[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF55333.1

[Show Plain Result]


## Summary of Sequence Search
    1::499
   10::481     5e-80  35%  495 aa  Y916_MYCBO RecName: Full=Uncharacterized monooxygenase Mb0916;     
   10::481     5e-80  35%  495 aa  Y892_MYCTU RecName: Full=Uncharacterized monooxygenase
  143::638     7e-67  33%  640 aa  HAPMO_PSEFL RecName: Full=4-hydroxyacetophenone monooxygenase;     
  136::607     4e-63  31%  662 aa  Y4ID_RHISN RecName: Full=Uncharacterized monooxygenase y4iD;       
   20::537     3e-60  34%  542 aa  PAMO_THEFY RecName: Full=Phenylacetone monooxygenase;       
   10::473     7e-56  34%  543 aa  CYMO_ACISP RecName: Full=Cyclohexanone 1,2-monooxygenase;       
    9::460     2e-50  30%  488 aa  STCW_EMENI RecName: Full=Putative sterigmatocystin biosynthesis
   25::489     6e-44  30%  550 aa  CPNB_COMTE RecName: Full=Cyclopentanone 1,2-monooxygenase;       
   25::489     6e-44  30%  550 aa  CPNB_COMS9 RecName: Full=Cyclopentanone 1,2-monooxygenase;       
    4::337     7e-21  25%  533 aa  FMO5_RAT RecName: Full=Dimethylaniline monooxygenase
    3::224     1e-18  32%  535 aa  FMO2_MOUSE RecName: Full=Dimethylaniline monooxygenase
    3::224     3e-18  30%  535 aa  FMO2_RABIT RecName: Full=Dimethylaniline monooxygenase
    3::336     3e-18  29%  535 aa  FMO2_CAVPO RecName: Full=Dimethylaniline monooxygenase
    4::337     3e-18  26%  533 aa  FMO5_RABIT RecName: Full=Dimethylaniline monooxygenase
    3::224     8e-18  32%  535 aa  FMO2_RAT RecName: Full=Dimethylaniline monooxygenase
    3::224     2e-17  29%  535 aa  FMO2_MACMU RecName: Full=Dimethylaniline monooxygenase
    4::225     2e-17  27%  533 aa  FMO5_MOUSE RecName: Full=Dimethylaniline monooxygenase
    3::224     9e-17  29%  535 aa  FMO2_PONAB RecName: Full=Dimethylaniline monooxygenase
   30::337     1e-16  23%  533 aa  FMO5_CAVPO RecName: Full=Dimethylaniline monooxygenase
    3::224     1e-16  29%  535 aa  FMO2_HUMAN RecName: Full=Dimethylaniline monooxygenase
    3::224     1e-16  29%  535 aa  FMO2_GORGO RecName: Full=Dimethylaniline monooxygenase
    3::224     1e-16  29%  535 aa  FMO2_PANTR RecName: Full=Dimethylaniline monooxygenase
    3::228     2e-16  30%  531 aa  FMO3_RAT RecName: Full=Dimethylaniline monooxygenase
   30::337     1e-15  22%  533 aa  FMO5_HUMAN RecName: Full=Dimethylaniline monooxygenase
    3::228     1e-15  27%  534 aa  FMO3_MOUSE RecName: Full=Dimethylaniline monooxygenase
    3::335     2e-15  27%  558 aa  FMO4_HUMAN RecName: Full=Dimethylaniline monooxygenase
    3::228     2e-15  28%  532 aa  FMO3_CANFA RecName: Full=Dimethylaniline monooxygenase
    3::336     2e-15  25%  532 aa  FMO1_HUMAN RecName: Full=Dimethylaniline monooxygenase
    3::224     3e-15  29%  532 aa  FMO3_MACMU RecName: Full=Dimethylaniline monooxygenase
    3::228     5e-15  29%  539 aa  FMO6_HUMAN RecName: Full=Putative dimethylaniline monooxygenase
