binding protein lepA;
  502::606     2e-39  73%  607 aa  LEPA_LACLS RecName: Full=GTP-binding protein lepA;
  502::606     2e-39  73%  607 aa  LEPA_LACLM RecName: Full=GTP-binding protein lepA;
  502::606     2e-39  73%  607 aa  LEPA_LACLA RecName: Full=GTP-binding protein lepA;
  492::596     2e-39  68%  597 aa  LEPA_JANMA RecName: Full=GTP-binding protein lepA;
  502::606     2e-39  73%  611 aa  LEPA_ENTFA RecName: Full=GTP-binding protein lepA;
  502::606     2e-39  71%  607 aa  LEPA_BACSK RecName: Full=GTP-binding protein lepA;
  502::606     2e-39  71%  607 aa  LEPA_BACHK RecName: Full=GTP-binding protein lepA;
  502::606     2e-39  71%  607 aa  LEPA_BACCZ RecName: Full=GTP-binding protein lepA;
  502::606     2e-39  71%  607 aa  LEPA_BACCQ RecName: Full=GTP-binding protein lepA;
  502::606     2e-39  71%  607 aa  LEPA_BACC7 RecName: Full=GTP-binding protein lepA;
  502::606     2e-39  71%  607 aa  LEPA_BACC4 RecName: Full=GTP-binding protein lepA;
  502::606     2e-39  71%  607 aa  LEPA_BACC3 RecName: Full=GTP-binding protein lepA;
  502::606     2e-39  71%  607 aa  LEPA_BACC2 RecName: Full=GTP-binding protein lepA;
  502::606     2e-39  71%  607 aa  LEPA_BACC1 RecName: Full=GTP-binding protein lepA;
  502::606     2e-39  71%  607 aa  LEPA_BACC0 RecName: Full=GTP-binding protein lepA;
  502::606     2e-39  71%  607 aa  LEPA_BACAN RecName: Full=GTP-binding protein lepA;
  502::606     2e-39  71%  607 aa  LEPA_BACAH RecName: Full=GTP-binding protein lepA;
  502::606     2e-39  71%  607 aa  LEPA_BACAC RecName: Full=GTP-binding protein lepA;
  502::606     2e-39  71%  607 aa  LEPA_BACAA RecName: Full=GTP-binding protein lepA;
  503::607     2e-39  72%  610 aa  LEPA_STRTD RecName: Full=GTP-binding protein lepA;
  503::607     2e-39  72%  610 aa  LEPA_STRT2 RecName: Full=GTP-binding protein lepA;
  503::607     2e-39  72%  610 aa  LEPA_STRT1 RecName: Full=GTP-binding protein lepA;
  502::606     2e-39  72%  607 aa  LEPA_EXIS2 RecName: Full=GTP-binding protein lepA;
  502::606     3e-39  70%  611 aa  LEPA_STRMU RecName: Full=GTP-binding protein lepA;
  502::606     3e-39  71%  610 aa  LEPA_STREM RecName: Full=GTP-binding protein lepA;
   66::170     4e-39  71%  174 aa  LEPA_STRP8 RecName: Full=Putative lepA protein homolog;
  502::606     4e-39  71%  610 aa  LEPA_STRP6 RecName: Full=GTP-binding protein lepA;
  502::607     4e-39  72%  608 aa  LEPA_LISW6 RecName: Full=GTP-binding protein lepA;
  502::607     4e-39  72%  608 aa  LEPA_LISMO RecName: Full=GTP-binding protein lepA;
  502::607     4e-39  72%  608 aa  LEPA_LISMH RecName: Full=GTP-binding protein lepA;
  502::607     4e-39  72%  608 aa  LEPA_LISMF RecName: Full=GTP-binding protein lepA;
  502::607     4e-39  72%  608 aa  LEPA_LISMC RecName: Full=GTP-binding protein lepA;
  502::607     4e-39  72%  608 aa  LEPA_LISIN RecName: Full=GTP-binding protein lepA;
  498::603     4e-39  71%  603 aa  LEPA_ACAM1 RecName: Full=GTP-binding protein lepA;
  502::606     5e-39  71%  610 aa  LEPA_STRSY RecName: Full=GTP-binding protein lepA;
  502::606     5e-39  71%  610 aa  LEPA_STRS2 RecName: Full=GTP-binding protein lepA;
  502::606     5e-39  71%  607 aa  LEPA_STRGC RecName: Full=GTP-binding protein lepA;
  497::600     5e-39  70%  600 aa  LEPA_SORC5 RecName: Full=GTP-binding protein lepA;
  498::598     5e-39  72%  600 aa  LEPA_RUBXD RecName: Full=GTP-binding protein lepA;
  495::598     5e-39  66%  599 aa  LEPA_GEOSM RecName: Full=GTP-binding protein lepA;
  495::599     5e-39  69%  600 aa  LEPA_GEOLS RecName: Full=GTP-binding protein lepA;
  495::598     5e-39  66%  599 aa  LEPA_GEOBB RecName: Full=GTP-binding protein lepA;
  503::608     5e-39  71%  612 aa  LEPA_BACP2 RecName: Full=GTP-binding protein lepA;
  495::599     6e-39  69%  599 aa  LEPA_PELCD RecName: Full=GTP-binding protein lepA;
  497::601     6e-39  71%  602 aa  LEPA_OCEIH RecName: Full=GTP-binding protein lepA;
  529::632     6e-39  74%  639 aa  LEPA_FRASC RecName: Full=GTP-binding protein lepA;
  502::606     6e-39  72%  607 aa  LEPA_EXISA RecName: Full=GTP-binding protein lepA;
  503::608     6e-39  70%  611 aa  LEPA_BACA2 RecName: Full=GTP-binding protein lepA;
  498::598     8e-39  72%  603 aa  LEPA_SYNJB RecName: Full=GTP-binding protein lepA;
  498::598     8e-39  72%  603 aa  LEPA_SYNJA RecName: Full=GTP-binding protein lepA;
  502::606     8e-39  71%  610 aa  LEPA_STRS7 RecName: Full=GTP-binding protein lepA;
  502::606     8e-39  70%  610 aa  LEPA_STRPZ RecName: Full=GTP-binding protein lepA;
  502::606     8e-39  70%  610 aa  LEPA_STRPM RecName: Full=GTP-binding protein lepA;
  502::606     8e-39  70%  610 aa  LEPA_STRPD RecName: Full=GTP-binding protein lepA;
  502::606     8e-39  70%  610 aa  LEPA_STRPC RecName: Full=GTP-binding protein lepA;
  502::606     8e-39  70%  635 aa  LEPA_STRPB RecName: Full=GTP-binding protein lepA;
  502::606     8e-39  70%  610 aa  LEPA_STRP3 RecName: Full=GTP-binding protein lepA;
  502::606     8e-39  70%  610 aa  LEPA_STRP1 RecName: Full=GTP-binding protein lepA;
  502::606     8e-39  71%  610 aa  LEPA_STRE4 RecName: Full=GTP-binding protein lepA;
  502::606     8e-39  70%  610 aa  LEPA_STRA5 RecName: Full=GTP-binding protein lepA;
  502::606     8e-39  70%  610 aa  LEPA_STRA3 RecName: Full=GTP-binding protein lepA;
  502::606     8e-39  70%  610 aa  LEPA_STRA1 RecName: Full=GTP-binding protein lepA;
  495::598     8e-39  67%  599 aa  LEPA_GEOUR RecName: Full=GTP-binding protein lepA;
  497::601     8e-39  68%  601 aa  LEPA_DESRM RecName: Full=GTP-binding protein lepA;
  499::602     8e-39  70%  602 aa  LEPA_CLOAB RecName: Full=GTP-binding protein lepA;
  502::606     8e-39  70%  607 aa  LEPA_BACCR RecName: Full=GTP-binding protein lepA;
  520::623     8e-39  70%  627 aa  LEPA_ALHEH RecName: Full=GTP-binding protein lepA;
  495::598     1e-38  67%  598 aa  LEPA_PELPD RecName: Full=GTP-binding protein lepA;
  495::598     1e-38  67%  599 aa  LEPA_GEOSF RecName: Full=GTP-binding protein lepA;
  502::606     1e-38  70%  607 aa  LEPA_BACWK RecName: Full=GTP-binding protein lepA;
  497::601     1e-38  66%  601 aa  LEPA_POLSQ RecName: Full=GTP-binding protein lepA;
  497::601     2e-38  65%  601 aa  LEPA_POLNS RecName: Full=GTP-binding protein lepA;
  504::607     2e-38  73%  615 aa  LEPA_FRAAA RecName: Full=GTP-binding protein lepA;
  492::596     2e-38  68%  597 aa  LEPA_NITMU RecName: Full=GTP-binding protein lepA;
  506::611     3e-38  72%  619 aa  LEPA_MICLC RecName: Full=GTP-binding protein lepA;
  501::605     3e-38  70%  605 aa  LEPA_CHLTE RecName: Full=GTP-binding protein lepA;
  495::598     3e-38  67%  599 aa  LEPA_AZOVD RecName: Full=GTP-binding protein lepA;
  497::601     5e-38  65%  602 aa  LEPA_PELTS RecName: Full=GTP-binding protein lepA;
  495::595     5e-38  69%  601 aa  LEPA_ORITI RecName: Full=GTP-binding protein lepA;
  495::595     5e-38  69%  601 aa  LEPA_ORITB RecName: Full=GTP-binding protein lepA;
  502::606     5e-38  70%  607 aa  LEPA_MACCJ RecName: Full=GTP-binding protein lepA;
  501::601     5e-38  71%  606 aa  LEPA_LAWIP RecName: Full=GTP-binding protein lepA;
  495::599     5e-38  70%  605 aa  LEPA_ACIC5 RecName: Full=GTP-binding protein lepA;
  498::598     7e-38  71%  603 aa  LEPA_THEEB RecName: Full=GTP-binding protein lepA;
  501::605     7e-38  69%  605 aa  LEPA_CHLP8 RecName: Full=GTP-binding protein lepA;
  499::602     9e-38  67%  602 aa  LEPA_CLOCE RecName: Full=GTP-binding protein lepA;
  500::604     9e-38  68%  605 aa  LEPA_CHLPB RecName: Full=GTP-binding protein lepA;
  500::604     1e-37  68%  604 aa  LEPA_PROA2 RecName: Full=GTP-binding protein lepA;
  497::601     1e-37  65%  601 aa  LEPA_DESHY RecName: Full=GTP-binding protein lepA;
  497::601     1e-37  65%  601 aa  LEPA_DESHD RecName: Full=GTP-binding protein lepA;
  495::599     1e-37  68%  601 aa  LEPA_ACIBL RecName: Full=GTP-binding protein lepA;
  501::605     2e-37  68%  605 aa  LEPA_CHLPD RecName: Full=GTP-binding protein lepA;
  495::595     2e-37  67%  600 aa  LEPA_RICRS RecName: Full=GTP-binding protein lepA;
  495::595     2e-37  67%  600 aa  LEPA_RICRO RecName: Full=GTP-binding protein lepA;
  495::595     2e-37  67%  600 aa  LEPA_RICPU RecName: Full=GTP-binding protein lepA;
  495::595     2e-37  67%  600 aa  LEPA_RICFE RecName: Full=GTP-binding protein lepA;
  495::595     2e-37  67%  600 aa  LEPA_RICCN RecName: Full=GTP-binding protein lepA;
  495::595     2e-37  67%  600 aa  LEPA_RICAE RecName: Full=GTP-binding protein lepA;
  493::596     2e-37  65%  598 aa  LEPA_NITEU RecName: Full=GTP-binding protein lepA;
  493::596     2e-37  65%  598 aa  LEPA_NITEC RecName: Full=GTP-binding protein lepA;
  499::603     2e-37  67%  604 aa  LEPA_CLOPH RecName: Full=GTP-binding protein lepA;
  501::605     2e-37  69%  605 aa  LEPA_CHLL2 RecName: Full=GTP-binding protein lepA;
  495::595     3e-37  67%  600 aa  LEPA_RICAH RecName: Full=GTP-binding protein lepA;
  497::601     3e-37  68%  601 aa  LEPA_METPB RecName: Full=GTP-binding protein lepA;
  497::601     3e-37  68%  601 aa  LEPA_METC4 RecName: Full=GTP-binding protein lepA;
  502::606     3e-37  67%  612 aa  LEPA_LACCB RecName: Full=GTP-binding protein lepA;
  502::606     3e-37  67%  612 aa  LEPA_LACC3 RecName: Full=GTP-binding protein lepA;
  501::605     3e-37  68%  605 aa  LEPA_CHLCH RecName: Full=GTP-binding protein lepA;
  502::606     4e-37  68%  607 aa  LEPA_STAAT RecName: Full=GTP-binding protein lepA;
  502::606     4e-37  68%  607 aa  LEPA_STAAS RecName: Full=GTP-binding protein lepA;
  502::606     4e-37  68%  607 aa  LEPA_STAAR RecName: Full=GTP-binding protein lepA;
  502::606     4e-37  68%  607 aa  LEPA_STAAN RecName: Full=GTP-binding protein lepA;
  502::606     4e-37  68%  607 aa  LEPA_STAAM RecName: Full=GTP-binding protein lepA;
  502::606     4e-37  68%  607 aa  LEPA_STAAE RecName: Full=GTP-binding protein lepA;
  502::606     4e-37  68%  607 aa  LEPA_STAAC RecName: Full=GTP-binding protein lepA;
  502::606     4e-37  68%  607 aa  LEPA_STAAB RecName: Full=GTP-binding protein lepA;
  502::606     4e-37  68%  607 aa  LEPA_STAA9 RecName: Full=GTP-binding protein lepA;
  502::606     4e-37  68%  607 aa  LEPA_STAA8 RecName: Full=GTP-binding protein lepA;
  502::606     4e-37  68%  607 aa  LEPA_STAA3 RecName: Full=GTP-binding protein lepA;
  502::606     4e-37  68%  607 aa  LEPA_STAA2 RecName: Full=GTP-binding protein lepA;
  502::606     4e-37  68%  607 aa  LEPA_STAA1 RecName: Full=GTP-binding protein lepA;
  497::600     4e-37  68%  601 aa  LEPA_METS4 RecName: Full=GTP-binding protein lepA;
  497::600     4e-37  68%  601 aa  LEPA_METNO RecName: Full=GTP-binding protein lepA;
  502::606     4e-37  69%  612 aa  LEPA_LACSS RecName: Full=GTP-binding protein lepA;
  498::601     4e-37  67%  601 aa  LEPA_CLONN RecName: Full=GTP-binding protein lepA;
  497::601     4e-37  66%  601 aa  LEPA_ANASK RecName: Full=GTP-binding protein lepA;
  497::601     4e-37  66%  601 aa  LEPA_ANADE RecName: Full=GTP-binding protein lepA;
  497::601     4e-37  66%  601 aa  LEPA_ANAD2 RecName: Full=GTP-binding protein lepA;
  502::606     5e-37  67%  607 aa  LEPA_STAAW RecName: Full=GTP-binding protein lepA;
  495::595     5e-37  66%  600 aa  LEPA_RICB8 RecName: Full=GTP-binding protein lepA;
  501::605     5e-37  68%  605 aa  LEPA_PELLD RecName: Full=GTP-binding protein lepA;
  499::603     6e-37  65%  603 aa  LEPA_MYXXD RecName: Full=GTP-binding protein lepA;
  495::598     6e-37  66%  598 aa  LEPA_MAGSM RecName: Full=GTP-binding protein lepA;
  506::610     6e-37  70%  618 aa  LEPA_KOCRD RecName: Full=GTP-binding protein lepA;
  502::606     8e-37  67%  607 aa  LEPA_STAHJ RecName: Full=GTP-binding protein lepA;
  502::606     8e-37  67%  607 aa  LEPA_STAES RecName: Full=GTP-binding protein lepA;
  502::606     8e-37  67%  607 aa  LEPA_STAEQ RecName: Full=GTP-binding protein lepA;
  501::605     8e-37  67%  605 aa  LEPA_PROVI RecName: Full=GTP-binding protein lepA;
  499::602     8e-37  65%  604 aa  LEPA_HYPNA RecName: Full=GTP-binding protein lepA;
  496::600     1e-36  67%  601 aa  LEPA_DESVH RecName: Full=GTP-binding protein lepA;
  497::599     1e-36  71%  601 aa  LEPA_TROWT RecName: Full=GTP-binding protein lepA;
  497::601     1e-36  67%  603 aa  LEPA_FINM2 RecName: Full=GTP-binding protein lepA;
  498::602     1e-36  66%  602 aa  LEPA_CLOK5 RecName: Full=GTP-binding protein lepA;
  497::602     2e-36  64%  602 aa  LEPA_MOOTA RecName: Full=GTP-binding protein lepA;
