[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF55235.1

[Show Plain Result]


## Summary of Sequence Search
    1::196
   68::203     4e-19  38%  205 aa  COMEA_BACSU RecName: Full=ComE operon protein 1;
   41::95      6e-12  51%  556 aa  EEPD1_XENLA RecName: Full=Endonuclease/exonuclease/phosphatase
   40::94      1e-11  49%  569 aa  EEPD1_RAT RecName: Full=Endonuclease/exonuclease/phosphatase family
   40::94      1e-11  49%  569 aa  EEPD1_MOUSE RecName: Full=Endonuclease/exonuclease/phosphatase
   40::94      1e-11  49%  569 aa  EEPD1_HUMAN RecName: Full=Endonuclease/exonuclease/phosphatase
   40::94      1e-11  49%  571 aa  EEPD1_BOVIN RecName: Full=Endonuclease/exonuclease/phosphatase
   41::95      5e-11  49%  550 aa  EEPD1_DANRE RecName: Full=Endonuclease/exonuclease/phosphatase
   48::105     6e-09  42%  112 aa  Y1008_HAEIN RecName: Full=Uncharacterized protein HI1008;Flags:
   62::116     1e-08  50%  123 aa  YBAV_SHIFL RecName: Full=Uncharacterized protein ybaV;Flags:
   62::116     1e-08  50%  123 aa  YBAV_ECOLI RecName: Full=Uncharacterized protein ybaV;Flags:
  496::554     1e-07  39%  773 aa  YHGF_ECOLI RecName: Full=Protein yhgF;
  496::554     2e-07  36%  762 aa  Y568_HAEIN RecName: Full=Uncharacterized protein HI0568;
  736::794     4e-07  37% 1015 aa  SRBD1_MOUSE RecName: Full=S1 RNA-binding domain-containing protein
  576::620     4e-07  49%  639 aa  KIF22_XENTR RecName: Full=Kinesin-like protein KIF22;AltName:
  588::638     4e-07  45%  657 aa  KIF22_RAT RecName: Full=Kinesin-like protein KIF22;
  572::641     4e-07  43%  660 aa  KIF22_MOUSE RecName: Full=Kinesin-like protein KIF22;
  593::643     4e-07  45%  662 aa  KIF22_BOVIN RecName: Full=Kinesin-like protein KIF22;
  708::766     5e-07  36%  995 aa  SRBD1_PONAB RecName: Full=S1 RNA-binding domain-containing protein
  708::766     5e-07  36%  995 aa  SRBD1_HUMAN RecName: Full=S1 RNA-binding domain-containing protein
  568::620     7e-07  38%  634 aa  KIF22_DANRE RecName: Full=Kinesin-like protein KIF22;
  485::543     9e-07  34%  757 aa  YHGF_NEIMB RecName: Full=Uncharacterized protein NMB0075;
  485::543     9e-07  34%  757 aa  YHGF_NEIMA RecName: Full=Uncharacterized protein NMA0194;
  596::646     2e-06  45%  665 aa  KIF22_PONAB RecName: Full=Kinesin-like protein KIF22;
  596::646     2e-06  45%  665 aa  KIF22_HUMAN RecName: Full=Kinesin-like protein KIF22;AltName:
  588::641     2e-06  43%  651 aa  KF22A_XENLA RecName: Full=Kinesin-like protein KIF22-A;AltName:
  507::589     2e-06  31%  663 aa  DNLJ_BRAHW RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  587::640     6e-06  43%  650 aa  KF22B_XENLA RecName: Full=Kinesin-like protein KIF22-B;AltName:
  515::573     2e-05  34%  791 aa  TEX_BORPE RecName: Full=Protein tex;
  764::840     7e-05  40%  957 aa  IF2_THEEB RecName: Full=Translation initiation factor IF-2;
  509::580     7e-05  33%  664 aa  DNLJ_CLOBH RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  509::580     7e-05  33%  664 aa  DNLJ_CLOB1 RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  509::580     9e-05  33%  664 aa  DNLJ_CLOBM RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  509::580     9e-05  33%  664 aa  DNLJ_CLOBL RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  509::580     9e-05  33%  664 aa  DNLJ_CLOBK RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  509::580     9e-05  33%  664 aa  DNLJ_CLOBJ RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  509::580     9e-05  33%  664 aa  DNLJ_CLOB6 RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  793::864     2e-04  39%  979 aa  IF2_SYNP2 RecName: Full=Translation initiation factor IF-2;
 1351::1423    3e-04  32% 1438 aa  DPO3_STAHJ RecName: Full=DNA polymerase III polC-type;       
 1355::1427    3e-04  32% 1442 aa  DPO3_STAES RecName: Full=DNA polymerase III polC-type;       
 1351::1423    3e-04  32% 1438 aa  DPO3_STAEQ RecName: Full=DNA polymerase III polC-type;       