    3::224     6e-15  28%  532 aa  FMO3_PANTR RecName: Full=Dimethylaniline monooxygenase
    3::224     1e-14  29%  535 aa  FMO1_RABIT RecName: Full=Dimethylaniline monooxygenase
    3::224     1e-14  27%  532 aa  FMO3_HUMAN RecName: Full=Dimethylaniline monooxygenase
    3::263     2e-14  27%  555 aa  FMO4_RABIT RecName: Full=Dimethylaniline monooxygenase
   32::228     2e-14  28%  531 aa  FMO3_RABIT RecName: Full=Dimethylaniline monooxygenase
    3::224     5e-14  30%  532 aa  FMO1_RAT RecName: Full=Dimethylaniline monooxygenase
    3::223     7e-14  31%  560 aa  FMO4_MOUSE RecName: Full=Dimethylaniline monooxygenase
   31::79      2e-13  31%  346 aa  Y968_MYCBO RecName: Full=Uncharacterized protein Mb0968c;
   31::79      2e-13  31%  346 aa  Y943_MYCTU RecName: Full=Uncharacterized protein Rv0943c/MT0969;
    3::224     2e-13  28%  532 aa  FMO1_PIG RecName: Full=Dimethylaniline monooxygenase
    3::224     2e-13  28%  532 aa  FMO1_CANFA RecName: Full=Dimethylaniline monooxygenase
   32::224     6e-13  28%  532 aa  FMO3_BOVIN RecName: Full=Dimethylaniline monooxygenase
    3::223     1e-12  28%  560 aa  FMO4_RAT RecName: Full=Dimethylaniline monooxygenase
    3::224     2e-12  29%  532 aa  FMO1_MOUSE RecName: Full=Dimethylaniline monooxygenase
   12::228     2e-12  34%  530 aa  FMO1_ARATH RecName: Full=Probable flavin-containing monooxygenase
   11::236     3e-11  27%  462 aa  GSOX3_ARATH RecName: Full=Flavin-containing monooxygenase FMO
   28::239     7e-11  28%  457 aa  GSOX2_ARATH RecName: Full=Flavin-containing monooxygenase FMO
    6::247     2e-10  30%  453 aa  FMO2_ARATH RecName: Full=Putative flavin-containing monooxygenase
    8::184     1e-09  30%  348 aa  CZCO_GEOKA RecName: Full=Uncharacterized oxidoreductase czcO-like; 
   30::235     4e-09  26%  459 aa  GSOX1_ARATH RecName: Full=Flavin-containing monooxygenase FMO
   30::235     7e-09  26%  461 aa  GSOX4_ARATH RecName: Full=Flavin-containing monooxygenase FMO
  113::237     4e-06  22%  459 aa  GSOX5_ARATH RecName: Full=Flavin-containing monooxygenase FMO
    4::42      4e-05  38%  345 aa  CZCO_BACSU RecName: Full=Uncharacterized oxidoreductase czcO;    
   42::214     7e-05  28%  432 aa  FMO1_YEAST RecName: Full=Thiol-specific monooxygenase;       
   98::196     1e-04  32%  425 aa  IUCD_ECOLX RecName: Full=L-lysine 6-monooxygenase;       
   80::200     1e-04  28%  337 aa  FENR_MAGSA RecName: Full=Ferredoxin--NADP reductase;       
 1756::1792    3e-04  57% 2111 aa  GLT1_SCHPO RecName: Full=Putative glutamate synthase [NADPH];        
    4::57      5e-04  41%  384 aa  GLF8_KLEPN RecName: Full=Probable UDP-galactopyranose mutase;    
   41::189     5e-04  26%  343 aa  FENR_RHILO RecName: Full=Ferredoxin--NADP reductase;       
  102::199     6e-04  28%  318 aa  TRXB_HAEIN RecName: Full=Thioredoxin reductase;         Short=TRXR;
   34::79      6e-04  30%  500 aa  PAO_MAIZE RecName: Full=Polyamine oxidase;         EC=1.5.3.n6;  