  504::608     2e-36  63%  610 aa  LEPA_LEGPL RecName: Full=GTP-binding protein lepA;
  504::608     2e-36  63%  610 aa  LEPA_LEGPH RecName: Full=GTP-binding protein lepA;
  504::608     2e-36  63%  610 aa  LEPA_LEGPC RecName: Full=GTP-binding protein lepA;
  504::608     2e-36  63%  610 aa  LEPA_LEGPA RecName: Full=GTP-binding protein lepA;
  497::599     3e-36  70%  601 aa  LEPA_TROW8 RecName: Full=GTP-binding protein lepA;
  495::595     4e-36  66%  600 aa  LEPA_RHOCS RecName: Full=GTP-binding protein lepA;
  500::600     4e-36  65%  606 aa  LEPA_NITOC RecName: Full=GTP-binding protein lepA;
  495::599     4e-36  63%  601 aa  LEPA_METCA RecName: Full=GTP-binding protein lepA;
  496::600     5e-36  66%  601 aa  LEPA_DESDG RecName: Full=GTP-binding protein lepA;
  502::606     7e-36  64%  607 aa  LEPA_STACT RecName: Full=GTP-binding protein lepA;
  503::607     7e-36  66%  608 aa  LEPA_RHIME RecName: Full=GTP-binding protein lepA;
  502::606     9e-36  64%  607 aa  LEPA_STAS1 RecName: Full=GTP-binding protein lepA;
  503::607     9e-36  65%  608 aa  LEPA_AGRT5 RecName: Full=GTP-binding protein lepA;
  495::595     2e-35  64%  600 aa  LEPA_RICCK RecName: Full=GTP-binding protein lepA;
  505::605     2e-35  67%  610 aa  LEPA_RHILW RecName: Full=GTP-binding protein lepA;
  505::605     2e-35  67%  610 aa  LEPA_RHIL3 RecName: Full=GTP-binding protein lepA;
  505::605     2e-35  67%  610 aa  LEPA_RHIE6 RecName: Full=GTP-binding protein lepA;
  497::597     2e-35  65%  601 aa  LEPA_BARQU RecName: Full=GTP-binding protein lepA;
  506::611     2e-35  67%  618 aa  LEPA_ARTCA RecName: Full=GTP-binding protein lepA;
  502::606     2e-35  67%  611 aa  LEPA1_LACPL RecName: Full=GTP-binding protein lepA 1;
  499::602     3e-35  64%  603 aa  LEPA_RHOFD RecName: Full=GTP-binding protein lepA;
  506::611     3e-35  67%  617 aa  LEPA_ARTS2 RecName: Full=GTP-binding protein lepA;
  506::611     3e-35  67%  617 aa  LEPA_ARTAT RecName: Full=GTP-binding protein lepA;
  497::597     3e-35  66%  601 aa  LEPA_RHILO RecName: Full=GTP-binding protein lepA;
  502::606     3e-35  60%  606 aa  LEPA_CHRSD RecName: Full=GTP-binding protein lepA;
  497::601     3e-35  62%  601 aa  LEPA_BARHE RecName: Full=GTP-binding protein lepA;
  493::596     6e-35  62%  596 aa  LEPA_NITSB RecName: Full=GTP-binding protein lepA;
  497::600     6e-35  65%  601 aa  LEPA_GRABC RecName: Full=GTP-binding protein lepA;
  497::600     6e-35  66%  601 aa  LEPA_GLUDA RecName: Full=GTP-binding protein lepA;
  495::599     6e-35  65%  600 aa  LEPA_ACIF5 RecName: Full=GTP-binding protein lepA;
  495::599     6e-35  65%  600 aa  LEPA_ACIF2 RecName: Full=GTP-binding protein lepA;
  497::597     7e-35  63%  602 aa  LEPA_OCHA4 RecName: Full=GTP-binding protein lepA;
  497::597     7e-35  63%  602 aa  LEPA_BRUSU RecName: Full=GTP-binding protein lepA;
  497::597     7e-35  63%  602 aa  LEPA_BRUSI RecName: Full=GTP-binding protein lepA;
  497::597     7e-35  63%  602 aa  LEPA_BRUO2 RecName: Full=GTP-binding protein lepA;
  497::597     7e-35  63%  602 aa  LEPA_BRUC2 RecName: Full=GTP-binding protein lepA;
  501::601     1e-34  67%  607 aa  LEPA_SPHWW RecName: Full=GTP-binding protein lepA;
  495::600     1e-34  61%  604 aa  LEPA_SOLUE RecName: Full=GTP-binding protein lepA;
  505::605     1e-34  65%  610 aa  LEPA_RHIEC RecName: Full=GTP-binding protein lepA;
  501::605     2e-34  65%  605 aa  LEPA_PELPB RecName: Full=GTP-binding protein lepA;
  497::598     2e-34  65%  602 aa  LEPA_DESAP RecName: Full=GTP-binding protein lepA;
  497::600     3e-34  65%  600 aa  LEPA_GLUOX RecName: Full=GTP-binding protein lepA;
  493::597     4e-34  63%  597 aa  LEPA_DESPS RecName: Full=GTP-binding protein lepA;
  497::597     4e-34  62%  602 aa  LEPA_BRUME RecName: Full=GTP-binding protein lepA;
  497::597     4e-34  62%  602 aa  LEPA_BRUMB RecName: Full=GTP-binding protein lepA;
  497::597     4e-34  62%  602 aa  LEPA_BRUAB RecName: Full=GTP-binding protein lepA;
  497::597     4e-34  62%  602 aa  LEPA_BRUA2 RecName: Full=GTP-binding protein lepA;
  497::597     4e-34  62%  602 aa  LEPA_BRUA1 RecName: Full=GTP-binding protein lepA;
  496::600     1e-33  63%  601 aa  LEPA_TREDE RecName: Full=GTP-binding protein lepA;
  495::598     1e-33  62%  599 aa  LEPA_PSEU5 RecName: Full=GTP-binding protein lepA;
  495::598     1e-33  62%  599 aa  LEPA_PSEAE RecName: Full=GTP-binding protein lepA;
  495::598     1e-33  62%  599 aa  LEPA_PSEAB RecName: Full=GTP-binding protein lepA;
  495::598     1e-33  62%  599 aa  LEPA_PSEA8 RecName: Full=GTP-binding protein lepA;
  495::598     1e-33  62%  599 aa  LEPA_PSEA7 RecName: Full=GTP-binding protein lepA;
   57::160     1e-33  62%  161 aa  LEPA_PSEFL RecName: Full=GTP-binding protein lepA;Flags: Fragment;
  495::598     2e-33  61%  599 aa  LEPA_PSEFS RecName: Full=GTP-binding protein lepA;
  493::596     2e-33  62%  596 aa  LEPA_CAMHC RecName: Full=GTP-binding protein lepA;
  497::600     2e-33  63%  601 aa  LEPA_ACICJ RecName: Full=GTP-binding protein lepA;
  502::606     3e-33  61%  611 aa  LEPA_LACRJ RecName: Full=GTP-binding protein lepA;
  502::606     3e-33  61%  611 aa  LEPA_LACRD RecName: Full=GTP-binding protein lepA;
  502::606     3e-33  62%  610 aa  LEPA_LACBA RecName: Full=GTP-binding protein lepA;
  502::606     4e-33  63%  610 aa  LEPA_LACF3 RecName: Full=GTP-binding protein lepA;
  506::609     5e-33  66%  615 aa  LEPA_CLAMS RecName: Full=GTP-binding protein lepA;
  506::609     5e-33  66%  615 aa  LEPA_CLAM3 RecName: Full=GTP-binding protein lepA;
  495::598     7e-33  61%  599 aa  LEPA_PSEF5 RecName: Full=GTP-binding protein lepA;
  500::604     7e-33  62%  604 aa  LEPA_METPP RecName: Full=GTP-binding protein lepA;
  500::603     9e-33  61%  604 aa  LEPA_HELHP RecName: Full=GTP-binding protein lepA;
  498::602     1e-32  62%  602 aa  LEPA_LEPCP RecName: Full=GTP-binding protein lepA;
  495::595     2e-32  61%  598 aa  LEPA_PSEU2 RecName: Full=GTP-binding protein lepA;
  492::592     2e-32  61%  595 aa  LEPA_PSESM RecName: Full=GTP-binding protein lepA;
  492::592     2e-32  61%  595 aa  LEPA_PSE14 RecName: Full=GTP-binding protein lepA;
  499::602     2e-32  61%  602 aa  LEPA_HELPY RecName: Full=GTP-binding protein lepA;
  499::602     2e-32  61%  602 aa  LEPA_HELPS RecName: Full=GTP-binding protein lepA;
  501::604     2e-32  61%  604 aa  LEPA_HELPJ RecName: Full=GTP-binding protein lepA;
  499::602     2e-32  61%  602 aa  LEPA_HELPH RecName: Full=GTP-binding protein lepA;
  499::602     2e-32  61%  602 aa  LEPA_HELPG RecName: Full=GTP-binding protein lepA;
  501::604     2e-32  61%  604 aa  LEPA_HELP2 RecName: Full=GTP-binding protein lepA;
  496::600     3e-32  64%  600 aa  LEPA_MYCMS RecName: Full=GTP-binding protein lepA;
  498::601     3e-32  63%  603 aa  LEPA_CYAP8 RecName: Full=GTP-binding protein lepA;
  495::598     3e-32  59%  598 aa  LEPA_CAMJR RecName: Full=GTP-binding protein lepA;
  495::598     3e-32  59%  598 aa  LEPA_CAMJJ RecName: Full=GTP-binding protein lepA;
  495::598     3e-32  59%  598 aa  LEPA_CAMJE RecName: Full=GTP-binding protein lepA;
  493::596     3e-32  59%  596 aa  LEPA_CAMJD RecName: Full=GTP-binding protein lepA;
  495::598     3e-32  59%  598 aa  LEPA_CAMJ8 RecName: Full=GTP-binding protein lepA;
  493::596     4e-32  58%  596 aa  LEPA_WOLSU RecName: Full=GTP-binding protein lepA;
  499::603     4e-32  61%  603 aa  LEPA_POLSJ RecName: Full=GTP-binding protein lepA;
  493::596     4e-32  59%  596 aa  LEPA_CAMLR RecName: Full=GTP-binding protein lepA;
  493::596     6e-32  60%  596 aa  LEPA_SULDN RecName: Full=GTP-binding protein lepA;
  492::595     6e-32  62%  595 aa  LEPA_PARD8 RecName: Full=GTP-binding protein lepA;
  506::607     6e-32  65%  616 aa  LEPA_LEIXX RecName: Full=GTP-binding protein lepA;
  498::601     6e-32  63%  603 aa  LEPA_CYAA5 RecName: Full=GTP-binding protein lepA;
  498::601     8e-32  62%  603 aa  LEPA_MICAN RecName: Full=GTP-binding protein lepA;
  490::593     8e-32  62%  593 aa  LEPA_BACV8 RecName: Full=GTP-binding protein lepA;
  492::595     1e-31  62%  595 aa  LEPA_PORGI RecName: Full=GTP-binding protein lepA;
  492::595     1e-31  62%  595 aa  LEPA_PORG3 RecName: Full=GTP-binding protein lepA;
  498::602     1e-31  60%  602 aa  LEPA_DIAST RecName: Full=GTP-binding protein lepA;
  498::602     1e-31  61%  602 aa  LEPA_CLOTE RecName: Full=GTP-binding protein lepA;
  498::602     1e-31  60%  602 aa  LEPA_ACISJ RecName: Full=GTP-binding protein lepA;
  493::596     1e-31  59%  596 aa  LEPA_CAMC1 RecName: Full=GTP-binding protein lepA;
  492::595     2e-31  58%  596 aa  LEPA_DECAR RecName: Full=GTP-binding protein lepA;
  493::596     2e-31  59%  596 aa  LEPA_CAMC5 RecName: Full=GTP-binding protein lepA;
  498::601     2e-31  62%  603 aa  LEPA_SYNY3 RecName: Full=GTP-binding protein lepA;
  492::596     2e-31  55%  597 aa  LEPA_RALME RecName: Full=GTP-binding protein lepA;
  492::596     2e-31  55%  597 aa  LEPA_RALEJ RecName: Full=GTP-binding protein lepA;
  502::606     2e-31  60%  609 aa  LEPA_LACS1 RecName: Full=GTP-binding protein lepA;
  496::600     2e-31  60%  601 aa  LEPA_DESVM RecName: Full=GTP-binding protein lepA;
  492::596     2e-31  55%  597 aa  LEPA_CUPTR RecName: Full=GTP-binding protein lepA;
  493::596     2e-31  60%  596 aa  LEPA_CAMFF RecName: Full=GTP-binding protein lepA;
  496::600     2e-31  59%  601 aa  LEPA_BORGA RecName: Full=GTP-binding protein lepA;
  497::601     2e-31  57%  601 aa  LEPA_ANADF RecName: Full=GTP-binding protein lepA;
  498::602     2e-31  60%  602 aa  LEPA_ACIAC RecName: Full=GTP-binding protein lepA;
  496::596     3e-31  62%  599 aa  LEPA_HYDS0 RecName: Full=GTP-binding protein lepA;
  501::605     3e-31  59%  606 aa  LEPA_BORBU RecName: Full=GTP-binding protein lepA;
  498::603     4e-31  59%  603 aa  LEPA_ANAVT RecName: Full=GTP-binding protein lepA;
  498::603     4e-31  59%  603 aa  LEPA_ANASP RecName: Full=GTP-binding protein lepA;
  498::602     5e-31  60%  602 aa  LEPA_VEREI RecName: Full=GTP-binding protein lepA;
  498::602     5e-31  60%  602 aa  LEPA_SYNP2 RecName: Full=GTP-binding protein lepA;
  501::604     5e-31  58%  604 aa  LEPA_HELAH RecName: Full=GTP-binding protein lepA;
  498::602     5e-31  58%  602 aa  LEPA_DELAS RecName: Full=GTP-binding protein lepA;
  499::603     6e-31  60%  604 aa  LEPA_EUBE2 RecName: Full=GTP-binding protein lepA;
  491::595     6e-31  59%  595 aa  LEPA_DEIGD RecName: Full=GTP-binding protein lepA;
  497::600     6e-31  58%  600 aa  LEPA_AQUAE RecName: Full=GTP-binding protein lepA;
  493::597     8e-31  56%  598 aa  LEPA_RALSO RecName: Full=GTP-binding protein lepA;
  498::603     8e-31  59%  603 aa  LEPA_NOSP7 RecName: Full=GTP-binding protein lepA;
  497::600     8e-31  58%  603 aa  LEPA_CARHZ RecName: Full=GTP-binding protein lepA;
  498::598     1e-30  63%  604 aa  LEPA_CYAP7 RecName: Full=GTP-binding protein lepA;
  498::601     1e-30  61%  601 aa  LEPA_TRIEI RecName: Full=GTP-binding protein lepA;
  496::600     1e-30  57%  601 aa  LEPA_BORAP RecName: Full=GTP-binding protein lepA;
  492::596     2e-30  54%  597 aa  LEPA_HERAR RecName: Full=GTP-binding protein lepA;
  492::596     2e-30  58%  598 aa  LEPA_AZOSB RecName: Full=GTP-binding protein lepA;
  494::598     2e-30  56%  598 aa  LEPA_FLAJ1 RecName: Full=GTP-binding protein lepA;
  495::599     2e-30  60%  599 aa  LEPA_BDEBA RecName: Full=GTP-binding protein lepA;
  569::668     2e-30  55%  669 aa  GUF1_HUMAN RecName: Full=GTP-binding protein GUF1 homolog;
  498::601     3e-30  60%  604 aa  LEPA_SYNP6 RecName: Full=GTP-binding protein lepA;
  498::601     3e-30  60%  604 aa  LEPA_SYNE7 RecName: Full=GTP-binding protein lepA;
  494::598     4e-30  54%  599 aa  LEPA_RALPJ RecName: Full=GTP-binding protein lepA;
  500::604     4e-30  56%  604 aa  LEPA_FUSNN RecName: Full=GTP-binding protein lepA;
  497::597     4e-30  59%  602 aa  LEPA_COXBU RecName: Full=GTP-binding protein lepA;
  497::597     4e-30  59%  602 aa  LEPA_COXBR RecName: Full=GTP-binding protein lepA;
  497::597     4e-30  59%  602 aa  LEPA_COXBN RecName: Full=GTP-binding protein lepA;
  498::602     4e-30  58%  602 aa  LEPA_CALS8 RecName: Full=GTP-binding protein lepA;
  492::596     4e-30  56%  598 aa  LEPA_AZOSE RecName: Full=GTP-binding protein lepA;
  551::647     4e-30  55%  651 aa  GUF1_MOUSE RecName: Full=GTP-binding protein GUF1 homolog;
  498::598     5e-30  60%  603 aa  LEPA_CYAP4 RecName: Full=GTP-binding protein lepA;