 1327::1410    4e-04  29% 1442 aa  DPO3_UREPA RecName: Full=DNA polymerase III polC-type;       
 1351::1423    6e-04  32% 1438 aa  DPO3_STAS1 RecName: Full=DNA polymerase III polC-type;       
  544::612     7e-04  26%  704 aa  DNLJ_SULSY RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  544::611     7e-04  26%  701 aa  DNLJ_SULAA RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
  509::580     7e-04  31%  667 aa  DNLJ_CLOBA RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
    1::196

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGHVAK
COMEA_BACSU     -----------------------------------------------------------------GAVQH
EEPD1_XENLA     ----------------------------------------------------------------------
EEPD1_RAT       ----------------------------------------------------------------------
EEPD1_MOUSE     ----------------------------------------------------------------------
EEPD1_HUMAN     ----------------------------------------------------------------------
EEPD1_BOVIN     ----------------------------------------------------------------------
EEPD1_DANRE     ----------------------------------------------------------------------
Y1008_HAEIN     ----------------------------------------------------------------------
YBAV_SHIFL      ----------------------------------------------------------------------
YBAV_ECOLI      ----------------------------------------------------------------------
YHGF_ECOLI      ----------------------------------------------------------------------
Y568_HAEIN      ----------------------------------------------------------------------
SRBD1_MOUSE     ----------------------------------------------------------------------
KIF22_XENTR     ----------------------------------------------------------------------
KIF22_RAT       ----------------------------------------------------------------------
KIF22_MOUSE     ----------------------------------------------------------------------
KIF22_BOVIN     ----------------------------------------------------------------------
SRBD1_PONAB     ----------------------------------------------------------------------
SRBD1_HUMAN     ----------------------------------------------------------------------
KIF22_DANRE     ----------------------------------------------------------------------
YHGF_NEIMB      ----------------------------------------------------------------------
YHGF_NEIMA      ----------------------------------------------------------------------
KIF22_PONAB     ----------------------------------------------------------------------
KIF22_HUMAN     ----------------------------------------------------------------------
KF22A_XENLA     ----------------------------------------------------------------------
DNLJ_BRAHW      ----------------------------------------------------------------------
KF22B_XENLA     ----------------------------------------------------------------------
TEX_BORPE       ----------------------------------------------------------------------
IF2_THEEB       ----------------------------------------------------------------------
DNLJ_CLOBH      ----------------------------------------------------------------------
DNLJ_CLOB1      ----------------------------------------------------------------------
DNLJ_CLOBM      ----------------------------------------------------------------------
DNLJ_CLOBL      ----------------------------------------------------------------------
DNLJ_CLOBK      ----------------------------------------------------------------------
DNLJ_CLOBJ      ----------------------------------------------------------------------
DNLJ_CLOB6      ----------------------------------------------------------------------
IF2_SYNP2       ----------------------------------------------------------------------
DPO3_STAHJ      ----------------------------------------------------------------------
DPO3_STAES      ----------------------------------------------------------------------