 1825::1861    6e-04  51% 2194 aa  GLSN_MEDSA RecName: Full=Glutamate synthase [NADH], amyloplastic;    
    4::44      6e-04  44%  384 aa  GLF1_KLEPN RecName: Full=Probable UDP-galactopyranose mutase;    
  153::189     8e-04  51%  493 aa  GLTB_BACSU RecName: Full=Glutamate synthase [NADPH] small chain;   
    4::42      8e-04  33%  345 aa  CZCO_BACA2 RecName: Full=Uncharacterized oxidoreductase czcO;    
    1::499

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxKRTVIVGSGFAGLGMGAQLKRRGDHDFVIIERADDVGGTWRDNTYPGAACDVPSHLYSFSFH
Y916_MYCBO      ------------VVGAGMSGMCVAITLLSAGITDVCIYEKADDVGGTWRDNTYPGLTCDVPSRLYQYSFA
Y892_MYCTU      ------------VVGAGMSGMCVAITLLSAGITDVCIYEKADDVGGTWRDNTYPGLTCDVPSRLYQYSFA
HAPMO_PSEFL     ---------KVVIIGAGESGMIAALRFKQAGV-PFVIYEKGNDVGGTWRENTYPGCRVDINSFWYSFSF-
Y4ID_RHISN      ---------RVLIIGAGMSGVAAAIRLRQLGI-SYIQVEKQDSTGGVWHAHHYPGCGVDTPGHLYSYTF-
PAMO_THEFY      -----------LVVGAGFSGLYALYRLRELG-RSVHVIETAGDVGGVWYWNRYPGARCDIESIEYCYSFS
CYMO_ACISP      -----------IVIGGGFGGLYAVKKLRDELELKVQAFDKATDVAGTWYWNRYPGALTDTETHLYCYSWD
STCW_EMENI      ---------RVITIGAGFSGILMAYQIQKQANIEHVVYEKNHDIGGTWLTNRYPNAGCDVPSHAYTYRFA
CPNB_COMTE      -----------LLIGAGFTGLYQLYHLRKLG-YKVHLVDAGADIGGIWHWNCYPGARVDTHCQIYQYSIP
CPNB_COMS9      -----------LLIGAGFTGLYQLYHLRKLG-YKVHLVDAGADIGGIWHWNCYPGARVDTHCQIYQYSIP
FMO5_RAT        --------KRIAVIGSGASGLTCIKCCLEEGLEP-VCFERSDDIGGLWRASIYKSVIINTSKEMMCFSDY
FMO2_MOUSE      --------KKVVVIGAGVSGL---ISLKCCVDEGLTCFERTEDIGGLWRENVEDGRASNTSKEMSCFSDF
FMO2_RABIT      --------KKVAVIGAGVSGL---ISLKCCVDEGLTCFERTEDIGGLWRASIYQSVITNTSKEMSCFSDF
FMO2_CAVPO      --------KKVAVIGAGVSGL---ISLKCCVDEGLTCFERTEDIGGLWRASIYKSVITNTSKEMSCFSDF
FMO5_RABIT      --------KRVAVIGAGASGLACIKCCLEEGLEP-VCFERTDDIGGLWRASIYKSVIINTSKEMMCFSDY
FMO2_RAT        --------KKVAVIGAGVSGL---ISLKGCVDEGLTCFERTEDIGGLWRENVEDGRASNTSKEMSCFSDF
FMO2_MACMU      --------KKVAVIGAGVSGL---ISLKCCVDEGLTCFERTEDIGGVWRASIYQSVVTNTSKEMSCFSDF
FMO5_MOUSE      --------KRIAVIGAGASGLTCIKCCLEEGLEP-VCFERSGDIGGLWRASIYQSVVINTSKEMMCFSDY
FMO2_PONAB      --------KKVAVIGAGVSGL---ISLKCCVDEGLTCFERTEDIGGVWRASIYQSVVTNTSKEMSCFSDF
FMO5_CAVPO      -----------------------------------VCFERSADIGGLWRASIYKSVIINTSKEMMCFSDY
FMO2_HUMAN      --------KKVAVIGAGVSGL---ISLKCCVDEGLTCFERTEDIGGVWRASIYQSVVTNTSKEMSCFSDF
FMO2_GORGO      --------KKVAVIGAGVSGL---ISLKCCVDEGLTCFERTEDIGGVWRASIYQSVVTNTSKEMSCFSDF
FMO2_PANTR      --------KKVAVIGAGVSGL---ISLKCCVDEGLTCFERTEDIGGVWRASIYQSVITNTSKEMSCFSDF
FMO3_RAT        --------RKVAVIGAGVSGLAAIRSCLEEGLEP-TCFERSDDVGGLWKDHTEEGRASIYQSVFTNSSXX
FMO5_HUMAN      -----------------------------------VCFERTDDIGGLWRASIYKSVIINTSKEMMCFSDY
FMO3_MOUSE      --------KKVAIIGAGVSGLAAIRSCLEEGLEP-TCFERSDDVGGLWRASIYQSVFTNSSKEMMCXXXX
FMO4_HUMAN      --------KKVAVIGAGVSGL---SSIKCCVDEDLTCFERSDDIGGLWKTRVYKSLVTNVCKEMSCYSDF
FMO3_CANFA      --------KRVAIIGAGVSGLASIRSCLEEGLEP-TCFERSEDIGGLWRASIYQSVFTNSSKEMMCXXXX