  499::602     5e-30  58%  603 aa  LEPA_CLOTH RecName: Full=GTP-binding protein lepA;
  492::596     5e-30  54%  597 aa  LEPA_BURPP RecName: Full=GTP-binding protein lepA;
  498::601     9e-30  59%  602 aa  LEPA_GLOVI RecName: Full=GTP-binding protein lepA;
  492::596     9e-30  54%  597 aa  LEPA_BURXL RecName: Full=GTP-binding protein lepA;
  502::584     1e-29  70%  605 aa  LEPA_STRPF RecName: Full=GTP-binding protein lepA;
  492::592     1e-29  55%  594 aa  LEPA_FRATW RecName: Full=GTP-binding protein lepA;
  492::592     1e-29  55%  594 aa  LEPA_FRATT RecName: Full=GTP-binding protein lepA;
  492::592     1e-29  55%  594 aa  LEPA_FRATO RecName: Full=GTP-binding protein lepA;
  492::592     1e-29  55%  594 aa  LEPA_FRATN RecName: Full=GTP-binding protein lepA;
  492::592     1e-29  55%  597 aa  LEPA_FRATM RecName: Full=GTP-binding protein lepA;
  492::592     1e-29  55%  594 aa  LEPA_FRATH RecName: Full=GTP-binding protein lepA;
  492::592     1e-29  55%  594 aa  LEPA_FRATF RecName: Full=GTP-binding protein lepA;
  492::592     1e-29  55%  594 aa  LEPA_FRAT1 RecName: Full=GTP-binding protein lepA;
  492::592     1e-29  55%  594 aa  LEPA_FRAP2 RecName: Full=GTP-binding protein lepA;
  496::600     1e-29  57%  601 aa  LEPA_DESDA RecName: Full=GTP-binding protein lepA;
  492::596     1e-29  53%  597 aa  LEPA_BURS3 RecName: Full=GTP-binding protein lepA;
  494::598     2e-29  55%  598 aa  LEPA_FLAPJ RecName: Full=GTP-binding protein lepA;
  502::606     2e-29  56%  606 aa  LEPA_DEIRA RecName: Full=GTP-binding protein lepA;
  492::596     2e-29  52%  597 aa  LEPA_BURVG RecName: Full=GTP-binding protein lepA;
  492::596     2e-29  52%  597 aa  LEPA_BURCM RecName: Full=GTP-binding protein lepA;
  492::596     2e-29  52%  597 aa  LEPA_BURCH RecName: Full=GTP-binding protein lepA;
  492::596     2e-29  52%  597 aa  LEPA_BURCC RecName: Full=GTP-binding protein lepA;
  492::596     2e-29  52%  597 aa  LEPA_BURCA RecName: Full=GTP-binding protein lepA;
  492::596     2e-29  52%  597 aa  LEPA_BURA4 RecName: Full=GTP-binding protein lepA;
  492::595     2e-29  58%  595 aa  LEPA_AMOA5 RecName: Full=GTP-binding protein lepA;
  495::598     2e-29  54%  599 aa  LEPA_SACD2 RecName: Full=GTP-binding protein lepA;
  492::596     2e-29  53%  597 aa  LEPA_LARHH RecName: Full=GTP-binding protein lepA;
  495::599     2e-29  53%  599 aa  LEPA_HAHCH RecName: Full=GTP-binding protein lepA;
  497::601     3e-29  54%  603 aa  LEPA_THETN RecName: Full=GTP-binding protein lepA;
  499::598     3e-29  59%  602 aa  LEPA_PROM4 RecName: Full=GTP-binding protein lepA;
  492::592     3e-29  54%  598 aa  LEPA_HAES2 RecName: Full=GTP-binding protein lepA;
  492::592     3e-29  54%  598 aa  LEPA_HAES1 RecName: Full=GTP-binding protein lepA;
  494::598     3e-29  55%  598 aa  LEPA_GRAFK RecName: Full=GTP-binding protein lepA;
  497::601     4e-29  54%  603 aa  LEPA_THEPX RecName: Full=GTP-binding protein lepA;
  497::601     4e-29  54%  603 aa  LEPA_THEP3 RecName: Full=GTP-binding protein lepA;
  492::596     4e-29  53%  597 aa  LEPA_NEIG2 RecName: Full=GTP-binding protein lepA;
  492::596     4e-29  53%  597 aa  LEPA_NEIG1 RecName: Full=GTP-binding protein lepA;
  494::598     5e-29  52%  599 aa  LEPA_THIDA RecName: Full=GTP-binding protein lepA;
  492::596     5e-29  53%  597 aa  LEPA_NEIMF RecName: Full=GTP-binding protein lepA;
  492::596     5e-29  53%  597 aa  LEPA_NEIMB RecName: Full=GTP-binding protein lepA;
  492::596     5e-29  53%  597 aa  LEPA_NEIMA RecName: Full=GTP-binding protein lepA;
  492::596     5e-29  53%  597 aa  LEPA_NEIM0 RecName: Full=GTP-binding protein lepA;
  492::596     5e-29  52%  597 aa  LEPA_BURP8 RecName: Full=GTP-binding protein lepA;
  492::592     5e-29  55%  597 aa  LEPA_ACTSZ RecName: Full=GTP-binding protein lepA;
  492::592     6e-29  54%  599 aa  LEPA_YERPY RecName: Full=GTP-binding protein lepA;
  492::592     6e-29  54%  599 aa  LEPA_YERPS RecName: Full=GTP-binding protein lepA;
  492::592     6e-29  54%  599 aa  LEPA_YERPP RecName: Full=GTP-binding protein lepA;
  492::592     6e-29  54%  599 aa  LEPA_YERPN RecName: Full=GTP-binding protein lepA;
  492::592     6e-29  54%  599 aa  LEPA_YERPG RecName: Full=GTP-binding protein lepA;
  492::592     6e-29  54%  599 aa  LEPA_YERPE RecName: Full=GTP-binding protein lepA;
  492::592     6e-29  54%  599 aa  LEPA_YERPB RecName: Full=GTP-binding protein lepA;
  492::592     6e-29  54%  599 aa  LEPA_YERPA RecName: Full=GTP-binding protein lepA;
  492::592     6e-29  54%  599 aa  LEPA_YERP3 RecName: Full=GTP-binding protein lepA;
  492::592     6e-29  54%  599 aa  LEPA_YERE8 RecName: Full=GTP-binding protein lepA;
  497::600     6e-29  56%  601 aa  LEPA_METSB RecName: Full=GTP-binding protein lepA;
  492::592     6e-29  53%  598 aa  LEPA_HAEIN RecName: Full=GTP-binding protein lepA;
  492::592     6e-29  53%  598 aa  LEPA_HAEIG RecName: Full=GTP-binding protein lepA;
  492::592     6e-29  53%  598 aa  LEPA_HAEIE RecName: Full=GTP-binding protein lepA;
  492::592     6e-29  53%  598 aa  LEPA_HAEI8 RecName: Full=GTP-binding protein lepA;
  492::592     6e-29  54%  597 aa  LEPA_HAEDU RecName: Full=GTP-binding protein lepA;
  498::602     6e-29  54%  602 aa  LEPA_ANATD RecName: Full=GTP-binding protein lepA;
  492::592     8e-29  54%  599 aa  LEPA_MANSM RecName: Full=GTP-binding protein lepA;
  497::600     8e-29  55%  601 aa  LEPA_LEPBL RecName: Full=GTP-binding protein lepA;
  497::600     8e-29  55%  601 aa  LEPA_LEPBJ RecName: Full=GTP-binding protein lepA;
  500::604     8e-29  57%  604 aa  LEPA1_RHOBA RecName: Full=GTP-binding protein lepA 1;
  492::592     1e-28  53%  598 aa  LEPA_SERP5 RecName: Full=GTP-binding protein lepA;
  497::601     1e-28  56%  601 aa  LEPA_LEPBP RecName: Full=GTP-binding protein lepA;
  497::601     1e-28  56%  601 aa  LEPA_LEPBA RecName: Full=GTP-binding protein lepA;
  492::596     1e-28  52%  597 aa  LEPA_BORPE RecName: Full=GTP-binding protein lepA;
  492::596     1e-28  52%  597 aa  LEPA_BORPA RecName: Full=GTP-binding protein lepA;
  492::596     1e-28  52%  597 aa  LEPA_BORBR RecName: Full=GTP-binding protein lepA;
  492::592     1e-28  53%  598 aa  LEPA_PASMU RecName: Full=GTP-binding protein lepA;
  497::599     1e-28  55%  600 aa  LEPA_LEPIN RecName: Full=GTP-binding protein lepA;
  497::599     1e-28  55%  600 aa  LEPA_LEPIC RecName: Full=GTP-binding protein lepA;
  497::600     2e-28  53%  602 aa  LEPA_STRM5 RecName: Full=GTP-binding protein lepA;
  492::592     2e-28  52%  599 aa  LEPA_PECCP RecName: Full=GTP-binding protein lepA;
  502::606     2e-28  55%  612 aa  LEPA_LACGA RecName: Full=GTP-binding protein lepA;
  498::602     2e-28  54%  603 aa  LEPA_EUBR3 RecName: Full=GTP-binding protein lepA;
  492::592     2e-28  52%  599 aa  LEPA_ERWT9 RecName: Full=GTP-binding protein lepA;
  492::592     2e-28  53%  599 aa  LEPA_ERWCT RecName: Full=GTP-binding protein lepA;
  492::596     2e-28  52%  597 aa  LEPA_BORPD RecName: Full=GTP-binding protein lepA;
  497::601     2e-28  55%  601 aa  LEPA_XANP2 RecName: Full=GTP-binding protein lepA;
  492::592     2e-28  53%  598 aa  LEPA_PHOLL RecName: Full=GTP-binding protein lepA;
  492::596     2e-28  50%  597 aa  LEPA_METFK RecName: Full=GTP-binding protein lepA;
  502::606     2e-28  55%  612 aa  LEPA_LACJO RecName: Full=GTP-binding protein lepA;
  498::601     2e-28  58%  602 aa  LEPA_ALKMQ RecName: Full=GTP-binding protein lepA;
  495::599     3e-28  53%  599 aa  LEPA_SILST RecName: Full=GTP-binding protein lepA;
  492::596     3e-28  51%  596 aa  LEPA_SHESR RecName: Full=GTP-binding protein lepA;
  492::596     3e-28  51%  596 aa  LEPA_SHESM RecName: Full=GTP-binding protein lepA;
  492::596     3e-28  51%  596 aa  LEPA_SHESA RecName: Full=GTP-binding protein lepA;
  492::596     3e-28  51%  596 aa  LEPA_SHEON RecName: Full=GTP-binding protein lepA;
  492::592     3e-28  55%  599 aa  LEPA_SALAR RecName: Full=GTP-binding protein lepA;
  502::606     3e-28  56%  612 aa  LEPA_LACAC RecName: Full=GTP-binding protein lepA;
  492::596     3e-28  51%  597 aa  LEPA_BORA1 RecName: Full=GTP-binding protein lepA;
  492::596     4e-28  50%  596 aa  LEPA_SHESW RecName: Full=GTP-binding protein lepA;
  492::596     4e-28  50%  596 aa  LEPA_SHEPC RecName: Full=GTP-binding protein lepA;
  492::596     4e-28  50%  596 aa  LEPA_SHELP RecName: Full=GTP-binding protein lepA;
  492::596     4e-28  51%  596 aa  LEPA_SHEFN RecName: Full=GTP-binding protein lepA;
  492::592     4e-28  54%  599 aa  LEPA_SALTY RecName: Full=GTP-binding protein lepA;
  492::592     4e-28  54%  599 aa  LEPA_SALTI RecName: Full=GTP-binding protein lepA;
  492::592     4e-28  54%  599 aa  LEPA_SALSV RecName: Full=GTP-binding protein lepA;
  492::592     4e-28  54%  599 aa  LEPA_SALPK RecName: Full=GTP-binding protein lepA;
  492::592     4e-28  54%  599 aa  LEPA_SALPC RecName: Full=GTP-binding protein lepA;
  492::592     4e-28  54%  599 aa  LEPA_SALPA RecName: Full=GTP-binding protein lepA;
  492::592     4e-28  54%  599 aa  LEPA_SALNS RecName: Full=GTP-binding protein lepA;
  492::592     4e-28  54%  599 aa  LEPA_SALHS RecName: Full=GTP-binding protein lepA;
  492::592     4e-28  54%  599 aa  LEPA_SALG2 RecName: Full=GTP-binding protein lepA;
  492::592     4e-28  54%  599 aa  LEPA_SALEP RecName: Full=GTP-binding protein lepA;
  492::592     4e-28  54%  599 aa  LEPA_SALDC RecName: Full=GTP-binding protein lepA;
  492::592     4e-28  54%  599 aa  LEPA_SALCH RecName: Full=GTP-binding protein lepA;
  492::592     4e-28  54%  599 aa  LEPA_SALA4 RecName: Full=GTP-binding protein lepA;
  496::600     4e-28  53%  601 aa  LEPA_DESAD RecName: Full=GTP-binding protein lepA;
  497::600     4e-28  55%  600 aa  LEPA_CLOPS RecName: Full=GTP-binding protein lepA;
  497::600     4e-28  55%  600 aa  LEPA_CLOPE RecName: Full=GTP-binding protein lepA;
  497::600     4e-28  55%  600 aa  LEPA_CLOP1 RecName: Full=GTP-binding protein lepA;
  495::599     4e-28  50%  599 aa  LEPA_ALCBS RecName: Full=GTP-binding protein lepA;
  496::596     5e-28  56%  602 aa  LEPA_ZYMMO RecName: Full=GTP-binding protein lepA;
  499::603     5e-28  54%  603 aa  LEPA_VARPS RecName: Full=GTP-binding protein lepA;
  497::600     5e-28  52%  602 aa  LEPA_STRMK RecName: Full=GTP-binding protein lepA;
  492::592     5e-28  54%  599 aa  LEPA_SHISS RecName: Full=GTP-binding protein lepA;
  492::592     5e-28  54%  599 aa  LEPA_SHIFL RecName: Full=GTP-binding protein lepA;
  492::592     5e-28  54%  599 aa  LEPA_SHIF8 RecName: Full=GTP-binding protein lepA;
  492::592     5e-28  54%  599 aa  LEPA_SHIDS RecName: Full=GTP-binding protein lepA;
  492::592     5e-28  54%  599 aa  LEPA_SHIBS RecName: Full=GTP-binding protein lepA;
  492::592     5e-28  54%  599 aa  LEPA_SHIB3 RecName: Full=GTP-binding protein lepA;
  492::596     5e-28  51%  596 aa  LEPA_SHEDO RecName: Full=GTP-binding protein lepA;
  492::596     5e-28  50%  596 aa  LEPA_SHEB9 RecName: Full=GTP-binding protein lepA;
  492::596     5e-28  50%  596 aa  LEPA_SHEB8 RecName: Full=GTP-binding protein lepA;
  492::596     5e-28  50%  596 aa  LEPA_SHEB5 RecName: Full=GTP-binding protein lepA;
  492::596     5e-28  50%  596 aa  LEPA_SHEB2 RecName: Full=GTP-binding protein lepA;
  491::594     5e-28  57%  598 aa  LEPA_MYCMO RecName: Full=GTP-binding protein lepA;
  502::602     5e-28  58%  612 aa  LEPA_LACH4 RecName: Full=GTP-binding protein lepA;
  492::592     5e-28  54%  599 aa  LEPA_ESCF3 RecName: Full=GTP-binding protein lepA;
  492::592     5e-28  54%  599 aa  LEPA_ECOSM RecName: Full=GTP-binding protein lepA;
  492::592     5e-28  54%  599 aa  LEPA_ECOSE RecName: Full=GTP-binding protein lepA;
  492::592     5e-28  54%  599 aa  LEPA_ECOLU RecName: Full=GTP-binding protein lepA;
  492::592     5e-28  54%  599 aa  LEPA_ECOLI RecName: Full=GTP-binding protein lepA;
  492::592     5e-28  54%  599 aa  LEPA_ECOLC RecName: Full=GTP-binding protein lepA;
  492::592     5e-28  54%  599 aa  LEPA_ECOL6 RecName: Full=GTP-binding protein lepA;
  492::592     5e-28  54%  599 aa  LEPA_ECOL5 RecName: Full=GTP-binding protein lepA;
  492::592     5e-28  54%  599 aa  LEPA_ECOHS RecName: Full=GTP-binding protein lepA;
  492::592     5e-28  54%  599 aa  LEPA_ECODH RecName: Full=GTP-binding protein lepA;
  492::592     5e-28  54%  599 aa  LEPA_ECOBW RecName: Full=GTP-binding protein lepA;
  492::592     5e-28  54%  599 aa  LEPA_ECO8A RecName: Full=GTP-binding protein lepA;