DPO3_STAEQ      ----------------------------------------------------------------------
DPO3_UREPA      ----------------------------------------------------------------------
DPO3_STAS1      ----------------------------------------------------------------------
DNLJ_SULSY      ----------------------------------------------------------------------
DNLJ_SULAA      ----------------------------------------------------------------------
DNLJ_CLOBA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PGLVTLAEGSRVADALAIAGTLPDADLTALNLAQLLVDGTQIHVLAIGEVQPISVDAAATSASGLISLNT
COMEA_BACSU     PGVYEMRTGDRVSQAIEKAGTSEQADEAQVNLAEILQDGTVVYIPKKGEXXXXXXXXXXXXXXALVNINT
EEPD1_XENLA     -----------------------------------------------------------------LNINT
EEPD1_RAT       -----------------------------------------------------------------LNINT
EEPD1_MOUSE     -----------------------------------------------------------------LNINT
EEPD1_HUMAN     -----------------------------------------------------------------LNINT
EEPD1_BOVIN     -----------------------------------------------------------------LNINT
EEPD1_DANRE     -----------------------------------------------------------------LNINT
Y1008_HAEIN     --------------------------------------------------------------SDKLNINT
YBAV_SHIFL      -----------------------------------------------------------------VSINN
YBAV_ECOLI      -----------------------------------------------------------------VSINN
YHGF_ECOLI      -----------------------------------------------------------------VDLNT
Y568_HAEIN      -----------------------------------------------------------------VDLNT
SRBD1_MOUSE     -----------------------------------------------------------------VDINI
KIF22_XENTR     -------------------------------------------------------------------LNT
KIF22_RAT       -------------------------------------------------------------------LNE
KIF22_MOUSE     ------------------------------------------------EVQ-ISPELLAHGRKKLLDLNE
KIF22_BOVIN     -------------------------------------------------------------------LNE
SRBD1_PONAB     -----------------------------------------------------------------VDINI
SRBD1_HUMAN     -----------------------------------------------------------------VDINI
KIF22_DANRE     ----------------------------------------------------------------LQTLNS
YHGF_NEIMB      -----------------------------------------------------------------VDVNT
YHGF_NEIMA      -----------------------------------------------------------------VDVNT
KIF22_PONAB     -------------------------------------------------------------------LNE
KIF22_HUMAN     -------------------------------------------------------------------LNE
KF22A_XENLA     -------------------------------------------------------------------LNT
DNLJ_BRAHW      -----------------------------------------IYALGIRQVGETTADLLAKYFTSIENFKK
KF22B_XENLA     -------------------------------------------------------------------LNT
TEX_BORPE       -----------------------------------------------------------------VDVNT
IF2_THEEB       -----------------------EAILTALN--QLPQDQVQLRVLAPGEITETDVDLAAASSAVIIGFNT
DNLJ_CLOBH      -----------------------------------------IYALGIPNVGKKTANDLVMKFKTLESIKN
DNLJ_CLOB1      -----------------------------------------IYALGIPNVGKKTANDLVMKFKTLESIKN
DNLJ_CLOBM      -----------------------------------------IYALGIPNVGKKTANDLVMKFKTLESIKN
DNLJ_CLOBL      -----------------------------------------IYALGIPNVGKKTANDLVMKFKTLESIKN
DNLJ_CLOBK      -----------------------------------------IYALGIPNVGKKTANDLVMKFKTLESIKN
DNLJ_CLOBJ      -----------------------------------------IYALGIPNVGKKTANDLVMKFKTLESIKN
DNLJ_CLOB6      -----------------------------------------IYALGIPNVGKKTANDLVMKFKTLESIKN
IF2_SYNP2       ------------------------------SLQQLPQDEVQIRVLAPGEISETDVDLAAASGAIIIGFNT
DPO3_STAHJ      -------------------------------------------------MQPISLEKS--QAFDFIIEGD
DPO3_STAES      -------------------------------------------------LQPISLEKS--QAFDFIIEGD