FMO1_HUMAN      --------KRVAIVGAGVSGLASIKCCLEEGLEP-TCFERSDDLGGLWRASLYKSVVSNSCKEMSCYSDF
FMO3_MACMU      --------KKVAIIGAGVSGLASIRSCLEEGLEP-TCFEKSNDIGGLWRASIYKSVFTNSSKEMMCXXXX
FMO6_HUMAN      --------KRVGIIGAGVSGLAAIWCCLEEGLEP-TCFERSDDVGGLWKDHTEEGRASIYQSVFTNSSXX
FMO3_PANTR      --------KKVAIIGAGVSGLASIRSCLEEGLEP-TCFEKSNDIGGLWRASIYKSVFSNSSKEMMCXXXX
FMO1_RABIT      --------KRVAIVGAGVSGLASIKCCLEEGLEP-TCFERSDDLGGLWRASLYKSVVSNSCKEMSCYSDF
FMO3_HUMAN      --------KKVAIIGAGVSGLASIRSCLEEGLEP-TCFEKSNDIGGLWRASIYKSVFSNSSKEMMCXXXX
FMO4_RABIT      --------KKVAVIGAGVSGL---TSIKCCLDEDLTCFERSNDIGGLWKTRIYWSLVTNVCKEMSCYSDF
FMO3_RABIT      --------------------------------------EMSDDIGGLWRASIYQSVFTNSSKEMMCXXXX
FMO1_RAT        --------KRVAIVGAGVSGLASIKCCLEEGLEP-TCFERSCDLGGLWRASLYNSVVSNSSKEMSCYSDF
FMO4_MOUSE      --------KKVAVIGAGVSGL---SSIKCCLDENLTCFERTSDFGGLWKTRVYRSLVTNVCKEMSCYSDF
Y968_MYCBO      ----------------------------------------------------------------------
Y943_MYCTU      ----------------------------------------------------------------------
FMO1_PIG        --------KRVAIVGAGVSGLASIKCCLEEGLEP-TCFERSDDLGGLWRASLYKSVVSNSCKEMSCYPDF
FMO1_CANFA      --------KRVAIVGAGVSGLASIKCCLEEGLEP-TCFERSDDLGGLWRASLYKSVVSNSCKEMSCYSDF
FMO3_BOVIN      --------------------------------------EKGEDIGGLWRASIYRSVFTNSSKEMTCXXXX
FMO4_RAT        --------KKVAVIGAGVSGL---SSIKCCLDENLTCFERSSDFGGLWKTRVYRSLVTNVCKEMSCYSDF
FMO1_MOUSE      --------KRVAIVGAGVSGLASIKCCLEEGLEP-TCFERSSDLGGLWRASLYKSVVSNSSREMSCYPDF
FMO1_ARATH      ---------RVAIIGAGVSGL---AAAKNLVHHNPTVFEASDSVGGVWRSCTYETTKLQSARVDYEFSDF
GSOX3_ARATH     --------KHVAVIGAGPAGLITSRELRREG-HSVVVFEREKQVGGLWHSSIYESLRTNVPREVRDFPFL
GSOX2_ARATH     -------------------------ELSREG-HTVVVLEREKEVGGLWHSSVYESLRTNLPRECMGFTFD
FMO2_ARATH      ---------RVAIIGAGVSGLAAAKHLAR---HHPQVFEASDSIGGVWRKCTYETTKLQSVRVSYELSDF
CZCO_GEOKA      -----------LVIGASQAGLAMGYYLKQNNIL-FAIVGKENRIGDVWR-NRYDSLVLFTPSSLPGMALK
GSOX1_ARATH     ----------------------------RREGHTVVVFDREKQVGGLWNDTTYESLRTNLPRECMGFTIH
GSOX4_ARATH     ----------------------------RREGHTVVVLDREKQVGGLWHSSVYKSLRTNLPRECMGYKDF
GSOX5_ARATH     ----------------------------------------------------------------------
CZCO_BACSU      ----------TIVIGAGQAGISIGYYLKQ-SDQKFIILDKSHEVGESWKD--------------------
FMO1_YEAST      ------------------------------------------DIGGVWH---YPEQKSDISKKLMQFSGF
IUCD_ECOLX      ----------------------------------------------------------------------
FENR_MAGSA      ----------------------------------------------------------------------
GLT1_SCHPO      --------RRVAIIGSGPAGLAAADQLNRAG-HHVVIYERADRPGG------------------------
GLF8_KLEPN      --------KNIMIVGAGFSGVVIARQLAEQG-YTVKIIDRRDHIGGNSYDTRDP--QTDVMVHVY-----
FENR_RHILO      -----------------------------------------------------PGGQC---AELYPEKIY
TRXB_HAEIN      ----------------------------------------------------------------------