  492::592     5e-28  54%  599 aa  LEPA_ECO7I RecName: Full=GTP-binding protein lepA;
  492::592     5e-28  54%  599 aa  LEPA_ECO5E RecName: Full=GTP-binding protein lepA;
  492::592     5e-28  54%  599 aa  LEPA_ECO57 RecName: Full=GTP-binding protein lepA;
  492::592     5e-28  54%  599 aa  LEPA_ECO55 RecName: Full=GTP-binding protein lepA;
  492::592     5e-28  54%  599 aa  LEPA_ECO24 RecName: Full=GTP-binding protein lepA;
  497::601     5e-28  58%  601 aa  LEPA_CLOD6 RecName: Full=GTP-binding protein lepA;
  497::601     7e-28  51%  601 aa  LEPA_XANCP RecName: Full=GTP-binding protein lepA;
  497::601     7e-28  51%  601 aa  LEPA_XANCB RecName: Full=GTP-binding protein lepA;
  497::601     7e-28  51%  601 aa  LEPA_XANC8 RecName: Full=GTP-binding protein lepA;
  492::592     7e-28  51%  598 aa  LEPA_TOLAT RecName: Full=GTP-binding protein lepA;
  492::592     7e-28  53%  599 aa  LEPA_SODGM RecName: Full=GTP-binding protein lepA;
  499::602     7e-28  53%  603 aa  LEPA_NITWN RecName: Full=GTP-binding protein lepA;
  492::592     7e-28  52%  599 aa  LEPA_KLEP3 RecName: Full=GTP-binding protein lepA;
  492::596     7e-28  51%  597 aa  LEPA_CHRVO RecName: Full=GTP-binding protein lepA;
  495::598     7e-28  52%  599 aa  LEPA_CELJU RecName: Full=GTP-binding protein lepA;
  497::600     9e-28  53%  601 aa  LEPA_OLICO RecName: Full=GTP-binding protein lepA;
  497::601     9e-28  51%  602 aa  LEPA_MARMM RecName: Full=GTP-binding protein lepA;
  495::600     9e-28  55%  600 aa  LEPA_MAGSA RecName: Full=GTP-binding protein lepA;
  492::592     9e-28  52%  599 aa  LEPA_ENT38 RecName: Full=GTP-binding protein lepA;
  495::598     1e-27  53%  599 aa  LEPA_SILPO RecName: Full=GTP-binding protein lepA;
  492::596     1e-27  50%  596 aa  LEPA_SHEAM RecName: Full=GTP-binding protein lepA;
  495::595     1e-27  51%  600 aa  LEPA_RICPR RecName: Full=GTP-binding protein lepA;
  499::602     1e-27  53%  603 aa  LEPA_RHOPT RecName: Full=GTP-binding protein lepA;
  499::602     1e-27  53%  603 aa  LEPA_RHOPA RecName: Full=GTP-binding protein lepA;
  506::609     1e-27  53%  610 aa  LEPA_NITHX RecName: Full=GTP-binding protein lepA;
  504::608     1e-27  55%  609 aa  LEPA_ERYLH RecName: Full=GTP-binding protein lepA;
  495::598     1e-27  53%  599 aa  LEPA_DINSH RecName: Full=GTP-binding protein lepA;
  492::592     1e-27  54%  599 aa  LEPA_CITK8 RecName: Full=GTP-binding protein lepA;
  499::602     1e-27  53%  603 aa  LEPA_BRAJA RecName: Full=GTP-binding protein lepA;
  493::596     1e-27  49%  600 aa  LEPA_BLOPB RecName: Full=GTP-binding protein lepA;
  497::601     1e-27  50%  601 aa  LEPA_XANOR RecName: Full=GTP-binding protein lepA;
  492::596     1e-27  50%  596 aa  LEPA_XANOP RecName: Full=GTP-binding protein lepA;
  497::601     1e-27  50%  601 aa  LEPA_XANOM RecName: Full=GTP-binding protein lepA;
  492::592     1e-27  52%  598 aa  LEPA_PROMH RecName: Full=GTP-binding protein lepA;
  491::594     1e-27  57%  598 aa  LEPA_MYCHJ RecName: Full=GTP-binding protein lepA;
  491::594     1e-27  57%  598 aa  LEPA_MYCH7 RecName: Full=GTP-binding protein lepA;
  491::594     1e-27  57%  598 aa  LEPA_MYCH2 RecName: Full=GTP-binding protein lepA;
  492::592     1e-27  51%  599 aa  LEPA_KLEP7 RecName: Full=GTP-binding protein lepA;
  492::592     1e-27  51%  599 aa  LEPA_ENTS8 RecName: Full=GTP-binding protein lepA;
  498::601     1e-27  55%  602 aa  LEPA_ALKOO RecName: Full=GTP-binding protein lepA;
  492::592     1e-27  50%  597 aa  LEPA_AERS4 RecName: Full=GTP-binding protein lepA;
  495::595     2e-27  51%  600 aa  LEPA_RICTY RecName: Full=GTP-binding protein lepA;
  494::594     2e-27  51%  598 aa  LEPA_PSEA6 RecName: Full=GTP-binding protein lepA;
  495::598     2e-27  51%  599 aa  LEPA_BLOFL RecName: Full=GTP-binding protein lepA;
  498::601     3e-27  53%  602 aa  LEPA_RHOSK RecName: Full=GTP-binding protein lepA;
  495::598     3e-27  53%  599 aa  LEPA_RHOS4 RecName: Full=GTP-binding protein lepA;
  498::601     3e-27  53%  602 aa  LEPA_RHOS1 RecName: Full=GTP-binding protein lepA;
  500::604     3e-27  53%  605 aa  LEPA_NOVAD RecName: Full=GTP-binding protein lepA;
  495::598     3e-27  52%  599 aa  LEPA_JANSC RecName: Full=GTP-binding protein lepA;
  501::601     3e-27  55%  607 aa  LEPA_SPHAL RecName: Full=GTP-binding protein lepA;
  495::598     3e-27  53%  599 aa  LEPA_RHOS5 RecName: Full=GTP-binding protein lepA;
  492::592     3e-27  53%  599 aa  LEPA_ECOUT RecName: Full=GTP-binding protein lepA;
  492::592     3e-27  53%  599 aa  LEPA_ECOK1 RecName: Full=GTP-binding protein lepA;
  492::592     3e-27  53%  599 aa  LEPA_ECO81 RecName: Full=GTP-binding protein lepA;
  492::592     3e-27  53%  599 aa  LEPA_ECO45 RecName: Full=GTP-binding protein lepA;
  492::592     3e-27  53%  599 aa  LEPA_ECO27 RecName: Full=GTP-binding protein lepA;
  495::598     4e-27  51%  599 aa  LEPA_ROSDO RecName: Full=GTP-binding protein lepA;
  499::602     4e-27  52%  603 aa  LEPA_RHOPS RecName: Full=GTP-binding protein lepA;
  497::600     4e-27  52%  601 aa  LEPA_RHOPB RecName: Full=GTP-binding protein lepA;
  499::602     4e-27  52%  603 aa  LEPA_RHOP2 RecName: Full=GTP-binding protein lepA;
  496::599     4e-27  51%  600 aa  LEPA_MARAV RecName: Full=GTP-binding protein lepA;
  502::606     4e-27  54%  612 aa  LEPA_LACDB RecName: Full=GTP-binding protein lepA;
  502::606     4e-27  54%  612 aa  LEPA_LACDA RecName: Full=GTP-binding protein lepA;
  492::596     4e-27  52%  596 aa  LEPA_CYTH3 RecName: Full=GTP-binding protein lepA;
  494::597     7e-27  51%  599 aa  LEPA_SYNWW RecName: Full=GTP-binding protein lepA;
  494::594     7e-27  50%  598 aa  LEPA_ALTMD RecName: Full=GTP-binding protein lepA;
  499::599     1e-26  52%  603 aa  LEPA_IDILO RecName: Full=GTP-binding protein lepA;
  492::592     1e-26  50%  595 aa  LEPA_VESOH RecName: Full=GTP-binding protein lepA;
  492::596     2e-26  50%  596 aa  LEPA_SHEWM RecName: Full=GTP-binding protein lepA;
  492::596     3e-26  50%  596 aa  LEPA_SHESH RecName: Full=GTP-binding protein lepA;
  492::596     3e-26  50%  596 aa  LEPA_SHEPW RecName: Full=GTP-binding protein lepA;
  492::596     3e-26  50%  596 aa  LEPA_SHEPA RecName: Full=GTP-binding protein lepA;
  492::596     3e-26  50%  596 aa  LEPA_SHEHH RecName: Full=GTP-binding protein lepA;
  491::594     4e-26  54%  600 aa  LEPA_MYCA5 RecName: Full=GTP-binding protein lepA;
  499::602     8e-26  50%  603 aa  LEPA_RHOP5 RecName: Full=GTP-binding protein lepA;
  546::637     2e-25  54%  646 aa  YE14_SCHPO RecName: Full=Uncharacterized GTP-binding protein
  492::595     2e-25  52%  596 aa  LEPA_COLP3 RecName: Full=GTP-binding protein lepA;
  499::602     3e-25  52%  604 aa  LEPA_SYNR3 RecName: Full=GTP-binding protein lepA;
  490::593     3e-25  50%  597 aa  LEPA_MYCPU RecName: Full=GTP-binding protein lepA;
  495::598     4e-25  50%  605 aa  LEPA_MYCS5 RecName: Full=GTP-binding protein lepA;
  492::596     5e-25  47%  597 aa  LEPA_RALEH RecName: Full=GTP-binding protein lepA;
  499::602     5e-25  50%  602 aa  LEPA_PROMS RecName: Full=GTP-binding protein lepA;
  499::602     5e-25  50%  602 aa  LEPA_PROM9 RecName: Full=GTP-binding protein lepA;
  499::602     5e-25  50%  602 aa  LEPA_PROM2 RecName: Full=GTP-binding protein lepA;
  499::602     5e-25  50%  602 aa  LEPA_PROM0 RecName: Full=GTP-binding protein lepA;
  496::597     7e-25  51%  599 aa  LEPA_UREU1 RecName: Full=GTP-binding protein lepA;
  496::597     7e-25  51%  599 aa  LEPA_UREPA RecName: Full=GTP-binding protein lepA;
  496::597     7e-25  51%  599 aa  LEPA_UREP2 RecName: Full=GTP-binding protein lepA;
  499::602     7e-25  50%  603 aa  LEPA_PROMT RecName: Full=GTP-binding protein lepA;
  492::592     9e-25  49%  598 aa  LEPA_PSYIN RecName: Full=GTP-binding protein lepA;
  499::598     9e-25  52%  603 aa  LEPA_PROM1 RecName: Full=GTP-binding protein lepA;
  498::602     9e-25  50%  602 aa  LEPA_PARUW RecName: Full=GTP-binding protein lepA;
  501::602     1e-24  52%  610 aa  LEPA_THET8 RecName: Full=GTP-binding protein lepA;
  501::602     1e-24  52%  610 aa  LEPA_THET2 RecName: Full=GTP-binding protein lepA;
  496::596     1e-24  50%  601 aa  LEPA_RHORT RecName: Full=GTP-binding protein lepA;
  499::602     1e-24  50%  602 aa  LEPA_PROMA RecName: Full=GTP-binding protein lepA;
  502::602     1e-24  51%  605 aa  LEPA_DEHSC RecName: Full=GTP-binding protein lepA;
  502::602     1e-24  51%  605 aa  LEPA_DEHSB RecName: Full=GTP-binding protein lepA;
  502::602     1e-24  51%  605 aa  LEPA_DEHE1 RecName: Full=GTP-binding protein lepA;
  499::602     1e-24  50%  602 aa  LEPA_CHLTA RecName: Full=GTP-binding protein lepA;
  492::592     2e-24  49%  597 aa  LEPA_VIBCM RecName: Full=GTP-binding protein lepA;
  492::592     2e-24  49%  597 aa  LEPA_VIBCH RecName: Full=GTP-binding protein lepA;
  492::592     2e-24  49%  597 aa  LEPA_VIBC3 RecName: Full=GTP-binding protein lepA;
  499::599     2e-24  50%  605 aa  LEPA_TREPS RecName: Full=GTP-binding protein lepA;
  499::599     2e-24  50%  605 aa  LEPA_TREPA RecName: Full=GTP-binding protein lepA;
  513::613     2e-24  50%  621 aa  LEPA_THEMA RecName: Full=GTP-binding protein lepA;
  495::598     2e-24  49%  599 aa  LEPA_PSEPW RecName: Full=GTP-binding protein lepA;
  495::598     2e-24  49%  599 aa  LEPA_PSEPK RecName: Full=GTP-binding protein lepA;
  492::595     2e-24  49%  596 aa  LEPA_PSEPG RecName: Full=GTP-binding protein lepA;
  492::595     2e-24  49%  596 aa  LEPA_PSEP1 RecName: Full=GTP-binding protein lepA;
  495::598     2e-24  49%  599 aa  LEPA_PSEMY RecName: Full=GTP-binding protein lepA;
  495::598     2e-24  49%  599 aa  LEPA_PSEE4 RecName: Full=GTP-binding protein lepA;
  499::602     2e-24  50%  602 aa  LEPA_CHLPN RecName: Full=GTP-binding protein lepA;
  499::602     2e-24  50%  602 aa  LEPA_CHLFF RecName: Full=GTP-binding protein lepA;
  499::602     2e-24  50%  602 aa  LEPA_CHLCV RecName: Full=GTP-binding protein lepA;
  499::602     2e-24  49%  602 aa  LEPA_PROMP RecName: Full=GTP-binding protein lepA;
  499::602     2e-24  49%  602 aa  LEPA_PROM5 RecName: Full=GTP-binding protein lepA;
  499::602     3e-24  50%  604 aa  LEPA_PROMM RecName: Full=GTP-binding protein lepA;
  499::602     3e-24  50%  604 aa  LEPA_PROM3 RecName: Full=GTP-binding protein lepA;
  496::600     3e-24  53%  600 aa  LEPA_MESFL RecName: Full=GTP-binding protein lepA;
  499::602     4e-24  49%  602 aa  LEPA_CHLTR RecName: Full=GTP-binding protein lepA;
  499::602     4e-24  49%  602 aa  LEPA_CHLTB RecName: Full=GTP-binding protein lepA;
  499::602     4e-24  49%  602 aa  LEPA_CHLT2 RecName: Full=GTP-binding protein lepA;
  499::602     4e-24  50%  602 aa  LEPA_CHLAB RecName: Full=GTP-binding protein lepA;
  492::596     4e-24  47%  597 aa  LEPA_BURTA RecName: Full=GTP-binding protein lepA;
  492::596     4e-24  47%  597 aa  LEPA_BURPS RecName: Full=GTP-binding protein lepA;
  492::596     4e-24  47%  597 aa  LEPA_BURP6 RecName: Full=GTP-binding protein lepA;
  492::596     4e-24  47%  597 aa  LEPA_BURP1 RecName: Full=GTP-binding protein lepA;
  492::596     4e-24  47%  597 aa  LEPA_BURP0 RecName: Full=GTP-binding protein lepA;
  492::596     4e-24  47%  597 aa  LEPA_BURMS RecName: Full=GTP-binding protein lepA;
  492::596     4e-24  47%  597 aa  LEPA_BURMA RecName: Full=GTP-binding protein lepA;
  492::596     4e-24  47%  597 aa  LEPA_BURM9 RecName: Full=GTP-binding protein lepA;
  492::596     4e-24  47%  597 aa  LEPA_BURM7 RecName: Full=GTP-binding protein lepA;
  492::596     4e-24  47%  597 aa  LEPA_BURM1 RecName: Full=GTP-binding protein lepA;
  499::602     1e-23  49%  602 aa  LEPA_CHLMU RecName: Full=GTP-binding protein lepA;
  492::593     1e-23  46%  602 aa  LEPA_BAUCH RecName: Full=GTP-binding protein lepA;
  492::592     2e-23  47%  597 aa  LEPA_VIBVY RecName: Full=GTP-binding protein lepA;
  492::592     2e-23  47%  597 aa  LEPA_VIBVU RecName: Full=GTP-binding protein lepA;
  492::592     2e-23  47%  597 aa  LEPA_VIBF1 RecName: Full=GTP-binding protein lepA;
  492::592     2e-23  49%  596 aa  LEPA_NEOSM RecName: Full=GTP-binding protein lepA;
  501::605     2e-23  48%  606 aa  LEPA_CAUCR RecName: Full=GTP-binding protein lepA;
  497::601     2e-23  48%  602 aa  LEPA_CAUCN RecName: Full=GTP-binding protein lepA;
  492::595     2e-23  44%  595 aa  LEPA_RUTMC RecName: Full=GTP-binding protein lepA;
  495::595     2e-23  48%  598 aa  LEPA_PSEPF RecName: Full=GTP-binding protein lepA;