DPO3_STAEQ      -------------------------------------------------LQPISLEKS--QAFDFIIEGD
DPO3_UREPA      ----------------------PQKKVSSRELALQPIYEIVIELLARGKISNISIEQSQATSYVIDKENN
DPO3_STAS1      -------------------------------------------------MQPISLEKS--KAFEFIIEGD
DNLJ_SULSY      -----------------------------------------IYGLGIRYVGEVTAKTLASAVRCIDDLKN
DNLJ_SULAA      -----------------------------------------IYGLGIRYVGEVTAKTLASAVNCLEDLKN
DNLJ_CLOBA      -----------------------------------------IYALGIPNVGVKTAKDIVNKFKSIDGLKN


                         +         .         .         .         .         *         .:210
query           ATVADLVTLPGVGEKTAQAIIDFRESNGGFSTVEDLLQVKGIGPSKFEQISGLVSP
COMEA_BACSU     ATLEELQGISGVGPSKAEAIIAYREENGRFQTIEDITKVSGIGEKSFEKIKSSIT-
EEPD1_XENLA     ATEEELMTLPGVTRQVAQNIVEYREYIGGFKKVEDLALVSGVGAAKLEQV------
EEPD1_RAT       ATEEELMTLPGVTRAVARSIVEYREYIGGFKKVEDLALVSGVGATKLEQV------
EEPD1_MOUSE     ATEEELMTLPGVTRAVARSIVEYREYIGGFKKVEDLALVSGVGATKLEQV------
EEPD1_HUMAN     ATEEELMTLPGVTRAVARSIVEYREYIGGFKKVEDLALVSGVGATKLEQV------
EEPD1_BOVIN     ATEEELMTLPGVTRAVARSIVEYREYIGGFKKVEDLALVSGVGATKLEQV------
EEPD1_DANRE     ATEEELMTLPGVNRGVAQNIVEYRDCIGGFKKVEDLALVSGVGATKLEAI------
Y1008_HAEIN     ATASEIQSLTGIGAKKAEAIVQYREKHGNFXNAEQLLEVQGIGKATLEK-------
YBAV_SHIFL      ASAEELAAMNGVGLKKAQAIVSYREEYGPFKTVEDLKQVPGMGNSLVER-------
YBAV_ECOLI      ASAEELAAMNGVGLKKAQAIVSYREEYGPFKTVEDLKQVPGMGNSLVER-------
YHGF_ECOLI      ASVPLLTRVAGLTRMMAQNIVAWRDENGQFQNRQQLLKVSRLGPKAFEQCAGFL--
Y568_HAEIN      ASAPLLARVAGMTKTLAQNIVEYRDENGRFESRSELKKVPRLGPKAFEQCAGFM--
SRBD1_MOUSE     CSEVLLRHIAGLNANRAKNIIEWREKNGPFINREQLKKVKGLGPKSFQQCAGFV--
KIF22_XENTR     GSVKELKSLQKIGDKKAKLIIGWREVNGPFKNVEDLASLEGI--------------
KIF22_RAT       GSARDLRSLQRIGQKKAQLIVGWRELHGPFNEVEDLEQVEGISGKQVE--------
KIF22_MOUSE     GSARELRSLQRIGQKKAQLIVGWRELHGPFSEVEDLEQVEGISGKQVE--------
KIF22_BOVIN     GSARDLRSLQRIGQKKAQLIVGWRELHGPFSQVEDLERVEGISGKQME--------
SRBD1_PONAB     CSEVLLRHIAGLNANRAKNIIEWREKNGPFINREQLKKVKGLGPKSFQQCAGFI--
SRBD1_HUMAN     CSEVLLRHIAGLNANRAKNIIEWREKNGPFINREQLKKVKGLGPKSFQQCAGFI--
KIF22_DANRE     GSLKELKSLQQIGDKKAKLIMGWREINGDFTQVEDLKKIEGVTVKRF---------
YHGF_NEIMB      ASAPLLARISGLNQTLAQNIVAYRDENGAFDSRKKLLKVPRLGEKTFEQAAGFL--
YHGF_NEIMA      ASAPLLARISGLNQTLAQNIVAYRDENGAFDSRKKLLKVPRLGEKTFEQAAGFL--
KIF22_PONAB     GSARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQME--------
KIF22_HUMAN     GSARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQME--------
KF22A_XENLA     GSVKELKSLQRIGDKKAKLIIGWREVNGPFKNVEELACLEGISA---KQVSSFI--
DNLJ_BRAHW      ATIDDLQNIEGIGEISAKSIYDFLHNEKTLKLIDDLL-ASGVNP-VFEKVVTVESP
KF22B_XENLA     GSVKELKSLQRIGDKKAKLIIGWREVNGLFKNVEELECLEGISA---KQVSSFI--
TEX_BORPE       ASAALLARVSGLNTLLAKNIVAWRDENGAFPTRDMLRKVPRFGEKAFEQAAGFL--
IF2_THEEB       TLAS------GARQAAEQHNVDIREYNIIYKLLDDI--------------------
DNLJ_CLOBH      TTIEQLVEVPDVGEIVAKSIYDFFEDEKVISNIEELLNL-GVKP------------
DNLJ_CLOB1      TTIEQLVEVPDVGEIVAKSIYDFFEDEKVISNIEELLNL-GVKP------------
DNLJ_CLOBM      TTIEQLVEVPDVGEIVAKSIYDFFEDEKIISNIEELLNL-GVKP------------
DNLJ_CLOBL      TTIEQLVEVPDVGEIVAKSIYDFFEDEKIISNIEELLNL-GVKP------------
DNLJ_CLOBK      TTIEQLVEVPDVGEIVAKSIYDFFEDEKIISNIEELLNL-GVKP------------
DNLJ_CLOBJ      TTIEQLVEVPDVGEIVAKSIYDFFEDEKIISNIEELLNL-GVKP------------
DNLJ_CLOB6      TTIEQLVEVPDVGEIVAKSIYDFFEDEKIISNIEELLNL-GVKP------------
IF2_SYNP2       TLA------PGARQAAEQEGVDIREYNVIYRFLEEI--------------------
DPO3_STAHJ      TLIPPFISVPGLGENVAKRIVEARE-DGPFLSKEDLNKKAGLSQKIIEYLDDLGS-
DPO3_STAES      TLIPPFISVPGLGENVAQRIVEARE-EGPFLSKEDLNKKAGLSQKVIDYLDELGS-
DPO3_STAEQ      TLIPPFISVPGLGENVAQRIVEARE-EGPFLSKEDLNKKAGLSQKVIDYLDELGS-
DPO3_UREPA      AIIPPFIAIQGLGETVANSIIEARNQK-VFSTIEDL--------------------
DPO3_STAS1      TLIPPFIAVPGLGENVAQRIVEARD-EGPFLSKEDLNKKAGLSQKVIEYLDELGS-
DNLJ_SULSY      FTITDLMKLPDIGYKVASEIYNFFHNQENLKMIEELRELR----------------
DNLJ_SULAA      FTITDLMKLPDIGDKVATEIYNFFHNEQNLKMIQQLKEL-----------------
DNLJ_CLOBA      ATFEELVSVQDVGDIVAQDIIEFFKEEKVISTIDELLSL-GVNP------------