PAO_MAIZE       ---------RVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAG---------------
GLSN_MEDSA      --------KRVAIVGSGPSGLAAADQLNKMG-HIVTVFERADRIGG------------------------
GLF1_KLEPN      --------KKILIVGAGFSGAVIGRQLAEKG-HQVHIIDQRDHIGGNSYD--------------------
GLTB_BACSU      --------KKVAIVGSGPAGLASADQLNQAG-HSVTVFERADRAGG------------------------
CZCO_BACA2      ----------TIVIGAGQAGISVGYYLK-KSKQKFIILDKSHEVGESWKN--------------------


                         .         .         *         .         .         .         .:140
query           PNPNWSQVFSPGPEIQTYLQNFAQDEGLLPHLHFNRNMNNARWDEKEGRWHITTPGQVYIAQFLITGTGH
Y916_MYCBO      KNPNWTQMFSRGGEIQDYLRGIAERYGLRHRIRFGATVVSARFD--DGRWVLTDSGTESTVDFLISATGV
Y892_MYCTU      KNPNWTQMFSRGGEIQDYLRGIAERYGLRHRIRFGATVVSARFD--DGRWVLTDSGTESTVDFLISATGV
HAPMO_PSEFL     ARGIWDDCFAPAPQVFAYMQAVAREHGLYEHIRFNTEVSDAHWDESTQRWQLLSEGQTQVSNVVVFAVGQ
Y4ID_RHISN      ASGNWSTFFPLQKEIDDYFNRVARDFGIESSIRYGTECLVTRYDEESLTWHLRLPNETLVTNVVLSAVGG
PAMO_THEFY      EEVNWTERYASQPEILRYINFVADKFDLRSGITFHTTVTAAAFDEATNTWTVTNHGDRIRARYLIMASGQ
CYMO_ACISP      KELLQSKKYVQGPDVRKYLQQVAEKHDLKKSYQFNTAVQSAHYNEADALWEVTTEGDKYTARFLITALGL
STCW_EMENI      LYPDWPRYFSYASDIWEYLDKVCAAFKLRQYMQFRTEVIKACWNEEEGQWKVQRPGQEDHCHILLNACG-
CPNB_COMTE      EEFNWKELFPNWAQMREYFHFADKKLDLSKDISFNTRVQSAVFDEGTREWTVRSIGHQPIARFVIANLGF
CPNB_COMS9      EEFNWKELFPNWAQMREYFHFADKKLDLSKDISFNTRVQSAVFDEGTREWTVRSIGHQPIARFVIANLGF
FMO5_RAT        PIPDHYPNFMHNSQVLEYFRMYAKEFGLLKYIQFKTTVCSVKKQSTSGQWQVVTEHQVDVFDGVLVCTGH
FMO2_MOUSE      PMPEDFPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVISVKKRPSSGQWEVYTQSQRTVFDAVMVCSGH
FMO2_RABIT      PMPEDFPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVISVKKRPSSGQWEVVTQSNVFDAVMVCSGHHI
FMO2_CAVPO      PMPEDFPNFLHNSKLLEYFRLFAKKFDLLKYIQFQTTVLTVKKHSSSGQWEVVTQSDVFDAVMVCSGHHI
FMO5_RABIT      PIPDHFPNFMHNSQVLEYFRMYAKEFGLLKYIQFKTTVCSVKKRSTSGQWEVLTEGKKESAVFVLVCTGH
FMO2_RAT        PMPEDFPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVISVKKRPSSGQWYVQSNGKEQRAVFVMVCSGH
FMO2_MACMU      PMPEDFPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRKCSSSGQWKVVTQSNVFDAVMVCTGHHF
FMO5_MOUSE      PIPDHYPNYMHNSQVLEYFRMYAKEFDLLKYIQFKTTVCSVKKQSTSGQWQVVTEQQVDVFDGVLVCTGH
FMO2_PONAB      PMPEDFPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRKCSSSGQWKVVTQSNVFDAVMVCSGHHI
FMO5_CAVPO      PIPDHYPNFMHNSHVLEYFRMYAKEFGLLKYIQFKTTVCNVKKRSTSGQWEVVTEHEVDVFDAVMVCTGH
FMO2_HUMAN      PMPEDFPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRKCSSSGQWKVVTQSNVFDAVMVCSGHHI
FMO2_GORGO      PMPEDFPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRKCSSSGQWKVVTQSNVFDAVMVCSGHHI
FMO2_PANTR      PMPEDFPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRKCSSSGQWKVVTQSNVFDAVMVCSGHHI
FMO3_RAT        XXXXXXXXXMHNSKLQEYITSFATEKNLLKYIQFETRINKCPDFSTTGKWEVTTEKNVFDAVMICSGHHH
FMO5_HUMAN      PIPDHYPNFMHNAQVLEYFRMYAKEFDLLKYIRFKTTVCSVKKQPDSGQWEVVTESEMNVFDGVMVCTGH