  492::592     3e-23  46%  597 aa  LEPA_VIBPA RecName: Full=GTP-binding protein lepA;
  492::592     3e-23  46%  597 aa  LEPA_VIBHB RecName: Full=GTP-binding protein lepA;
  491::594     4e-23  50%  599 aa  LEPA_MYCFE RecName: Full=GTP-binding protein lepA;
  494::598     6e-23  43%  598 aa  LEPA_WOLWR RecName: Full=GTP-binding protein lepA;
  494::598     6e-23  43%  598 aa  LEPA_WOLPM RecName: Full=GTP-binding protein lepA;
  492::592     6e-23  48%  597 aa  LEPA_VIBSL RecName: Full=GTP-binding protein lepA;
  499::603     6e-23  48%  603 aa  LEPA_POLNA RecName: Full=GTP-binding protein lepA;
  497::600     6e-23  47%  600 aa  LEPA_MYCPE RecName: Full=GTP-binding protein lepA;
  498::602     6e-23  48%  602 aa  LEPA_MYCGA RecName: Full=GTP-binding protein lepA;
  494::598     8e-23  41%  598 aa  LEPA_WOLPP RecName: Full=GTP-binding protein lepA;
  496::600     8e-23  51%  600 aa  LEPA_MYCCT RecName: Full=GTP-binding protein lepA;
  494::598     1e-22  50%  598 aa  LEPA_MYCPN RecName: Full=GTP-binding protein lepA;
  497::600     2e-22  47%  602 aa  LEPA_XYLFT RecName: Full=GTP-binding protein lepA;
  497::600     2e-22  47%  602 aa  LEPA_XYLFM RecName: Full=GTP-binding protein lepA;
  497::600     2e-22  47%  602 aa  LEPA_XYLFA RecName: Full=GTP-binding protein lepA;
  497::600     2e-22  47%  602 aa  LEPA_XYLF2 RecName: Full=GTP-binding protein lepA;
  495::598     2e-22  45%  599 aa  LEPA_TERTT RecName: Full=GTP-binding protein lepA;
  492::596     3e-22  45%  596 aa  LEPA_XANC5 RecName: Full=GTP-binding protein lepA;
  502::605     3e-22  46%  605 aa  LEPA_PHYMT RecName: Full=GTP-binding protein lepA;
  494::598     3e-22  48%  598 aa  LEPA_MYCGE RecName: Full=GTP-binding protein lepA;
  497::601     4e-22  45%  601 aa  LEPA_XANAC RecName: Full=GTP-binding protein lepA;
  495::599     4e-22  47%  601 aa  LEPA_THICR RecName: Full=GTP-binding protein lepA;
  491::594     7e-22  49%  597 aa  LEPA_MYCAP RecName: Full=GTP-binding protein lepA;
  502::604     9e-22  46%  605 aa  LEPA_ONYPE RecName: Full=GTP-binding protein lepA;
  494::594     9e-22  45%  598 aa  LEPA_EHRRW RecName: Full=GTP-binding protein lepA;
  494::594     9e-22  45%  598 aa  LEPA_EHRRG RecName: Full=GTP-binding protein lepA;
  502::604     9e-22  46%  605 aa  LEPA_AYWBP RecName: Full=GTP-binding protein lepA;
  492::592     1e-21  45%  597 aa  LEPA_AERHH RecName: Full=GTP-binding protein lepA;
  502::603     2e-21  46%  605 aa  LEPA_PHYAS RecName: Full=GTP-binding protein lepA;
  495::598     2e-21  42%  598 aa  LEPA_PSYCK RecName: Full=GTP-binding protein lepA;
  495::598     3e-21  42%  600 aa  LEPA_PSYWF RecName: Full=GTP-binding protein lepA;
  501::604     3e-21  43%  605 aa  LEPA_ACIBY RecName: Full=GTP-binding protein lepA;
  501::604     3e-21  43%  605 aa  LEPA_ACIBT RecName: Full=GTP-binding protein lepA;
  501::604     3e-21  43%  605 aa  LEPA_ACIBC RecName: Full=GTP-binding protein lepA;
  501::604     3e-21  43%  605 aa  LEPA_ACIB5 RecName: Full=GTP-binding protein lepA;
  501::604     3e-21  43%  605 aa  LEPA_ACIB3 RecName: Full=GTP-binding protein lepA;
  495::598     4e-21  42%  598 aa  LEPA_PSYA2 RecName: Full=GTP-binding protein lepA;
  492::592     4e-21  47%  597 aa  LEPA_EDWI9 RecName: Full=GTP-binding protein lepA;
  490::593     4e-21  47%  593 aa  LEPA_BACTN RecName: Full=GTP-binding protein lepA;
  501::604     4e-21  43%  605 aa  LEPA_ACIBS RecName: Full=GTP-binding protein lepA;
  494::594     5e-21  41%  598 aa  LEPA_EHRCR RecName: Full=GTP-binding protein lepA;
  490::593     6e-21  48%  593 aa  LEPA_BACFR RecName: Full=GTP-binding protein lepA;
  490::593     6e-21  48%  593 aa  LEPA_BACFN RecName: Full=GTP-binding protein lepA;
  493::597     8e-21  45%  598 aa  LEPA_DESOH RecName: Full=GTP-binding protein lepA;
  492::592     1e-20  47%  596 aa  LEPA_PSEHT RecName: Full=GTP-binding protein lepA;
  494::594     1e-20  39%  598 aa  LEPA_WOLTR RecName: Full=GTP-binding protein lepA;
  501::601     1e-20  45%  605 aa  LEPA_MESSB RecName: Full=GTP-binding protein lepA;
  501::604     1e-20  42%  605 aa  LEPA_ACIAD RecName: Full=GTP-binding protein lepA;
  495::595     2e-20  43%  599 aa  LEPA_ANAMM RecName: Full=GTP-binding protein lepA;
  495::595     2e-20  43%  599 aa  LEPA_ANAMF RecName: Full=GTP-binding protein lepA;
  495::600     2e-20  45%  602 aa  LEPA_PELUB RecName: Full=GTP-binding protein lepA;
  494::598     4e-20  39%  598 aa  LEPA_ANAPZ RecName: Full=GTP-binding protein lepA;
  493::597     4e-20  43%  598 aa  LEPA2_RHOBA RecName: Full=GTP-binding protein lepA 2;
  492::592     7e-20  43%  599 aa  LEPA_HAMD5 RecName: Full=GTP-binding protein lepA;
  505::610     3e-19  40%  610 aa  LEPA_BUCAT RecName: Full=GTP-binding protein lepA;
  505::610     3e-19  40%  610 aa  LEPA_BUCAI RecName: Full=GTP-binding protein lepA;
  505::610     3e-19  40%  610 aa  LEPA_BUCA5 RecName: Full=GTP-binding protein lepA;
  496::597     4e-19  42%  601 aa  LEPA_BUCAP RecName: Full=GTP-binding protein lepA;
  492::592     6e-19  43%  597 aa  LEPA_PHOPR RecName: Full=GTP-binding protein lepA;
  499::602     6e-18  42%  606 aa  LEPA_SYNSC RecName: Full=GTP-binding protein lepA;
  499::602     6e-18  42%  606 aa  LEPA_SYNPX RecName: Full=GTP-binding protein lepA;
  492::592     8e-18  42%  597 aa  LEPA_VIBFM RecName: Full=GTP-binding protein lepA;
  499::603     1e-17  42%  604 aa  LEPA_SYNPW RecName: Full=GTP-binding protein lepA;
  492::595     1e-17  38%  595 aa  LEPA_BUCBP RecName: Full=GTP-binding protein lepA;
  499::602     2e-17  42%  604 aa  LEPA_SYNS3 RecName: Full=GTP-binding protein lepA;
  499::602     5e-17  41%  602 aa  LEPA_SYNS9 RecName: Full=GTP-binding protein lepA;
  543::643     9e-17  37%  645 aa  GUF1_YEAST RecName: Full=GTP-binding protein GUF1;AltName:
  493::596     2e-16  40%  598 aa  LEPA_SYNFM RecName: Full=GTP-binding protein lepA;
  493::596     1e-15  39%  598 aa  LEPA_SYNAS RecName: Full=GTP-binding protein lepA;
  494::594     5e-15  35%  598 aa  LEPA_EHRCJ RecName: Full=GTP-binding protein lepA;
  492::592     2e-14  37%  597 aa  LEPA_ALISL RecName: Full=GTP-binding protein lepA;
  493::593     4e-14  38%  596 aa  LEPA_BUCCC RecName: Full=GTP-binding protein lepA;
  494::594     4e-14  38%  595 aa  LEPA2_LACPL RecName: Full=GTP-binding protein lepA 2;
  540::643     1e-13  41%  645 aa  YO81_CAEEL RecName: Full=Uncharacterized GTP-binding protein
  492::559     3e-08  32%  599 aa  LEPA_WIGBR RecName: Full=GTP-binding protein lepA;
    1::106

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDAFSAIVHRDNAQWYGNKMTVKLKELIPRQQFEVPVQAAIGSKVIARENIRALRKDVLAKCYGGDISRK
LEPA_CORGL      VDAFSAIVHRDNAQWYGNKMTVKLKELIPRQQFEVPVQAAIGSKVIARENIRALRKDVLAKCYGGDISRK
LEPA_COREF      VDAFSAIVHRDNAQWYGNKMTVKLKSLIPRQQFEVPIQAAVGSRIIARENIRALRKDVLAKCYGGDISRK
LEPA_CORDI      VDAFSAIVHRDNAQWYGNKMTKKLKELIPRQQFEVPVQAAIGSKVIARENIRALRKDVLAKCYGGDISRK
LEPA_CORA7      VDAFSAIVHRDSAQWYGNKMTKKLKELIPRQQFEVPVQAAIGSKIIARENIRAMRKDVLAKCYGGDISRK
LEPA_CORJK      VDAFSAIVHRENAHWYGNKMTVKLKELIPRQQFEVPVQAAIGSKIIARENIRALRKDVLSKCYGGDVSRK
LEPA_CORU7      VDAFSAIVHRENAHYYGNKMAVKLKDLIPRQQFEVPIQAAIGSKIIARENIRALRKDVLAKCYGGDISRK
LEPA_MYCTU      VDAFSAIVHKDTAYAYGNKMTTKLKELIPRQQFEVPVQAAIGSKIIARENIRAIRKDVLSKCYGGDITRK
LEPA_MYCTA      VDAFSAIVHKDTAYAYGNKMTTKLKELIPRQQFEVPVQAAIGSKIIARENIRAIRKDVLSKCYGGDITRK
LEPA_MYCBT      VDAFSAIVHKDTAYAYGNKMTTKLKELIPRQQFEVPVQAAIGSKIIARENIRAIRKDVLSKCYGGDITRK
LEPA_MYCBP      VDAFSAIVHKDTAYAYGNKMTTKLKELIPRQQFEVPVQAAIGSKIIARENIRAIRKDVLSKCYGGDITRK
LEPA_MYCBO      VDAFSAIVHKDTAYAYGNKMTTKLKELIPRQQFEVPVQAAIGSKIIARENIRAIRKDVLSKCYGGDITRK
LEPA_MYCLE      VDAFSAIVHKDSASAYGNKMTNKLKELIPRQQFEVPVQAAIGSKVIARENIRAIRKDVLSKCYGGDITRK
LEPA_MYCLB      VDAFSAIVHKDSASAYGNKMTNKLKELIPRQQFEVPVQAAIGSKVIARENIRAIRKDVLSKCYGGDITRK
LEPA_NOCFA      VDAFSAIVHKDAAQAYGHKMTTKLRELIPRQQFEVPIQAAIGSKIIARENIRAIRKDVLAKCYGGDISRK
LEPA_MYCPA      VDAFSAIVHKDAAFAYGNKMTTKLKELIPRQQFEVPVQAAIGSKIIARENIRAIRKDVLSKCYGGDITRK
LEPA_THEFY      VDAFSAIVHRDNAYSYGAEMTKKLRELIPRQQFEVPIQAAIGSRVIARENIRALRKDVLAKCYGGDISRK
LEPA_BIFA0      IDAFSAIVHRDKAYSYGVMMTKKLRELIPRQQFEIPIQAAIGSRIIARENIRALRKDVLAKCYGGDITRK
LEPA_BIFLO      VDAFSAIVHRDKAYSYGVMMTKKLRSLIPRQQFEIPIQAAIGSRIIARENIRALRKDVLAKCYGGDITRK
LEPA_BIFLI      VDAFSAIVHRDKAYSYGVMMTKKLRSLIPRQQFEIPIQAAIGSRIIARENIRALRKDVLAKCYGGDITRK
LEPA_BIFLD      VDAFSAIVHRDKAYSYGVMMTKKLRSLIPRQQFEIPIQAAIGSRIIARENIRALRKDVLAKCYGGDITRK
LEPA_RHOSR      VDAFSSIVHRSAAGAYGGRMTSKLRELIPRQQFEVPIQAAIGSKIISRENIRAIRKDVLAKCYGGDISRK
LEPA_RHOOB      VDAFSSIVHRSAAGAYGGRMTSKLRELIPRQQFEVPIQAAIGSKIISRENIRAIRKDVLAKCYGGDISRK
LEPA_PROAC      VDALSSIVHRDKSYSYGVAMAAKLKELIPRQQFEVPVQAAIGARVIARETIRAVRKDVLAKCYGGDISRK
LEPA_STRGG      VDAFSAVTHKDKAYAYGVRLVAKLQKLIPRQNFEVPIQAAIGARVIARETVRAIRKDVLAKCYGGDISRK
LEPA_STRCO      VDAFSAITHKDAAYAYGVRLVAKLRELIPRQAFEVPIQAAIGSRVIARETIRAIRKDVLAKCYGGDISRK
LEPA_STRAW      VDAFSAITHKDAAYAYGVRLVAKLRELIPRQAFEVPIQAAIGSRVIARETIRAIRKDVLAKCYGGDISRK
LEPA_MYCSS      VDAFSAIVHKDGASAYGNKMTTKLKELIPRQQFEVPVQAAVGSXXXXXXXXXXXXKDVLSKCYGGDITRK
LEPA_MYCSK      VDAFSAIVHKDGASAYGNKMTTKLKELIPRQQFEVPVQAAVGSXXXXXXXXXXXXKDVLSKCYGGDITRK
LEPA_MYCSJ      VDAFSAIVHKDGASAYGNKMTTKLKELIPRQQFEVPVQAAVGSXXXXXXXXXXXXKDVLSKCYGGDITRK
LEPA_KINRD      VDAFSQIVHREKAYGYGVMMAGKLKDLIPRQQFEVPIQAAIGARVIARENVRAIRKDVLAKCYGGDITRK
LEPA_HELMI      IDAFSIIVHRDRAYNRGRALADKLKDLIPRQMFEVPIQAVIGNKVIARETIKAIRKNVLAKCYGGDISRK
LEPA_GEOKA      IDALSFIVHRDSAYERGKAIVEKLKDLIPRQQFEVPVQAAIGNKVIARSTIKALRKNVLAKCYGGDVSRK
LEPA_GEOTN      IDALSFIVHRDSAYERGKVIVEKLKDLIPRQQFEVPVQAAIGNKIIARSTIKALRKNVLAKCYGGDVSRK
LEPA_BACHD      VDALSVIVHRDSAYERGKQIVEKLKELIPRQQFEVPVQASIGTKIIARSTIKAMRKNVLAKCYGGDISRK
LEPA_GEOMG      VDALSLIIHRDKAYYRGRDLVSKMKELIPRQMFEVAIQAAIGAKVIARETVKALRKDVLAKCYGGDITRK
LEPA_ANOFW      VDALSFIVHRDSAYDRGKVIVEKLKDLIPRQQFEVPVQAAIGNKIIARSTIKALRKNVLAKCYGGDISRK
LEPA_GEOSL      VDALSLIIHRDKAYYRGRDLVSKMKELIPRQMFEVVIQAAIGAKVIARETVKALRKDVLAKCYGGDITRK
LEPA_BACCN      VDALSFIVHRDSAYDRGKVIVEKLKELIPRQQFEVPIQAAIGNKIVARSTIKAMRKNVLAKCYGGDISRK
LEPA_SYMTH      VDALSCIVHREKAQKLGRALVQKLRKLIPRHLFEVPIQAAVGNKILARENIAPLRKDVLAKCYGGDVTRK
LEPA_STRZT      VDALSFIVHKDFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGHKIVARTDIKALRKNVLAKCYGGDVSRK
LEPA_STRZP      VDALSFIVHKDFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGHKIVARTDIKALRKNVLAKCYGGDVSRK
LEPA_STRZJ      VDALSFIVHKDFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGHKIVARTDIKALRKNVLAKCYGGDVSRK
LEPA_STRR6      VDALSFIVHKDFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGHKIVARTDIKALRKNVLAKCYGGDVSRK
LEPA_STRPN      VDALSFIVHKDFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGHKIVARTDIKALRKNVLAKCYGGDVSRK
LEPA_STRPJ      VDALSFIVHKDFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGHKIVARTDIKALRKNVLAKCYGGDVSRK
LEPA_STRPI      VDALSFIVHKDFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGHKIVARTDIKALRKNVLAKCYGGDVSRK
LEPA_STRP7      VDALSFIVHKDFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGHKIVARTDIKALRKNVLAKCYGGDVSRK
LEPA_STRP4      VDALSFIVHKDFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGHKIVARTDIKALRKNVLAKCYGGDVSRK
LEPA_STRP2      VDALSFIVHKDFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGHKIVARTDIKALRKNVLAKCYGGDVSRK
LEPA_CLOBM      VDALSMIVPRERAYAKGRNMAQKLKEIIPRQMFEIPIQAAVGAKIIARETIKAMRKDVLAKCYGGDISRK
LEPA_CLOBL      VDALSMIVPRERAYAKGRNMAQKLKEIIPRQMFEIPIQAAVGAKIIARETIKAMRKDVLAKCYGGDISRK
LEPA_CLOBK      VDALSMIVPRERAYAKGRNMAQKLKEIIPRQMFEIPIQAAVGAKIIARETIKAMRKDVLAKCYGGDISRK
LEPA_CLOBJ      VDALSMIVPRERAYAKGRNMAQKLKEIIPRQMFEIPIQAAVGAKIIARETIKAMRKDVLAKCYGGDISRK
LEPA_CLOBH      VDALSMIVPRERAYAKGRNMAQKLKEIIPRQMFEIPIQAAVGAKIIARETIKAMRKDVLAKCYGGDISRK
LEPA_CLOB6      VDALSMIVPRERAYAKGRNMAQKLKEIIPRQMFEIPIQAAVGAKIIARETIKAMRKDVLAKCYGGDISRK
LEPA_CLOB1      VDALSMIVPRERAYAKGRNMAQKLKEIIPRQMFEIPIQAAVGAKIIARETIKAMRKDVLAKCYGGDISRK
LEPA_BACLD      IDALSFIVHRDYAYERGKVIVEKLKELIPRQQFEVPVQAAIGTKIVARSTIKAMRKNVLAKCYGGDISRK
LEPA_STRU0      VDALSFIVHREFAYERGKLIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRK
LEPA_BACSU      IDALSFIVHRDYAYERGKVIVEKLKELIPRQQFEVPVQAAIGQKIVARSTIKAMRKNVLAKCYGGDISRK
LEPA_LACLS      VDALSFIVHKDFAFERGKVIVEKLKKLIPRQQFEVPIQATIGNKIVARSDIKALRKNVLAKCYGGDISRK
LEPA_LACLM      VDALSFIVHKDFAFERGKVIVEKLKKLIPRQQFEVPIQATIGNKIVARSDIKALRKNVLAKCYGGDISRK
LEPA_LACLA      VDALSFIVHKDFAFERGKVIVEKLKKLIPRQQFEVPIQATIGNKIVARSDIKALRKNVLAKCYGGDISRK
LEPA_JANMA      VDALAIIVHRANSQYRGRAVAAKMRELIPRQMFDVAIQAAIGANIISRENVKALRKNVLAKCYGGDISRK
LEPA_ENTFA      VDALSFIVHRDFAFERGKAIVEKLKKLIPRQQFEVPVQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRK
LEPA_BACSK      VDALSVIVHRDSAYERGKVIVEKLKELIPRQQFEVPVQASIGTKIIARSTIKAIRKNVLAKCYGGDISRK
LEPA_BACHK      VDALSFIVHRDSAYDRGKVIVEKLKELIPRQQFEVPIQATIGNKVVARSTIKAMRKNVLAKCYGGDISRK
LEPA_BACCZ      VDALSFIVHRDSAYDRGKVIVEKLKELIPRQQFEVPIQATIGNKVVARSTIKAMRKNVLAKCYGGDISRK
LEPA_BACCQ      VDALSFIVHRDSAYDRGKVIVEKLKELIPRQQFEVPIQATIGNKVVARSTIKAMRKNVLAKCYGGDISRK
LEPA_BACC7      VDALSFIVHRDSAYDRGKVIVEKLKELIPRQQFEVPIQATIGNKVVARSTIKAMRKNVLAKCYGGDISRK
LEPA_BACC4      VDALSFIVHRDSAYDRGKVIVEKLKELIPRQQFEVPIQATIGNKVVARSTIKAMRKNVLAKCYGGDISRK
LEPA_BACC3      VDALSFIVHRDSAYDRGKVIVEKLKELIPRQQFEVPIQATIGNKVVARSTIKAMRKNVLAKCYGGDISRK
LEPA_BACC2      VDALSFIVHRDSAYDRGKVIVEKLKELIPRQQFEVPIQATIGNKVVARSTIKAMRKNVLAKCYGGDISRK
LEPA_BACC1      VDALSFIVHRDSAYDRGKVIVEKLKELIPRQQFEVPIQATIGNKVVARSTIKAMRKNVLAKCYGGDISRK
LEPA_BACC0      VDALSFIVHRDSAYDRGKVIVEKLKELIPRQQFEVPIQATIGNKVVARSTIKAMRKNVLAKCYGGDISRK
LEPA_BACAN      VDALSFIVHRDSAYDRGKVIVEKLKELIPRQQFEVPIQATIGNKVVARSTIKAMRKNVLAKCYGGDISRK
LEPA_BACAH      VDALSFIVHRDSAYDRGKVIVEKLKELIPRQQFEVPIQATIGNKVVARSTIKAMRKNVLAKCYGGDISRK
LEPA_BACAC      VDALSFIVHRDSAYDRGKVIVEKLKELIPRQQFEVPIQATIGNKVVARSTIKAMRKNVLAKCYGGDISRK
LEPA_BACAA      VDALSFIVHRDSAYDRGKVIVEKLKELIPRQQFEVPIQATIGNKVVARSTIKAMRKNVLAKCYGGDISRK
LEPA_STRTD      VDALSFIVHREFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGQKIVARTDIKALRKNVLAKCYGGDVSRK
LEPA_STRT2      VDALSFIVHREFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGQKIVARTDIKALRKNVLAKCYGGDVSRK
LEPA_STRT1      VDALSFIVHREFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGQKIVARTDIKALRKNVLAKCYGGDVSRK
LEPA_EXIS2      VDALSFIVHRDFAYERGKVIVDKLKELIPRMQFEVPIQAAVGTKIVARSTIKALRKNVLAKCYGGDISRK
LEPA_STRMU      VDALSFIVHKEFAYERGKLIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRK
LEPA_STREM      VDALSFIVHREFAYERGKLIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRK
LEPA_STRP8      VDALSFIVHKEFAYERGKIIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRK
LEPA_STRP6      VDALSFIVHKEFAYERGKIIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRK
LEPA_LISW6      VDALSFIVHRDFAYERGKIIVEKLKELIPRQQFEVPIQAAIATKIVSRSTIKALRKNVLAKCYGGDVSRK
LEPA_LISMO      VDALSFIVHRDFAYERGKIIVEKLKELIPRQQFEVPIQAAIATKIVSRSTIKALRKNVLAKCYGGDVSRK
LEPA_LISMH      VDALSFIVHRDFAYERGKIIVEKLKELIPRQQFEVPIQAAIATKIVSRSTIKALRKNVLAKCYGGDVSRK
LEPA_LISMF      VDALSFIVHRDFAYERGKIIVEKLKELIPRQQFEVPIQAAIATKIVSRSTIKALRKNVLAKCYGGDVSRK
LEPA_LISMC      VDALSFIVHRDFAYERGKIIVEKLKELIPRQQFEVPIQAAIATKIVSRSTIKALRKNVLAKCYGGDVSRK
LEPA_LISIN      VDALSFIVHRDFAYERGKIIVEKLKELIPRQQFEVPIQAAIATKIVSRSTIKALRKNVLAKCYGGDVSRK
LEPA_ACAM1      VDSLAAIVHRDKAYYTGRALVSKLRELIPRHQFKIPIQAAIGAKVIASESIPALRKDVLAKCYGGDVSRK
LEPA_STRSY      VDALSFIVHKEFAYERGKIIVDKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRK
LEPA_STRS2      VDALSFIVHKEFAYERGKIIVDKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRK
LEPA_STRGC      VDALSFIVHKEFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGQKIVARTDIKALRKNVLAKCYGGDVSRK
LEPA_SORC5      LDALSVIVHRDKAYARGRDLAVKLKDIVPRQQYEVAIQAAIGSKVIARTTVKAMRKDVTAKCYGGDISRK
LEPA_RUBXD      VDSLSIIVHRDKAYQRGRALVEKLKELIPRQQFEVPVQAAVGKRVIARETVRAYRKDVTAKCYGGDITRK
LEPA_GEOSM      VDALSLIIHKDKAYYRGRELVSKMKELIPRQMFEIAIQAAVGTKVIARETVKAMRKDVLAKCYGGDITRK
LEPA_GEOLS      VDALSLILHRDKAYFRGRDLVSKMKELISRQMFEVAIQAAIGSKIIARETVKAMRKDVLAKCYGGDITRK
LEPA_GEOBB      VDALSLIIHKDKAYYRGRELVSKMKELIPRQMFEIAIQAAVGTKVIARETVKAMRKDVLAKCYGGDITRK
LEPA_BACP2      IDALSFIVHRDYAYERGKIIVDKLKELIPRQHFEVPIQAAIGQKIVARSTIKAMRKNVLAKCYGGDISRK
LEPA_PELCD      VDALSLIVHRDKSQMRGRELVAKMKEFIPRQQYEVAVQAAIGNKVVARANVKALRKDVTAKCYGGDITRK
LEPA_OCEIH      IDALSFVVHRDFAYERGKQIVEKLKELIPRQQFEVPVQAAIGNKIVARSNIKAVRKDVTAKLYGGDITRK
LEPA_FRASC      VDAFSAIVHREKAYAYGVSMTTKLRELIPRQQFEVPIQAAIGSXXXXXXXXXXXXKDVLAKCYGGDITRK
LEPA_EXISA      VDALSFIVHRDFAYERGKVIVEKLKALIPRMQFEVPVQAAVGTKIVARSTIKALRKNVLAKCYGGDISRK
LEPA_BACA2      IDALSFIVHRDYAYERGKVIVEKLKELIPRQHFEVPIQAAIGQKIVARSTIKAMRKNVLAKCYGGDISRK
LEPA_SYNJB      VDSLSTIVHRDKAFYVGRSLVAKLRELIPRHQFEVPIQAAIGSKVIARETIPALRKNVLAKCYGGDVTRK
LEPA_SYNJA      VDSLSTIVHRDKAFYVGRSLVAKLRELIPRHQFEVPIQAAIGSRVIARETIPALRKNVLAKCYGGDVTRK
LEPA_STRS7      VDALSFIVHRAFAYERGKLIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRK
LEPA_STRPZ      VDALSFIVHKEFAYERGKIIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRK
LEPA_STRPM      VDALSFIVHKEFAYERGKIIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRK
LEPA_STRPD      VDALSFIVHKEFAYERGKIIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRK
LEPA_STRPC      VDALSFIVHKEFAYERGKIIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRK
LEPA_STRPB      VDALSFIVHKEFAYERGKIIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRK
LEPA_STRP3      VDALSFIVHKEFAYERGKIIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRK
LEPA_STRP1      VDALSFIVHKEFAYERGKIIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRK
LEPA_STRE4      VDALSFIVHRAFAYERGKLIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRK
LEPA_STRA5      VDALSFIVHKEFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRK
LEPA_STRA3      VDALSFIVHKEFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRK
LEPA_STRA1      VDALSFIVHKEFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRK
LEPA_GEOUR      VDALSLIIHKDKAYFRGRDLVSKMKELIPRQMFEIAIQAAIGNKVIARETVKAMRKDVLAKCYGGDITRK
LEPA_DESRM      LDALSCIVHSERAYTRGRALVEKLRSLIPRQMFEIPVQAAIGNKIIARETVKAMRKDVLAKCYGGDISRK
LEPA_CLOAB      VDALSMIVPKDRAYAKGRTMAEKLKEIIPRQLFEIPIQAAVGSKIIARETVKALRKDVLAKCYGGDISRK
LEPA_BACCR      VDALSFIVHRDSAYDRGKVIVEKLKELIPRQQFEVPIQATIGNKVVARSTIKAMRKNVLAKCYGGDISRK
LEPA_ALHEH      VDALAVIVHRDQAQSRGRELTDKLKEIIPRQMFEVAIQAAIGNHVIARSTVKALRKNVTAKCYGGDISRK
LEPA_PELPD      VDALSLILHRDKAYYRGRDLVSKMKELIPRQMFEVAIQAAIGNKIIARETVKAMRKDVLAKCYGGDITRK
LEPA_GEOSF      VDALSLIIHKEKAYYRGRDLVSKMKELIPRQMFEIAIQAAIGNKVIARETVKALRKDVLAKCYGGDITRK
LEPA_BACWK      VDALSFIVHRDSAYDRGKVIVEKLKKLIPRQQFEVPIQATIGNKVVSRSTIKAMRKNVLAKCYGGDISRK
LEPA_POLSQ      VDALSVIVHRSNSQHRGREVVAKMRGIIPRQMFDVAIQAAIGSNIVARENVKALRKNVLAKCYGGDISRK
LEPA_POLNS      VDALSVIVHRSNSQSRGREVVAKMRDIIPRQMFDVAIQAAIGSNIVARENVKALRKNVLAKCYGGDISRK
LEPA_FRAAA      VDAFSAIVHKEKAYSYGVAMTTKLRELIPRQQFEVPIQAAIGSXXXXXXXXXXXXKDVLAKCYGGDITRK
LEPA_NITMU      VDALSLIVHRASSQYRGRELAQKMRELIPRQMFDIAVQAAIGSHIIARESIKALRKNVLAKCYGGDITRK
LEPA_MICLC      VDAFSSITHRDNAYAYGVMMTGKLKELIPRQQYEVPIQAAIGSXXXXXXXXXXXXKDVLSKCYGGDISRK
LEPA_CHLTE      VDALSSIVHRSKSYEWGRKLCQKLKGIIPRQMYEVAIQAAIGSRVIARESISAMRKNVLAKCYGGDISRK
LEPA_AZOVD      VDALALIVHRDKAHQKGRALTEKMKELIPRQMFDVAIQAAIGGQVVARTTVKALRKNVLAKCYGGDVTRK
LEPA_PELTS      LDALSVIVHRDKAYQRGRHLVEKLRGLIPRHLFEIPIQAAVGNRIIARETVKAIRKDVLAKCYGGDVTRK
LEPA_ORITI      VDALSTIVHRSKAEFRGRELCKRLKDLIPAHLFQIAIQAAIGSRIIARETIRALRKDVLAKCYGGDITRK
LEPA_ORITB      VDALSTIVHRSKAEFRGRELCKRLKDLIPAHLFQIAIQAAIGSRIIARETIRALRKDVLAKCYGGDITRK
LEPA_MACCJ      VDALSFIVHRDFAYDRGKVIVEKLKTLIPRQQFEVPVQAAIGQKIIARTNIKSIGKNVLAKCYGGDISRK
LEPA_LAWIP      VDALAVIVHRDKAYHYGRSLAIKLKKTIPRQMFEVAIQAAIGQKVIARESISALRKNVTAKCYGGDITRK
LEPA_ACIC5      VDALSIIVHRDFAYERGRALVSKMRELIPRQQFEVAIQAAIGSKIIARETVAALRKNVIAKCYGGDISRK
LEPA_THEEB      VDSLAAIVHRDKAYHVGRALVSKLKDLIPRHQFKIPIQAAIGSRVIASESIPALRKDVLAKCYGGDVTRK
LEPA_CHLP8      VDALSSIVHRSKSYEWGRKLCSKLKGIIPRQMYEVAIQAAIGSRVIARETISAMRKNVLAKCYGGDISRK
LEPA_CLOCE      VDALSFIVHREKSVARGRRMAEKLKESIPRQMFEIPIQACIGGKIIARETVKAFRKDVLSKCYGGDISRK
LEPA_CHLPB      VDALSTIVHRSKAYEWGRRLCQKLKSIIPRQMYEVAIQAAIGSRVIARETISAMRKNVLAKCYGGDISRK
LEPA_PROA2      VDALSTVVHRSKAYEWGRKLCQKLKTIIPKQMYEVAIQAAIGSRVISRETISAIRKNVLAKCYGGDISRK
LEPA_DESHY      VDALSFIVHKEKSYARGRRLVEKLRGIIPRQMFEVPIQAVIGQKVVARETVKAMRKDVLAKCYGGDISRK
LEPA_DESHD      VDALSFIVHKEKSYARGRRLVEKLRGIIPRQMFEVPIQAVIGQKVVARETVKAMRKDVLAKCYGGDISRK
LEPA_ACIBL      VDALSTIVHKDFAYDRGRALVSKMRELIPRQMFEVPIQAAIGAKIIARETVAAMRKNVLAKCYGGDISRK
LEPA_CHLPD      VDALSIIVHRSKAYEWGRKLCTKLKGIIPKQMYEVAIQAAIGSRVISRETISAMRKNVLAKCYGGDISRK
LEPA_RICRS      VDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASIGSRIIARETIKALRKDVLSKCYGGDISRK
LEPA_RICRO      VDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASIGSRIIARETIKALRKDVLSKCYGGDISRK
LEPA_RICPU      VDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASIGSRIIARETIKALRKDVLSKCYGGDISRK
LEPA_RICFE      VDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASIGSRIIARETIKALRKDVLSKCYGGDISRK
LEPA_RICCN      VDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASIGSRIIARETIKALRKDVLSKCYGGDISRK
LEPA_RICAE      VDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASIGSRIIARETIKALRKDVLSKCYGGDISRK
LEPA_NITEU      VDALSLIVHRASSQHRGRELAQKMRELIPRQMFDIAVQAAIGAHIVARENVKALRKNVLAKCYGGDITRK
LEPA_NITEC      VDALSLIVHRASSQQRGRELAQKMRELIPRQMFDIAVQAAIGAHIVARENVKALRKNVLAKCYGGDITRK
LEPA_CLOPH      VDALSFIVHGESAYERGRRMCEKLKDEIPRHLFEIPIQAAVGSKVIARETVKAMRKDVLAKCYGGDISRK
LEPA_CHLL2      VDALSIIVHRSKAYEWGRKLCQKLKGIIPKQMYEVAIQAAIGSRVISRETISAMRKNVLAKCYGGDISRK
LEPA_RICAH      IDALSTIVHRSRAEQRGKVLCVRLKDLIPRQQIDIAIQASIGSRIIARETIKALRKDVLSKCYGGDISRK
LEPA_METPB      VDALSMLVHRTRAESRGRAMCEKLKDLIPRHLFQIPVQAAIGGKIIARETIRALSKDVTAKCYGGDISRK
LEPA_METC4      VDALSMLVHRTRAESRGRAMCEKLKDLIPRHLFQIPVQAAIGGKIIARETIRALSKDVTAKCYGGDISRK
LEPA_LACCB      VDALSTIVHKDFAYERGKAIVARLKTTIPRQQFEIPIQAAIGNKVIARSTVKAYRKNVLAKCYGGDITRK
LEPA_LACC3      VDALSTIVHKDFAYERGKAIVARLKTTIPRQQFEIPIQAAIGNKVIARSTVKAYRKNVLAKCYGGDITRK
LEPA_CHLCH      VDALSIIVHRSKAYEWGKKLCQKLKGIIPKQMYEVAIQAAIGSRIISRETISAMRKNVLAKCYGGDISRK
LEPA_STAAT      VDALSFIVHRDFAYERGKALVEKLKTLIPRQQFEVPVQAAIGQKIVARTNIKSMGKNVLAKCYGGDISRK
LEPA_STAAS      VDALSFIVHRDFAYERGKALVEKLKTLIPRQQFEVPVQAAIGQKIVARTNIKSMGKNVLAKCYGGDISRK
LEPA_STAAR      VDALSFIVHRDFAYERGKALVEKLKTLIPRQQFEVPVQAAIGQKIVARTNIKSMGKNVLAKCYGGDISRK
LEPA_STAAN      VDALSFIVHRDFAYERGKALVEKLKTLIPRQQFEVPVQAAIGQKIVARTNIKSMGKNVLAKCYGGDISRK
LEPA_STAAM      VDALSFIVHRDFAYERGKALVEKLKTLIPRQQFEVPVQAAIGQKIVARTNIKSMGKNVLAKCYGGDISRK
LEPA_STAAE      VDALSFIVHRDFAYERGKALVEKLKTLIPRQQFEVPVQAAIGQKIVARTNIKSMGKNVLAKCYGGDISRK
LEPA_STAAC      VDALSFIVHRDFAYERGKALVEKLKTLIPRQQFEVPVQAAIGQKIVARTNIKSMGKNVLAKCYGGDISRK
LEPA_STAAB      VDALSFIVHRDFAYERGKALVEKLKTLIPRQQFEVPVQAAIGQKIVARTNIKSMGKNVLAKCYGGDISRK
LEPA_STAA9      VDALSFIVHRDFAYERGKALVEKLKTLIPRQQFEVPVQAAIGQKIVARTNIKSMGKNVLAKCYGGDISRK
LEPA_STAA8      VDALSFIVHRDFAYERGKALVEKLKTLIPRQQFEVPVQAAIGQKIVARTNIKSMGKNVLAKCYGGDISRK
LEPA_STAA3      VDALSFIVHRDFAYERGKALVEKLKTLIPRQQFEVPVQAAIGQKIVARTNIKSMGKNVLAKCYGGDISRK
LEPA_STAA2      VDALSFIVHRDFAYERGKALVEKLKTLIPRQQFEVPVQAAIGQKIVARTNIKSMGKNVLAKCYGGDISRK
LEPA_STAA1      VDALSFIVHRDFAYERGKALVEKLKTLIPRQQFEVPVQAAIGQKIVARTNIKSMGKNVLAKCYGGDISRK
LEPA_METS4      VDALSMLVHRTRAESRGRAMCEKLKDLIPRHLFQIPVQAAIGGKIIARETIRALSKDVTAKCYGGDISRK
LEPA_METNO      VDALSMLVHRTRAESRGRAMCEKLKDLIPRHLFQIPVQAAIGGKIIARETIRALSKDVTAKCYGGDISRK
LEPA_LACSS      VDALSFIVHRDFAFERSRVIVGKLKETIPRQQFEVPIQAAIGNKIIARSTVKAFRKNVLAKCYGGDITRK
LEPA_CLONN      VDALSMIVPEERAYNKGRAIAEKLKEVIPRQMFEIPIQAAVGAKIIARETVKAMRKDVLAKCYGGDISRK
LEPA_ANASK      VDALSVIVHRERAYQRGRDLCQRLREVIPKQMYEVAIQAAIGAKVIARETVKAFRKNVLAKCYGGDISRK
LEPA_ANADE      VDALSVIVHRERAYQRGRDLCQRLREVIPKQMYEVAIQAAIGAKVIARETVKAFRKNVLAKCYGGDISRK
LEPA_ANAD2      VDALSVIVHRERAYQRGRDLCQRLREVIPKQMYEVAIQAAIGAKVIARETVKAFRKNVLAKCYGGDISRK
LEPA_STAAW      VDALSFIVHRDFAYERGKALVEKLKTLIPRQQFEVPVQAAIGQKIVARTNIKSMGKNVLAKCYGGDISRK
LEPA_RICB8      VDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASIGSRIIARETIKALRKDVLSKCYGGDITRK
LEPA_PELLD      VDALSIIVHRSKAYDWGRKLCGKLKGIIPKQMYEVAIQAAIGSRIISRETISAMRKNVLAKCYGGDISRK
LEPA_MYXXD      VDALSVIVHRERAYLRGREVCQKLKEVIPKQMYEVAIQAAIGAKIISRETISAIRKNVLAKCYGGDISRK
LEPA_MAGSM      VDALSVIVHRNISQYRGRELAKKMKELIHRQMFDVAVQACIGGKIIARETVKALRKNVTAKCYGGDITRK
LEPA_KOCRD      VDAFSAITHKDKAYSYGVLMTGKLQKLIPRQQYEVPIQAAIGSXXXXXXXXXXXXKDVLSKCYGGDISRK
LEPA_STAHJ      VDALSFIVHKDFAYERGKALVEKLKTLIPRQQFEVPVQAAIGQKIVARTNIKSMGKNVLSKCYGGDISRK
LEPA_STAES      VDALSFIVHRDFAYERGKALVEKLKTLIPRQQFEVPVQAAIGQKIVARTNIKSMGKNVLSKCYGGDISRK
LEPA_STAEQ      VDALSFIVHRDFAYERGKALVEKLKTLIPRQQFEVPVQAAIGQKIVARTNIKSMGKNVLSKCYGGDISRK
LEPA_PROVI      VDALSIIVHRSKAYDWGRKLCGKLKGIIPKQMYEVAIQAAIGSRIISRETISAMRKNVLAKCYGGDISRK
LEPA_HYPNA      VDALAMLVHRDRAESRGRQMCERLKELIPRQMFKIPIQAAIGGRVVARETISAMRKDVTAKCYGGDATRK
LEPA_DESVH      VDALAVIVHRDKAYHYGRALALKLKRTIPRQLFEVAIQAAIGQKVIARETISAMRKNVTAKCYGGDITRK
LEPA_TROWT      VDAFSAIVHXXXXXXXXXXXXXRLSELIPRQQFEVPIQAAIGSRVVARETIRAVRKDVVAKCYGGDITRK
LEPA_FINM2      VDALTIIVHEDLAYERARKIVTKLKDEIPRHQFVIPVQAAIGNKIIARETIKAYRKDVLAKCYGGDITRK
LEPA_CLOK5      VDALSMIVPEERAYDRGRGIAEKLKGIIPRQLFEIPIQAAVGGKVIARETVKAMRKDVLAKCYGGDISRK
LEPA_MOOTA      VDALSLITHRDQAYQRGRALVERLRQLIPRQLFDVPIQAAIGSRVIARETIPALRKNVLAKCYGGDVTRK