FMO3_MOUSE      XXXXXXXXXMHHSKLQEYITSFAKEKNLLKYIQFETSINKCPNFSTTGKWEVTTEKHVFDATMICSGHHI
FMO4_HUMAN      PFHEDYPNFMNHEKFWDYLQEFAEHFDLLKYIQFKTTVCSIRPDFSEGQWDVVTEGKQNRAVFVMVCTGH
FMO3_CANFA      XXXXXXXXXMHNSKLQEYITVFSKEKNLLKYIQFKTSVNKRPDFSVSGQWDITTEGKRESATFVLICSGH
FMO1_HUMAN      PFPEDYPNYVPNSQFLEYLKMYANHFDLLKHIQFKTSVTKCSDSAVSGQWEVVTKQESAIFDAVMVCTGF
FMO3_MACMU      XXXXXXXXXMHNSKIQEYLTAFAKEKSLLKYIQFKTFVSNKRPDATTGQWDVTTEGKRESAVFVMVCSGH
FMO6_HUMAN      XXXXXXXNYIHHSKLQEYIKTYAQKKDLLRYIQFETLVSGIKKCPSTGQWVVVTEKESTIFDAVMICSGH
FMO3_PANTR      XXXXXXXNFMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSNKRPDATTGQWDVTTEGKKESAVFVMVCSGH
FMO1_RABIT      PFPEDYPNYVPNSQFLDYLKMYADRFSLLKSIQFKTSITKCQDFNVSGQWEVVTEGKQESAIFVMVCTGF
FMO3_HUMAN      XXXXXXXNFMHNSKIQEYIIAFAKEKNLLKYIQFKTSVNKHPDFATTGQWDVTTEGKKESAVFVMVCSGH
FMO4_RABIT      PFQEDYPNFMSHSKFWNYLQEFAEHFDLLKYIQFKTTVCSVRPDSKTGQWDVVTEGKQHRAVFVMVCTGK
FMO3_RABIT      XXXXXXXNFMHNSKLQEYITTFAREKNLLKYIQFKTLVSSIKKHPDTGQWYVSTEGKKETAVFVMICSGH
FMO1_RAT        PFPEDYPNFVPNSLFLEYLQLYATQFNLLRCIYFNTKVCSIRPDAVSGQWEVVTQGKQSSDTFVMVCTGF
FMO4_MOUSE      PFREDYPNFMSHEKFWDYLREFAEHFGLLRYIRFKTTVLSVRPDFSEGQWDVVTETEVFDAVMVCTGSPH
Y968_MYCBO      ----------------------------------------------------------------------
Y943_MYCTU      ----------------------------------------------------------------------
FMO1_PIG        PFPEDYPNYVPNSHFLEYLRMYANQFNLLKCIQFKTKVCSVTKHEDTGQWDVVTEGKQESAVFVMVCTGF
FMO1_CANFA      PFPEDYPNYVPNSQFLEYLKMYANRFSLLKCIRFKTKVCKVTKCPDTGQWEVVTQGKQESAIFVMVCTGF
FMO3_BOVIN      XXXXXXXNFMHNSKLQEYITMFAKEKNLLKYIQFKTIVSNKRPDQTTGQWDVITEGKKESAVFVMICSGH
FMO4_RAT        PFHEDYPNFMSHEKFWDYLREFAEHFGLLKYIRFKTTVRSVRPDFSEGQWEVVTETEVFDAVMVCTGQFL
FMO1_MOUSE      PFPEDYPNFVPNSLFLEYLKLYSTQFNLQRCIYFNTKVCSIRPDAVSGQWEVVTVGKQNSAIFVMVCTGF
FMO1_ARATH      PWPNDDTTFPPYLEILDYLESYAKHFDLLKFMKFGSKVIEVRFGDGEGAYGNLLPGQWHAFEFVVVCTGK
GSOX3_ARATH     PRSRDARRYPNHREVLAYIQDFAREFKIEEMIRFETEVVRVE-PVDNGNWRVQSKNEIYDA--VVVCNGH
GSOX2_ARATH     DESRDSRRYPSHMEVLAYLQDFAREFNLEEMVRFEIEV--VRVEPVNGKWRVKTSGGVSIFDAVVVCSGH
FMO2_ARATH      LWPNRGESFPTYVDVLDYLEAYAKHFNLVKFIKFNSKVVELRFDGKTGAYGNLLPGQWHAFEYVVVCAGK
CZCO_GEOKA      GDPNG---YPTKDEIADYLEDYAQKFELPIHL----NTEVISLQKEDEIFKVTTNNGNYVAEKVVVATGP
GSOX1_ARATH     DISRDSRRYPSHREVLAYLQDFAREFKIEEMVRFETEVVCV--EPVNGKWSVRSKNSVGFAAHVVVCSGH
GSOX4_ARATH     PXXXXXXXXXXXXEVLAYLQDFATEFNIEEMIRFETEV--LRVEPVNGKWRVQSKDEIYDA--VVMCCGH
GSOX5_ARATH     -------------EVLAYLEDFAREFKLVEMVRFKTEVVLVEPEDK--KWRVQSKNSDGISKAVVVCNGH
CZCO_BACSU      ----------------------------------------------------------------------
FMO1_YEAST      PFEENVPLYPSRRNIWEYLKAYANKDAI--SIHFSTEVTYLK--KKNSQWEITSKDELRTTKFVIVASGH
IUCD_ECOLX      -------------EFSDYLRWAAED---MNNLYFSHTVENIDFDKKRRLFLVQTSQGEYFARNICLGTG-
FENR_MAGSA      -----------------------------PTYHFGTQVSTSRLDD--GRWGLSNGDSIAARAVIICAGGG
GLT1_SCHPO      ----------------------------------------------------------------------
GLF8_KLEPN      ----------------------------------------------------------------------
FENR_RHILO      DIPGWPSISAQGL-VDKLLE---QIHPFKPDFTYNRMVSSLEKLE-DGSFRVTTDNEVFEAKVVVIAAGG
TRXB_HAEIN      --------------------------------------------------------QNFTCDALIIATG-
PAO_MAIZE       ----------------------------------------------------------------------
GLSN_MEDSA      ----------------------------------------------------------------------
GLF1_KLEPN      ----------------------------------------------------------------------
GLTB_BACSU      ----------------------------------------------------------------------
CZCO_BACA2      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LADESYPTIPGLESFTGEKFHSARWDHNVSLKGKRIGVVGTGASAIQIVPEMAKIASELVVFQRTPSYII
Y916_MYCBO      LHHPRIPPIAGLDDFRGTVFHSARWDHTVPLLGRRIAVIGTGSTGVQLVCGLAGVAGKVTMFQRTAQWVL
Y892_MYCTU      LHHPRIPPIAGLDDFRGTVFHSARWDHTVPLLGRRIAVIGTGSTGVQLVCGLAGVAGKVTMFQRTAQWVL
HAPMO_PSEFL     LNRPMIPAIPGIETFKGPMFHSAQWDHDVDWSGKRVGVIGTGASATQFIPQLAQTAAELKVFARTTNWLL
Y4ID_RHISN      FTTPKWPNLSGLRNFDGPVVHTSKWDPEVALDGKRVAVIGNGASAMQVVPAIADRVGALTIFQRSRQWVF
PAMO_THEFY      LSVPQLPNFPGLKDFAGNLYHTGNWPHEVDFSGQRVGVIGTGSSGIQVSPQIAKQAAELFVFQRTPHFAV
CYMO_ACISP      LSAPNLPNIKGINQFKGELHHTSRWPDDVSFEGKRVGVIGTGSTGVQVITAVAPLAKHLTVFQRSAQYSV
STCW_EMENI      -----WPDTPGLDRFKGRVIHTAAWPDDVQWNSDRVAVIGSGASSIQAVAGIQPHVGHLDIFVRTGVWFT
CPNB_COMTE      GASPSTPNVDGIETFKGQWYHTALWQEGVNMAGKRVAIIGTGSSGVQVAQEAALDAKQVTVYQRTPNLAL
CPNB_COMS9      GASPSTPNVDGIETFKGQWYHTALWQEGVNMAGKRVAIIGTGSSGVQVAQEAALDAKQVTVYQRTPNLAL
FMO5_RAT        HTDPHLPSFPGIEKFKGKYFHSREYKNPVEFTGKRVIVIGIGNSGGDLAVEISHTAKQVFLSTRRGAWIL
FMO2_MOUSE      HIQPHLPSFPGIERFRGQYFHSREYKHPVGFEGKRILVVGIGNSAADIASELSKTAAQVFVSTRHGSWVM
FMO2_RABIT      LPNIPLKSFPGIEKFKGQYFHSRQYKHPAGLEGKRILVIGIGNSASDIAVELSKKAAQVYISTRKGSWVM
FMO2_CAVPO      LPHIPLKSFPGIERFKGQYFHSRQYKHPAGFEGKRILVIGIGNSASDIASELSKNAAQVFISTRNGSWVM
FMO5_RABIT      HTSAHLPSFPGIEKFKGQYLHSRDYKNPEKFTGKRVIVIGIGNSGGDLAVEISHTAKQVFLSTRRGAWIM
FMO2_RAT        HIQPHLPSFPGIERFQGQYFHSRQYKHPVGYEGKRILVVGIGNSAADIASELSKRAAQVFVSTRHGSWVL
FMO2_MACMU      LPHIPLKSFPGIERFKGQYFHSRQYKHPDGFEGKRILVIGMGNSGSDIAVELSKSAAQVFISTRHGTWVM
FMO5_MOUSE      HTDAHLPSFPGIEKFKGKYFHSRDYKNPVEFTGKRVIVIGIGNSGGDLAVEISHTAKQVFLSTRRGAWIL
FMO2_PONAB      LPHIPLKSFPGIERFKGQYFHSRQYKHPDGFEGKRILVIGMGNSGSDIAVELSKNAAQVFISTRHGTWVL
FMO5_CAVPO      HTNAHLPSFPGIEKFKGQYFHSRDYKNPEAFTGKRVVIIGIGNSGGDLAVEISHTAKQVFLSTRRGSWIL
FMO2_HUMAN      LPHIPLKSFPGMERFKGQYFHSRQYKHPDGFEGKRILVIGMGNSGSDIAVELSKNAAQVFISTRHGTWVM
FMO2_GORGO      LPHIPLKSFPGIERFKGQYFHSRQYKHPDGFEGKRILVIGMGNSGSDIAVELSKNAAQVFISTRHGTWVM
FMO2_PANTR      LPHIPLKSFPGIERFKGQYFHSRQYKHPDGFEGKRILVIGMGNSGSDIAVELSKNAAQVFISTRHGTWVM
FMO3_RAT        LPKDSFP---GLNRFKGKCFHSRDYKEPGTWKGKRVLVIGLGNSGCDIAAELSHVAQQVIISSRSGSWV-
FMO5_HUMAN      HTNAHLPSFPGIEKFKGQYFHSRDYKNPEGFTGKRVIIIGIGNSGGDLAVEISQTAKQVFLSTRRGAWIL
FMO3_MOUSE      FPHVPKDSFPGLNRFKGKCFHSRDYKEPGIWKGKRVLVIGLGNSGCDIAAELSHVAQKVTISSRSGSWV-