LEPA_LEGPL      VDALAVIVHRDSAHSRGKLIAEKMQQLIPRQMFDVAIQAAIGSHIIARQTVKALRKNVTAKCYGGDVTRK
LEPA_LEGPH      VDALAVIVHRDSAHSRGKLIAEKMQQLIPRQMFDVAIQAAIGSHIIARQTVKALRKNVTAKCYGGDVTRK
LEPA_LEGPC      VDALAVIVHRDSAHSRGKLIAEKMQQLIPRQMFDVAIQAAIGSHIIARQTVKALRKNVTAKCYGGDVTRK
LEPA_LEGPA      VDALAVIVHRDSAHSRGKLIAEKMQQLIPRQMFDVAIQAAIGSHIIARQTVKALRKNVTAKCYGGDVTRK
LEPA_TROW8      VDAFSAIVHXXXXXXXXXXXXXRLSELIPRQQFEVPIQAAIGSRVVARETIRAVRKDVVAKCYGGDITRK
LEPA_RHOCS      VDALAMIVHRTQAEYRGRQLCERLKDLIPRHLFKIPIQAAIGGRVIARETIAALRKDVLAKCYGGDISRK
LEPA_NITOC      VDALSLIVHRNQAHYRGRELAEKMRELIPRQLFDVAIQAAIGAHIVARTTVKALRKNVTAKCYGGDITRK
LEPA_METCA      VDALSLIVHRDISMNRGRDLVERMKDLIPRQMFEVAIQAAIGSKIIARSTVKAMRKNVLAKCYGGDITRK
LEPA_DESDG      VDALACIVHRDKAYYQGRAIALRLKRTIPRQMFEVVVQAAIGNKIIARERNAPLRKNVTAKCYGGDITRK
LEPA_STACT      VDALSFIVHKEFAYERGKALVERLKTLIPRQQFEVPVQAAVGQKIVARTNIKSMGKNVLSKCYGGDISRK
LEPA_RHIME      VDALSMMVHRMAAEKRGREMCEKLKELIPKHMFKIPIQAAIGGNVIARETISALRKDVTAKCYGGDATRK
LEPA_STAS1      VDALSFIVHKEFAYERGKTLVDKLKTLIPRQQFEVPVQAAVGQKIVARTNIKSMGKNVLSKCYGGDITRK
LEPA_AGRT5      VDALSMLVHRSAADRRGRGMCEKLKELIPPHMFQIPIQAAIGGKVIARETVRALRKDVTAKCYGGDATRK
LEPA_RICCK      VDALSTIVHRSRAEQTGRALCVRLKDLIPIQQIDIVIQASIGSRIIARETIKALRKDVLSKCYGGDITRK
LEPA_RHILW      VDALSMMVHRTAAEKRGRDMCEKLKELIPKHMFKIPIQAAIGGNVIARETISALRKDVTAKCYGGDATRK
LEPA_RHIL3      VDALSMMVHRTAAEKRGRDMCEKLKELIPKHMFKIPIQAAIGGNVIARETISALRKDVTAKCYGGDATRK
LEPA_RHIE6      VDALSMMVHRTAAEKRGRDMCEKLKELIPKHMFKIPIQAAIGGNVIARETISALRKDVTAKCYGGDATRK
LEPA_BARQU      IDALSMLVHRTVAEKRGRSMCEKLKDLIPQHMFQIPIQAAIGGKIIARETIRALRKDVTAKCYGGDVTRK
LEPA_ARTCA      VDAFSAITHREKAYAYGVMMTGKLRELIPRQQFEVPIQXXXXXXXXXXXXXXXXXKDVLAKCYGGDISRK
LEPA1_LACPL     VDALSFIAHRDFAPARGREIAAKLKTIIPRQNFEIPVQATIGSKVIARTNIKAYRKDVTAHLYGGDRTRR
LEPA_RHOFD      VDALSIIVHRSQSQYRGRAVVSKMREIISRQMYDVAIQAAIGSNVIARETIKAMRKNVIAKCYGGDISRK
LEPA_ARTS2      VDAFSAITHRDKAYAYGVMMTGKLRELIPRQQFEVPIQXXXXXXXXXXXXXXXXXKDVLAKCYGGDITRK
LEPA_ARTAT      VDAFSAITHRDKAYAYGVMMTGKLRELIPRQQFEVPIQXXXXXXXXXXXXXXXXXKDVLAKCYGGDITRK
LEPA_RHILO      VDALSMLVHRTAAEKRGRQMCEKLKELIPHHLFKIPIQAAIGGKVIARETISALRKDVTAKCYGGDVSRK
LEPA_CHRSD      VDALATIVHRDHAHPRGRALVEKMKELIPRQMFDVAIQATLGGQVVARSTVKALRKNVTAKCYGGDVTRK
LEPA_BARHE      IDALSMLVHRTIAEKRGRSLCEKLKDLIPQHMFQIPIQAAIGGKIIARETIRALRKDVTAKCYGGDVTRK
LEPA_NITSB      VDALSIIVPKEKAQYKGRELVKKMKELVPRQLFEVAIQASIGNKIIARETVSAMRKNVTAKCYGGDITRK
LEPA_GRABC      VDALSFIAHRSAAENRGRQICAKLKELIPRQLFKIAIQAAIGSRIIARETLGALSKDVTAKCYGGDISRK
LEPA_GLUDA      VDALAFIAHRSAAESRGRSICAKLKELIPRQLFKIAIQAAIGSRVIARETIGALSKDVTAKCYGGDISRK
LEPA_ACIF5      LDALSWIVHRDVSXXXXXXXXXXXXDLIPRQMFEVAIQAAIGARVIARESVKALRKNVLAKCYGGDISRK
LEPA_ACIF2      LDALSWIVHRDVSXXXXXXXXXXXXDLIPRQMFEVAIQAAIGARVIARESVKALRKNVLAKCYGGDISRK
LEPA_OCHA4      VDALSMLVHRSAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRIVARETISALRKDVTAKCYGGDVTRK
LEPA_BRUSU      VDALSMLVHRSAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRIVARETISALRKDVTAKCYGGDVTRK
LEPA_BRUSI      VDALSMLVHRSAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRIVARETISALRKDVTAKCYGGDVTRK
LEPA_BRUO2      VDALSMLVHRSAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRIVARETISALRKDVTAKCYGGDVTRK
LEPA_BRUC2      VDALSMLVHRSAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRIVARETISALRKDVTAKCYGGDVTRK
LEPA_SPHWW      VDALSMIVHRAAAEARGRHMCERLKDLIPRHLFKIPVQAAIGGKVIARETIAAMRKDVTAKCYGGDATRK
LEPA_SOLUE      VDALSIIVHKDFAFERGKALISRLRKLIPKQMFEVALQAAIGNKIVARETISAMRKNVIAKCYGGDISRK
LEPA_RHIEC      VDALSMLVHRTAAEKRGRDMCERLKELIPKHMFKIPIQAAIGGNVIARETISALRKDVTAKCYGGDATRK
LEPA_PELPB      VDALSIVVHRSKAYDWGXXXXXXXXGIIPKQMYEVAIQAAIGSKVISRETISAMRKNVLAKCYGGDISRK
LEPA_DESAP      LDALSIIVHRDRAYHRSKIIVERLRDLIPRQLFEIVIQAAIGQRVIARESIRALRKAVLEKCYGGDVTRK
LEPA_GLUOX      VDALSFISHRTVAEQRGRSICAKLKDLIPKQLFKIAIQAAIGSKVIARETIGALSKDVTAKCYGGDISRK
LEPA_DESPS      VDALSQLVHRVNARKRGLHSCEMLKEEIPRQMFKIAIQAAIGGNVVARTNISAMRKDVTAKCYGGDISRK
LEPA_BRUME      VDALSMLVHRSAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRIVARETISALRKDVTAKCYGGDVTRK
LEPA_BRUMB      VDALSMLVHRSAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRIVARETISALRKDVTAKCYGGDVTRK
LEPA_BRUAB      VDALSMLVHRSAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRIVARETISALRKDVTAKCYGGDVTRK
LEPA_BRUA2      VDALSMLVHRSAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRIVARETISALRKDVTAKCYGGDVTRK
LEPA_BRUA1      VDALSMLVHRSAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRIVARETISALRKDVTAKCYGGDVTRK
LEPA_TREDE      VDALAQLAYKPSAYDKARLVCEKLKDEIPRQQFKIPIQGAIGSQIIARETISALRKDVLAKCYGGDITRK
LEPA_PSEU5      VDALALIVHRDNAHYKGRQLTEKMKELIPRQMFDXXXXXXXXXXXXXRTTVKALRKNVLAKCYGGDVSRK
LEPA_PSEAE      VDALALIVHRDNAPYKGRQLVEKMKELIPRQMFDVXXXXXXXXXXXXRSTVKALRKNVLAKCYGGDVSRK
LEPA_PSEAB      VDALALIVHRDNAPYKGRQLVEKMKELIPRQMFDVXXXXXXXXXXXXRSTVKALRKNVLAKCYGGDVSRK
LEPA_PSEA8      VDALALIVHRDNAPYKGRQLVEKMKELIPRQMFDVXXXXXXXXXXXXRSTVKALRKNVLAKCYGGDVSRK
LEPA_PSEA7      VDALALIVHRDNAPYKGRQLVEKMKELIPRQMFDVXXXXXXXXXXXXRSTVKALRKNVLAKCYGGDVSRK
LEPA_PSEFL      VDALALIVHKDNAHYKGRQLTEKMKELIPRQMFDVXXXXXXXXXXXXRTSVKALRKNVLAKCYGGDVSRK
LEPA_PSEFS      VDALALIVHKDNAHYKGRQLTEKMKELIPRQMFDVXXXXXXXXXXXXRTSVKALRKNVLAKCYGGDVSRK
LEPA_CAMHC      VDALSIIVPRDKALQKGRDLVKAMKEIVPRQLFEVAIQASIGNKIIARENVRAMGKNVTAKCYGGDITRK
LEPA_ACICJ      VDALAFIAHRSVADTRGRAICAKLKDLIPRQLFKIAIQAAIGGRVIARETLGALSKDVTAKCYGGDISRK
LEPA_LACRJ      VDALSFIAHRDFAAERGREITAKLKKIIPRQNFEIPIQAAIGSKIIARTNIKAYRKDVTARIHTGDPDRR
LEPA_LACRD      VDALSFIAHRDFAAERGREITAKLKKIIPRQNFEIPIQAAIGSKIIARTNIKAYRKDVTARIHTGDPDRR
LEPA_LACBA      VDALSFIAHRTFAPARGREIASRLKKIIPRQNFEIPVQAAIGAKIIARTTIKAYRKDVTAHLYGGDRTRR
LEPA_LACF3      VDALSFISHRDFAEERGREIASKLKKIIPRQNFEIPVQAAIGSKIIARTNIKAYRKDVTARIHTGDPDRR
LEPA_CLAMS      VDAFSAIVHRDKAYAYGVLMTGRLRELIPRQQFEVPXXXXXXXXXXXXXXXXXXXKDVLAKCYGGDITRK
LEPA_CLAM3      VDAFSAIVHRDKAYAYGVLMTGRLRELIPRQQFEVPXXXXXXXXXXXXXXXXXXXKDVLAKCYGGDITRK
LEPA_PSEF5      VDALALIVHRDNAHYKGRALTEKMKELIPRQMFDXXXXXXXXXXXXXRTTVKALRKNVLAKCYGGDVSRK
LEPA_METPP      VDALSIIVHRSQSQYRGRAVVAKMREIISRQMYDVXXXXXXXXXXXXRENIKALRKNVLAKCYGGDISRK
LEPA_HELHP      VDALSIIVDKSKSYEKGRALVESMKEIVPRQLFEVAIQASVGNKVIARENIKSMGKNVTAKCYGGDITRK
LEPA_LEPCP      VDALSIIVHRAQSQYRGRAVAAKMREQIPRQMYDVXXXXXXXXXXXXRENIKALRKNVLAKCYGGDISRK
LEPA_PSEU2      VDALALIVHRDNAHYKGRALTEKMKELIPRQMFDXXXXXXXXXXXXXRTTVKALRKNVLAKCYGGDVSRK
LEPA_PSESM      VDALALIVHRDNAHYKGRALTEKMKELIPRQMFDXXXXXXXXXXXXXRTTVKALRKNVLAKCYGGDVSRK
LEPA_PSE14      VDALALIVHRDNAHYKGRALTEKMKELIPRQMFDXXXXXXXXXXXXXRTTVKALRKNVLAKCYGGDVSRK
LEPA_HELPY      VDALSIIIDKNKAYEKGRALVETMKELIPRQLFEVAIQASVGNKIIARETIKSVGKNVTAKCYGGDITRK
LEPA_HELPS      VDALSIIIDKNKAYEKGRALVETMKELIPRQLFEVAIQASVGNKIIARETIKSVGKNVTAKCYGGDITRK
LEPA_HELPJ      VDALSIIIDKNKAYEKGRALVETMKELIPRQLFEVAIQASVGNKIIARETIKSVGKNVTAKCYGGDITRK
LEPA_HELPH      VDALSIIIDKNKAYEKGRALVETMKELIPRQLFEVAIQASVGNKIIARETIKSVGKNVTAKCYGGDITRK
LEPA_HELPG      VDALSIIIDKNKAYEKGRALVETMKELIPRQLFEVAIQASVGNKIIARETIKSVGKNVTAKCYGGDITRK
LEPA_HELP2      VDALSIIIDKNKAYEKGRALVETMKELIPRQLFEVAIQASVGNKIIARETIKSVGKNVTAKCYGGDITRK
LEPA_MYCMS      VDAFSMIVNQKFAYQRGSALTLKLKELIPRQNFEVPVQATIGNKVISRETIKAYRKDVTWKLHAADKSRR
LEPA_CYAP8      VDALAMIVHRDKAYYVGRALTEKLKELIPRHQFKVPIQAAIGSKVIASEHIPALRKDVLAKCYGGDISRX
LEPA_CAMJR      VDALSIIVPNEKAQSKGRELVSAMKEIVPRQLFEVAIQASIGNKIIARETVKSMGKNVTAKCYGGDITRK
LEPA_CAMJJ      VDALSIIVPNEKAQSKGRELVSAMKEIVPRQLFEVAIQASIGNKIIARETVKSMGKNVTAKCYGGDITRK
LEPA_CAMJE      VDALSIIVPNEKAQSKGRELVSAMKEIVPRQLFEVAIQASIGNKIIARETVKSMGKNVTAKCYGGDITRK
LEPA_CAMJD      VDALSIIVPNEKAQSKGRELVSAMKEIVPRQLFEVAIQASIGNKIIARETVKSMGKNVTAKCYGGDITRK
LEPA_CAMJ8      VDALSIIVPNEKAQSKGRELVSAMKEIVPRQLFEVAIQASIGNKIIARETVKSMGKNVTAKCYGGDITRK
LEPA_WOLSU      VDALSIIVPKEKSYERGKELVEAMKEIVPRQLFEVAIQASVGNKIIARETVKSMGKNVTAKCYGGDITRK
LEPA_POLSJ      VDALSIIVHRSQSAYRGRAVVAKMREIISRQQFDVXXXXXXXXXXXXRETIKALRKNVIAKCYGGDISRK
LEPA_CAMLR      VDALSIIVPNEKALSKGRELVKAMKEIVPRQLFEVAIQASIGNKIIARENVKSMGKNVTAKCYGGDITRK
LEPA_SULDN      VDALSIVVPRNQALPRGRVLVKNMKEIIPRQLFEVAVQASLGSQVIARETVKSMGKNVTAKCYGGDITRK
LEPA_PARD8      VDALSTLTHVDNSVTFGRRMCEKLKELIPRQQFDXXXXXXXXXXXXXRETIKAVRKDVTAKCYGGDISRK
LEPA_LEIXX      VDAFSAIVHREKAYAYGTMMAGRLRELIPRQQFEVPXXXXXXXXXXXXXXXXXXXKDVLAKCYGGDITRK
LEPA_CYAA5      VDALAMIVHRDKAYYVGRALTEKLKELIPRHQFKVPIQAAIGSKVIASEHIPALRKDVLAKCYGGDISRX
LEPA_MICAN      VDALAMIVHRDKAYYVGRALTEKLKELIPRHQFKVPIQAAIGSKIIASEHIPALRKDVLAKCYGGDISRX
LEPA_BACV8      VDALSTLTHVDNAYNLGKRMCEKLKELIPRQQFDXXXXXXXXXXXXSRETIKAVRKDVTAKCYGGDVSRK
LEPA_PORGI      VDALSTLTHVDNSVTFGRRMCEKLKELIPRQQFEXXXXXXXXXXXXXRETIKPVRKDVTAKCYGGDISRK
LEPA_PORG3      VDALSTLTHVDNSVTFGQRMCEKLKELIPRQQFEXXXXXXXXXXXXXRETIKPVRKDVTAKCYGGDISRK
LEPA_DIAST      VDALSIIVHRSQSQYRGRAVAAKMREIISRQMFDVXXXXXXXXXXXXRETIKALRKNVLAKCYGGDITRK
LEPA_CLOTE      VDALSMIVPEERAYSRGRQMAEKLKEIIPRQMFEVPIQAAVGSKVIARETVRALRKDVLAKCYGGDISRX
LEPA_ACISJ      VDALSIIVHRSQSQYRGRAVAAKMREIISRQMFDVXXXXXXXXXXXXRETIKALRKNVLAKCYGGDITRK
LEPA_CAMC1      VDALSIIVPESKAQTKGRDFVKAMKEIVPRQLFEVAIQASIGNKIIARETVKSMGKNVTAKCYGGDITRK
LEPA_DECAR      VDALSLIVHRANAQYRGRELASKMRELIPRQMYDVAIQAAIGSHIISRENVKAMRKDVLAKCYGGDISRX
LEPA_CAMC5      VDALSIIVPESKAQSKGRDFVKAMKEIVPRQLFEVAIQASIGNKIIARETVKSMGKNVTAKCYGGDITRK
LEPA_SYNY3      VDALAMIVHRDKAYYVGRAMVSKLKELIPRHQFKVPIQAAIGAKVIASEHIPALRKDVLAKCYGGDISRX
LEPA_RALME      VDALSVIVHRSNSQYRGREVAAKMREIIPRQMYDVAIQAAIGSNIIARENVKALRKNVLAKCYGGDISRX
LEPA_RALEJ      VDALSVIVHRSNSQYRGREVAAKMREIIPRQMYDVAIQAAIGSNIIARENVKALRKNVLAKCYGGDISRX
LEPA_LACS1      VDALSFISHRQFAQARGRVIVDKLKTIIPRQNFEIPIQAAIGAKIIARTNIKAYRKDVTARIHTGDPDRR
LEPA_DESVM      VDALAVIVHRDKAYHYGRALALKLKRTIPRQMFEVXXXXXXXXXXXXRESISALRKNVTAKCYGGDITRK
LEPA_CUPTR      VDALSVIVHRSNSQYRGREVAAKMREIIPRQMYDVAIQAAIGSNIIARENVKALRKNVLAKCYGGDISRX
LEPA_CAMFF      VDALSIIVPEEKAMSKGRDFVKTMKELVPRQLFEVAIQASIGNKVIARETVKSMGKNVTAKCYGGDITRK
LEPA_BORGA      VDALSQLVFKDSAKTKAIGICKKLKDEIARQQFKIAIQGAIGSNVIARETISPVRKDVTAKCYGGDITRK
LEPA_ANADF      VDALSVIVHRERAYHRGRELCQKLREVIPKQMYEVXXXXXXXXXXXXRETVKAFRKDVIAKCYGGDISRK
LEPA_ACIAC      VDALSIIVHRSQSAYRGRAVAAKMREIISRQMFDVXXXXXXXXXXXXRETIKALRKNVLAKCYGGDITRK
LEPA_HYDS0      VDALSFLVHKDKAYRKARALVEQLKETIPRQLFEINVQAAIGSKIIASERIPPMRANVTAKCYGGDISRK
LEPA_BORBU      VDALSQLVFKDSARTKAIGICKKLKDEIARQQFRIAIQGAIGSNVIARETISPVRKDVTAKCYGGDITRK
LEPA_ANAVT      VDSLAMIVHRDKAYGVGRSMAEKLKELIPRHQFKVPIQASIGSKVIASEHIPALRKDVLAKCYGGDISRX
LEPA_ANASP      VDSLAMIVHRDKAYGMGRSMAEKLKELIPRHQFKVPIQASIGSKVIASEHIPALRKDVLAKCYGGDISRX
LEPA_VEREI      VDALSIIVHRSQSQHRGRAVVAKMREIISRQMYDVXXXXXXXXXXXXRETIKALRKNVLAKCYGGDITRK
LEPA_SYNP2      VDSLAMIVHRDKAYNVGRAMAEKLKELIPRHQFKIPIQAAIGSKIIASEHIPALRKDVLAKCYGGDISRX
LEPA_HELAH      VDALSIIIDKNKAYEKGRALVEAMKELIPHQLFEVAIQASVGNKIIARETIKSVGKNVTAKCYGGDITRK
LEPA_DELAS      VDALSIIVHRSQATYRGRAVVAKMREIISRQMFDVXXXXXXXXXXXXRETVKAMRKNVLAKCYGGDITRK
LEPA_EUBE2      VDALSFIVFAGNAEERGRKMCEKLKEEIPRQQFEIPIQAAIGSKVIARETVKALRKDVLAKCYGGDISRX
LEPA_DEIGD      VDALAVIVHEDKAYSLGRKIVDKMAEVIPRQLFPVPVQAAIGGKIIARATVKAYRKDVLAKCYGGDITRX
LEPA_AQUAE      VDALSFIVHADRAQKFARRVAEKLRETIPRQLFEVHIQVAKGGKVIASERIKPLRANVTAKCYGGDVTRK
LEPA_RALSO      VDALSIIVHRSNSAYRGREVAAKMREIIPRQMYDVAIQAAIGSNVIARENVKALRKNVLAKCYGGDISRX
LEPA_NOSP7      VDSLAMIVHRDKAYNVGRAMAEKLKELIPRHQFKVPIQASIGSKVIASEHIPALRKDVLAKCYGGDISRX
LEPA_CARHZ      VDALSIIVHEDKAYYRGRQLVEKLRELIPRHLFEIPIQAAIGSRVIARETVKALRKDVLAKCYGGDVTRX
LEPA_CYAP7      VDALAMIVHRDKAYNVGRALTEKLKELIPRHQFKVPIQAAIGSKVIASEHIPALRKDVLAKCYGGDITRX
LEPA_TRIEI      VDALAIIVHRDKAYGVGRALAEKLKELIPRHQFKVPIQASIGSKVIASEHIPALRKDVLAKCYGGDISRX
LEPA_BORAP      VDALSQLVFKDSARTKAVGICKKLKDEIARQQFKIAIQGAIGSNVIARETISPVRKDVTAKCYGGDITRK
LEPA_HERAR      VDALAIIVHRSNSQYRGRQVASKMRELIPRQMFDVAIQATIGANIISRENVKALRKNVLAKCYGGDISRX
LEPA_AZOSB      VDALSVIVHRASAQYRGRELAAKLRGLIPRQMFDVAVQAAIGSHIIARETIKALRKNVLAKCYGGDITRX
LEPA_FLAJ1      VDALSALIHEDNAYNIGKKMTEKLRELIPRQQFDIPIQAAIGAKIIARETIKALRKDVTAKCYGGDISXX
LEPA_BDEBA      IDALSLIVHRSKAQNRGRLLAEKMKELIPRQMYQVXXXXXXXXXXXXRETLGAIRKDVTAKCYGGDISRK
GUF1_HUMAN      ------VVHKDKAHSIGKAICERLKDSLPRQLFEIAIQAAIGSKIIARETVKAYRKNVLAKCYGGDITRK
LEPA_SYNP6      VDPLATIVHRDKAYYVGKALVEKLKELIPRHQFKIPLQAAIGSRVIASESIPALRKDVLAKCYGGDISRX
LEPA_SYNE7      VDPLATIVHRDKAYYVGKALVEKLKELIPRHQFKIPLQAAIGSRVIASESIPALRKDVLAKCYGGDISRX
LEPA_RALPJ      VDALSIIVHRSNSTYRGREVAAKMREIIPRQMYDVAIQAAIGANVIARENVKALRKNVLAKCYGGDISRX
LEPA_FUSNN      VDAFSFIAHNDNAFHRGKAICQKLSEVIPRQQFEIPIQAALGSKIIARETIKAYRKNVIAKCYGGDITRX
LEPA_COXBU      VDALATIVHRDLAYTRGRELTERLKDLIPRQMFEVXXXXXXXXXXXXRTSVKALRKNVTAKCYGGDITRK
LEPA_COXBR      VDALATIVHRDLAYTRGRELTERLKDLIPRQMFEVXXXXXXXXXXXXRTSVKALRKNVTAKCYGGDITRK
LEPA_COXBN      VDALATIVHRDLAYTRGRELTERLKDLIPRQMFEVXXXXXXXXXXXXRTSVKALRKNVTAKCYGGDITRK
LEPA_CALS8      VDALSFIVHRDKAYQRARKIVEKLKEEIPRHLFEIPIQACIGSKVIARETVKALRKDVLAKCYGGDVTRX
LEPA_AZOSE      VDALSVIVHRASAQYRGREVAAKLRGLIPRQMFDVAIQSAIGSHIVARETIKALRKNVLAKCYGGDISRX
GUF1_MOUSE      ------VVHREKAYTVGKSICERLKESLPRQLYEIAIQAAVGSKVIARETVKAYRKNVLAKCYGGDITRK
LEPA_CYAP4      VDSLAAIVHRDKAYGVGRALVSKLRELIPRHQFKIPIQAAIGSKVIASESIPALRKDVLAKCYGGDITRX
LEPA_CLOTH      VDALSFIVHREKAYARGRRIAEKLKEAIPRQQFEVPIQACIGGKIIARETVKAYRKDVLAKCYGGDITRX
LEPA_BURPP      VDALSVIVHRSQSQYRGREVAAKMRELIPRQMYDVAIQATIGANIIARENIKALRKNVLAKCYGGDISRX
LEPA_GLOVI      VDSLSCITHADKAPEVGRQLTAKLKELIPRQQFQVPIQAAIGSKVVARENIAPLRKNVLAKCYGGDISRX
LEPA_BURXL      VDALSVIVHRSQSQYRGREVASKMRELIPRQMYDVAIQATIGANIIARENIKALRKNVLAKCYGGDISRX
LEPA_STRPF      VDALSFIVHKEFAYERGKIIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRK
LEPA_FRATW      VDALASIVHKDQAKYKGRELVERLKELIPRQMFEVAIQAAIGGTIVARSTVKALRKNVLAKCYGGDVSRX
LEPA_FRATT      VDALASIVHKDQAKYKGRELVERLKELIPRQMFEVAIQAAIGGTIVARSTVKALRKNVLAKCYGGDVSRX
LEPA_FRATO      VDALASIVHKDQAKYKGRELVERLKELIPRQMFEVAIQAAIGGTIVARSTVKALRKNVLAKCYGGDVSRX
LEPA_FRATN      VDALASIVHKDQAKYKGRELVERLKELIPRQMFEVAIQAAIGGTIVARSTVKALRKNVLAKCYGGDVSRX
LEPA_FRATM      VDALASIVHKDQAKYKGRELVERLKELIPRQMFEVAIQAAIGGTIVARSTVKALRKNVLAKCYGGDVSRX
LEPA_FRATH      VDALASIVHKDQAKYKGRELVERLKELIPRQMFEVAIQAAIGGTIVARSTVKALRKNVLAKCYGGDVSRX
LEPA_FRATF      VDALASIVHKDQAKYKGRELVERLKELIPRQMFEVAIQAAIGGTIVARSTVKALRKNVLAKCYGGDVSRX
LEPA_FRAT1      VDALASIVHKDQAKYKGRELVERLKELIPRQMFEVAIQAAIGGTIVARSTVKALRKNVLAKCYGGDVSRX
LEPA_FRAP2      VDALASIVHKDQAKYKGRELVERLKELIPRQMFEVAIQAAIGGTIVARSTVKALRKNVLAKCYGGDVSRX
LEPA_DESDA      VDALAVIVHRDRAYTYGRGLALKLKRTIPRQLFXXXXXXXXXXXXXXRETVSAFRKDVTAKCYGGDISRK
LEPA_BURS3      VDALSVIVHRSQSQYRGREVAAKMREIIPRQMYDVAIQATIGAHIIARENIKALRKNVLAKCYGGDISRX
LEPA_FLAPJ      VDALSALIHESNAYHIGKKMCEKLKELIPRQQFDIPIQAAIGAKIIARETIKALRKDVTAKCYGGDISXX
LEPA_DEIRA      IDALAVIVHESKTYSLGRKIVDKMAEVIPRQMFPVPVQAVIGAKIIARATVKAYRKDVLAKCYGGDISRX
LEPA_BURVG      VDALSIIVHRSQSQYRGREVAAKMREIIPRQMYDVAIQAAIGAHIVARENIKALRKNVLAKCYGGDITRX
LEPA_BURCM      VDALSIIVHRSQSQYRGREVAAKMREIIPRQMYDVAIQAAIGAHIVARENIKALRKNVLAKCYGGDITRX
LEPA_BURCH      VDALSIIVHRSQSQYRGREVAAKMREIIPRQMYDVAIQAAIGAHIVARENIKALRKNVLAKCYGGDITRX
LEPA_BURCC      VDALSIIVHRSQSQYRGREVAAKMREIIPRQMYDVAIQAAIGAHIVARENIKALRKNVLAKCYGGDITRX
LEPA_BURCA      VDALSIIVHRSQSQYRGREVAAKMREIIPRQMYDVAIQAAIGAHIVARENIKALRKNVLAKCYGGDITRX
LEPA_BURA4      VDALSIIVHRSQSQYRGREVAAKMREIIPRQMYDVAIQAAIGAHIVARENIKALRKNVLAKCYGGDITRX
LEPA_AMOA5      IDALSAIVHRDKAYELGKKLCAKLKELLPKQMFEIPIQAAIGTKVIARETIKAMRKNVIAKCYGGDISXX
LEPA_SACD2      VDALALIVHRDTAQYKGRSLADKMKELIPRQMFDVAIQAAIGGQVVARTTVKALRKNVIAKCYGGDVSRX
LEPA_LARHH      VDALSLIVHRQNAIYRGRELVSKMRELIPRQMFDIAVQAAIGNNIIARETVKALRKNVLAKCYGGDITRX
LEPA_HAHCH      VDALALIVHRDNAASRGRLLTEKMKELIPRQMFDVAIQAAIGGQIVSRTTVKALRKNVLAKCYGGDVSRX
LEPA_THETN      VDALSMIVHKDKAYEKGRKIVEKLKENIPRHLFEIPIQAAIGSRIIARETVKALRKNVLAKCYGGDVTRX
LEPA_PROM4      -DPLTTIVHRDKAYGVGRALVDKLKELIPRQQFKIPLQASIGSRIIASQNISALRKDVLAKCYGGDISRX
LEPA_HAES2      VDALALIVHKDNAQYRGRELVEKMRELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRX
LEPA_HAES1      VDALALIVHKDNAQYRGRELVEKMRELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRX
LEPA_GRAFK      VDALSALLHVDNAYDIGKKMCEKLKELIPRQQFDIPIQAAIGAKIIARETVKALRKDVTAKCYGGDISXX
LEPA_THEPX      VDALSMIVHKDKAYEKARKIVEKLKENIPRHLFEIPIQAAIGSKIIARETVKALRKNVLAKCYGGDVTRX
LEPA_THEP3      VDALSMIVHKDKAYEKARKIVEKLKENIPRHLFEIPIQAAIGSKIIARETVKALRKNVLAKCYGGDVTRX
LEPA_NEIG2      VDALSLIVHRQSAVHKGRELASKMRELIPRQMFDIAVQAAIGSRIIARENVKALRKNVLAKCYGGDITRX
LEPA_NEIG1      VDALSLIVHRQSAVHKGRELASKMRELIPRQMFDIAVQAAIGSRIIARENVKALRKNVLAKCYGGDITRX
LEPA_THIDA      VDALSLIVHRATSVYRGRELAAKMRELIPRQMFDVAVQAAIGANIIARENVKAMRKNVLAKCYGGDITRX
LEPA_NEIMF      VDALSLIVHRQSAVHRGRELASKMRELIPRQMFDIAVQAAIGSQIIARENVKALRKNVLAKCYGGDITRX
LEPA_NEIMB      VDALSLIVHRQSAVHRGRELASKMRELIPRQMFDIAVQAAIGSQIIARENVKALRKNVLAKCYGGDITRX
LEPA_NEIMA      VDALSLIVHRQSAVHRGRELASKMRELIPRQMFDIAVQAAIGSQIIARENVKALRKNVLAKCYGGDITRX
LEPA_NEIM0      VDALSLIVHRQSAVHRGRELASKMRELIPRQMFDIAVQAAIGSQIIARENVKALRKNVLAKCYGGDITRX
LEPA_BURP8      VDALSVIVHRSQSQYRGREVASKMREIIPRQMYDVAIQATIGAHIIARENIKALRKNVLAKCYGGDITRX
LEPA_ACTSZ      VDALALIVHKDNAVYRGRELVEKMKELIPRQQFDIAIQAAIGNQVIARSTVKQLRKNVLAKCYGGDVSRX
LEPA_YERPY      VDALALITHRDNAQYRGRDLVEKMKELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRX
LEPA_YERPS      VDALALITHRDNAQYRGRDLVEKMKELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRX
LEPA_YERPP      VDALALITHRDNAQYRGRDLVEKMKELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRX
LEPA_YERPN      VDALALITHRDNAQYRGRDLVEKMKELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRX
LEPA_YERPG      VDALALITHRDNAQYRGRDLVEKMKELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRX
LEPA_YERPE      VDALALITHRDNAQYRGRDLVEKMKELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRX
LEPA_YERPB      VDALALITHRDNAQYRGRDLVEKMKELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRX
LEPA_YERPA      VDALALITHRDNAQYRGRDLVEKMKELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRX
LEPA_YERP3      VDALALITHRDNAQYRGRDLVEKMKELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRX
LEPA_YERE8      VDALALITHRDNAQYRGRDLVEKMKELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRX
LEPA_METSB      VDALSMLVHRDRADTRGRVMVEKLKELIPPHMFQIPIQAAIGGKIIARETVRALRKDVTAKCYGGDASRX
LEPA_HAEIN      VDALALIVHKDNSQYRGRELVEKMRELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRX
LEPA_HAEIG      VDALALIVHKDNSQYRGRELVEKMRELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRX
LEPA_HAEIE      VDALALIVHKDNSQYRGRELVEKMRELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRX
LEPA_HAEI8      VDALALIVHKDNSQYRGRELVEKMRELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRX
LEPA_HAEDU      VDALALIVHKDNAAYRGRELVEKMKELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRX
LEPA_ANATD      VDALSFIVHKDKAYQRARRIVEKLKEEIPRHLFEIPIQACIGSKVIARETVKALRKDVLAKCYGGDVTRX
LEPA_MANSM      VDALALIVHKDNAPYRGRELVEKMKELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRX
LEPA_LEPBL      VDALSMIVHRTKAEQRGREIIEKLKDLIPRHQFMIPIQAAVGGKILARESISALRKNVTAKCYGGDITRX
LEPA_LEPBJ      VDALSMIVHRTKAEQRGREIIEKLKDLIPRHQFMIPIQAAVGGKILARESISALRKNVTAKCYGGDITRX
LEPA1_RHOBA     VDALSVVCHXXXXXXXXXXXXKKLKSEIERHMFEVAVQAAIGSRVIARETVPAMRKNVTAKCYGGDITRK
LEPA_SERP5      VDALALITHRDNSQYRGRELVEKMKELIPRQQFDIAIQAAIGTHIIARATVKQLRKNVLAKCYGGDVSRX
LEPA_LEPBP      VDALSSIVHKTKAEERGRVIIEKLKDLIPRHQFMIPLQAAIGSKVVARESISALRKNVTAKCYGGDISRX
LEPA_LEPBA      VDALSSIVHKTKAEERGRVIIEKLKDLIPRHQFMIPLQAAIGSKVVARESISALRKNVTAKCYGGDISRX
LEPA_BORPE      VDALAMIAHRNNARYRAREVVSRMRGLIPRQMFDVAIQAAIGAEVIARENVKALRKNVLAKCYGGDISRX
LEPA_BORPA      VDALAMIAHRNNARYRAREVVSRMRGLIPRQMFDVAIQAAIGAEVIARENVKALRKNVLAKCYGGDISRX
LEPA_BORBR      VDALAMIAHRNNARYRAREVVSRMRGLIPRQMFDVAIQAAIGAEVIARENVKALRKNVLAKCYGGDISRX
LEPA_PASMU      VDALALIVHKDNAPYRGRELVEKMRELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRX
LEPA_LEPIN      VDALSMIVHRSKAEQRGREIIEKLKDLIPRHQFMIPLQAAVGGKILARESISALRKNVTAKCYGGDITRX
LEPA_LEPIC      VDALSMIVHRSKAEQRGREIIEKLKDLIPRHQFMIPLQAAVGGKILARESISALRKNVTAKCYGGDITRX
LEPA_STRM5      VDALSLIVHRSHADRRGRELCDKMKDLIPRQQFDVAIQAAVGSQIIARTTVKAMRKNVLAKCYGGDVSRX
LEPA_PECCP      VDALALITHRDNSQYRGRELVEKMKDLIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRX
LEPA_LACGA      IDALSFIAHREEAQNRARQMTTMLKKLIPRQNFEVDIQGAIGAKIISRATIKPYRKDVTWKIHTGDPDRR
LEPA_EUBR3      VDALSFIVFKESAYERGRKMCEKLKGEIPRHLFEIPIQAAVGGKIIARETVKALRKDVLAKCYGGDISRX
LEPA_ERWT9      VDALALITHRDNSQYRGRELVEKMKDLIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRX
LEPA_ERWCT      VDALALITHRDNSQYRGREFVEKMKELIPRQQFDIAIQAAIGNHIIARATVKQLRKNVLAKCYGGDVSRX
LEPA_BORPD      VDALAMIVHRANARYRARDVVTRMRGLIPRQMFDVAIQAAIGAEVIARENVKALRKNVLAKCYGGDITRX
LEPA_XANP2      VDALSMLVHRARADARGRVMCEKLKDLIPQHLFNIPIQAAIGAKIIARETIKALRKDVTAKCYGGDISRX
LEPA_PHOLL      VDALALITHRGNAQYRGRELVEKMKELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRX
LEPA_METFK      VDALSLIVHRSNSVYRGRELVSKMRELIPRQMFDIAVQASIGANIIARETVKAMRKNVLAKCYGGDITRX
LEPA_LACJO      IDALSFIAHREEAQNRARQMTTMLKKLIPRQNFEVDIQGAIGAKIISRATIKPYRKDVTWKIHTGDPDRR
LEPA_ALKMQ      VDALSFIVHESKAYARGKGMCEKLKDEIPRHQFPVPLQASIGTKIIARETIRALRKDVLAKCYGGDISRX
LEPA_SILST      VDALSTMVHRDRAEQRGRAMCEKLKDLIPRHMFKIPIQAAIGGKVIARETLSALRKDVTAKCYGGDATRX
LEPA_SHESR      VDALAMIIHRSNIRHRGLALVEKMKELIPRQMFDIAIQAAVGSQIIARSTVKALRKDVTAKCYGGDVSRX
LEPA_SHESM      VDALAMIIHRSNIRHRGLALVEKMKELIPRQMFDIAIQAAVGSQIIARSTVKALRKDVTAKCYGGDVSRX
LEPA_SHESA      VDALAMIIHRSNIRHRGLALVEKMKELIPRQMFDIAIQAAVGSQIIARSTVKALRKDVTAKCYGGDVSRX
LEPA_SHEON      VDALAMIIHRSNIRHRGLALVEKMKELIPRQMFDIAIQAAVGSQIIARSTVKALRKDVTAKCYGGDVSRX
LEPA_SALAR      VDALALITHRDNAQNRGRELVDKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRX
LEPA_LACAC      IDALSFIAHRSEAQDRARQMTSMLKKLIPRQNFEVDIQGAIGAKIISRATIKPYRKDVTWKIHTGDPDRR
LEPA_BORA1      VDALAMIVHRSNARYRARDVVSRMRALIPRQMYDVAIQAAIGAEVIARENVKALRKNVLAKCYGGDISRX
LEPA_SHESW      VDALAMVIHRSNIRHRGLALVEKMKELIPRQMFDIAIQAAVGSQIIARSTVKALRKDVTAKCYGGDVSRX
LEPA_SHEPC      VDALAMVIHRSNIRHRGLALVEKMKELIPRQMFDIAIQAAVGSQIIARSTVKALRKDVTAKCYGGDVSRX
LEPA_SHELP      VDALAMILHKANVRYQGLALVNKMKELIPRQMFDIAIQAAVGSQIIARSSVKALRKDVTAKCYGGDVSRX
LEPA_SHEFN      VDALAMIIHRSNIRHRGLALVEKMKELIPRQMFDIAIQAAVGSQIIARSSIKALRKDVTAKCYGGDVSRX
LEPA_SALTY      VDALALITHRDNSQSRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRX
LEPA_SALTI      VDALALITHRDNSQSRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRX
LEPA_SALSV      VDALALITHRDNSQSRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRX
LEPA_SALPK      VDALALITHRDNSQSRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRX
LEPA_SALPC      VDALALITHRDNSQSRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRX
LEPA_SALPA      VDALALITHRDNSQSRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRX
LEPA_SALNS      VDALALITHRDNSQSRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRX
LEPA_SALHS      VDALALITHRDNSQSRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRX
LEPA_SALG2      VDALALITHRDNSQSRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRX
LEPA_SALEP      VDALALITHRDNSQSRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRX
LEPA_SALDC      VDALALITHRDNSQSRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRX
LEPA_SALCH      VDALALITHRDNSQSRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRX
LEPA_SALA4      VDALALITHRDNSQSRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRX
LEPA_DESAD      VDAFSAIVHKDSAYPFGRSLALKLKRAIPRQMFEIVIQAAIGRKIIAKERVAPFRKNVTAKCYGGDITRK
LEPA_CLOPS      VDALSMIVPEVKAYQRGRAIAEKLKEIIPRHMFEVPIQAAVGSKIIARETVKAMRKDVLAKCYGGDISRX
LEPA_CLOPE      VDALSMIVPEVKAYQRGRAIAEKLKEIIPRHMFEVPIQAAVGSKIIARETVKAMRKDVLAKCYGGDISRX
LEPA_CLOP1      VDALSMIVPEVKAYQRGRAIAEKLKEIIPRHMFEVPIQAAVGSKIIARETVKAMRKDVLAKCYGGDISRX
LEPA_ALCBS      VDALAMICHLDQSAYRGRALCEKMKELVPRQMFDVAIQAAIGSKIIARQTVKALRKNVTAKCYGGDVSRX
LEPA_ZYMMO      VDALSMIVHRHAAEGRGRQMCQRMKDLIPRHLFKIPIQAAIGGKVIARETIGAMRKDVTAKCYGGDISRX
LEPA_VARPS      VDALSIIVHRSQSQYRGRAVVSKMREIISRQMFDVAIQAAIGVNIIARETIKALRKNVLAKCYGGDITRX
LEPA_STRMK      VDALSLIVHRSHADRRGRELCEKMKDLIPRQMFDVAIQAAVGSQIIARTTVKAMRKNVLAKCYGGDVSRX
LEPA_SHISS      VDALALITHRDNSQNRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRX
LEPA_SHIFL      VDALALITHRDNSQNRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRX
LEPA_SHIF8      VDALALITHRDNSQNRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRX
LEPA_SHIDS      VDALALITHRDNSQNRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRX
LEPA_SHIBS      VDALALITHRDNSQNRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRX
LEPA_SHIB3      VDALALITHRDNSQNRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRX
LEPA_SHEDO      VDALAMIIHRSNIRHRGLALVEKMKELIPRQMFDIAIQAAVGSQIIARSTIKALRKDVTAKCYGGDVSRX
LEPA_SHEB9      VDALAMVIHRSNIRHRGLALVDKMKELIPRQMFDIAIQAAVGSQIIARSTVKALRKDVTAKCYGGDVSRX
LEPA_SHEB8      VDALAMVIHRSNIRHRGLALVDKMKELIPRQMFDIAIQAAVGSQIIARSTVKALRKDVTAKCYGGDVSRX
LEPA_SHEB5      VDALAMVIHRSNIRHRGLALVDKMKELIPRQMFDIAIQAAVGSQIIARSTVKALRKDVTAKCYGGDVSRX
LEPA_SHEB2      VDALAMVIHRSNIRHRGLALVDKMKELIPRQMFDIAIQAAVGSQIIARSTVKALRKDVTAKCYGGDVSRX
LEPA_MYCMO      IDALAIIVHKDFAYSRGRDLTVKLKEVIPRQNFEIPVQAAIGAKVIARETIKAYRKDVTAKLYGGDVTXX
LEPA_LACH4      IDALSFIAHRSEAQDRARQMTSMLKKLIPRQNFEVDIQGAIGAKIISRATIKPYRKDVTWKIHTGDPDRR
LEPA_ESCF3      VDALALITHRDNSQNRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRX
LEPA_ECOSM      VDALALITHRDNSQNRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRX
LEPA_ECOSE      VDALALITHRDNSQNRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRX
LEPA_ECOLU      VDALALITHRDNSQNRGRELVEKMKDLIPRQQFDIAIQA