FMO4_HUMAN      FLNPHLPAFPGIHKFKGQILHSQEYKIPEGFQGKRVLVIGLGNTGGDIAVELSRTAAQVLLSTRTGTWVL
FMO3_CANFA      HVYPNLPSFPGLKLFKGKCFHSREYKEPGIFKGKRVLVIGLGNSGCDIATELSHTAEQVIISSRSGSWV-
FMO1_HUMAN      LTNPYLPSFPGINAFKGQYFHSRQYKHPDIFKDKRVLVIGMGNSGTDIAVEASHLAEKVFLSTTGGGWVI
FMO3_MACMU      HVYPNLPSFPGLNHFKGKCFHSRDYKEPGVFKGKRVLVVGLGNSGCDIATELSHTAEQVVISSRSGSWVM
FMO6_HUMAN      HVYPNLPTFPGLDQFRGNYLHSRDYKNPEAFKGKRVLVIGLGNSGSDIAVELSRLATQVIISTRSASWV-
FMO3_PANTR      HVYPNLPSFPGLNHFKGKCFHSRDYKEPGVFNGKRVLVVGLGNSGCDIATELSRTAEQVMISSRSGSWVM
FMO1_RABIT      LTNPHLPLFPGIKTFKGQYFHSRQYKHPDIFKDKRVLVVGMGNSGTDIAVEASHVAKKVFLSTTGGAWVI
FMO3_HUMAN      HVYPNLPSFPGLNHFKGKCFHSRDYKEPGVFNGKRVLVVGLGNSGCDIATELSRTAEQVMISSRSGSWVM
FMO4_RABIT      FLNPRLPSFPGILKFRGQILHCQEYKIPEGFRGQRVLVIGLGNSGGDVAVELSRVAAQVLLSTRTGTWVI
FMO3_RABIT      HVYPNLPSFPGLKHFKGKSFHSREYKEPGIFKGKRVLVIGLGNSGCDIATELSHTAEQVVISSRSGSWV-
FMO1_RAT        LTNPHLPSFPGIQTFKGQYFHSRQYKHPDVFKDKRVLVVGMGNSGTDIAVEASHLAKKVFLSTTGGAWVI
FMO4_MOUSE      LPLESFP---GIHKFKGQILHSQEYRIPDAFRGKRILVVGLGNTGGDIAVELSEIAAQVFLSTRTGTWVL
Y968_MYCBO      ---------------------SAAWDRDFDPAGKRIAVVGTDAAAAHYISRLSESAASVTVFTQAPRRVV
Y943_MYCTU      ---------------------SAAWDRDFDPAGKRIAVVGTDAAAAHYISRLSESAASVTVFTQAPRRVV
FMO1_PIG        LTNPYLPSFPGINTFKGQYFHSRQYKHPDIFKDKSVLVVGMGNSGTDIAVEASHLAKKVFLSTTGGAWVI
FMO1_CANFA      LTNPHLPLFPGINTFKGQYFHSRQYKHPDIFKDKRVLVIGMGNSGTDIAVETSRLAKKVFLSTTGGAWVM
FMO3_BOVIN      HVYPNIPSFPGIKLFKGKCFHSRDYKEPGIFKGKRVLVIGLGNSGCDIASELSHIAEKVIISSRSGSWVM
FMO4_RAT        SPRLPLESFPGIHKFKGQILHSQEYRIPDAFRGKRILVVGLGNTGGDVAVELSGIAAQVFLSTRTGAWVR
FMO1_MOUSE      LTNPHLPSFPGILTFKGEYFHSRQYKHPDIFKDKRVLVVGMGNSGTDIAVEASHLAKKVFLSTTGGAWVI
FMO1_ARATH      YGDPAFPAKKGPEMFQGKVMHSMDYEASTLLSGKKVAVIGFKKSAIDLALESA-----------------
GSOX3_ARATH     YTEPNIAHIPGIKSWPGKQIHSHNYRVPDPFENEVVVVIGNFASGADISRDIAKVAKEVHIASR------
GSOX2_ARATH     YTEPNVAHIPGIKSWPGKQIHSHNYRVPGPFENEVVVVIGNFASGADISRDIAKVAKEVHIASRASEF--
FMO2_ARATH      YGDPTFPVKKGPEIFKGKVLHSMDYSKSQLLHGKKVAVIGFKKSAIDLALESAKEGKTCTMVVRTPHWVI
CZCO_GEOKA      FQKPYIP--PFAESLSDKVYHTSRYLNPSQLQEGSVLVVGAGNSGAQIAVELSE----------------
GSOX1_ARATH     FTEPNVAHIPGIKSWPGKQIHSHNYRVPGPFNNEVVVVIGNYASGADISRDIAKVAKEVHIASR------
GSOX4_ARATH     FAEPNIAQIPGIESWPGRQTHSHSYRVPDPFKDEVVVVIGNFASGADISRDISKVAKEVHIASR------
GSOX5_ARATH     YTEPRVAHVPGIDSWPGKQIHSHNYRVPDQFKDQVVVVIGNFASGADISRDITGVAKEVHIASRS-----
CZCO_BACSU      ----------------------------------------------------------------------
FMO1_YEAST      YSVPKLPTIAGLDLWFDNKFHSKDFKNCEFAREKVVIVVGNGSSGQDIANQLTTVAKKV-----------
IUCD_ECOLX      ----KQPYLPPVKHMTQSCFHASEMNRRPDLSGKRITVVGGGQSGADL----------------------
FENR_MAGSA      AFGPNRPPLDGLEQFEGTGFYLVR--KREDFRGKKVVIAGGGDSAVDWAISLSEVAAKVMVVHRRPKF--
GLT1_SCHPO      ----------------------------------------------------------------------
GLF8_KLEPN      ----------------------------------------------------------------------
FENR_RHILO      GSFQKRPPIPGIEPYEGKSFYSVR--RMEDFRGHDLVIVGGGDSALDWTLNLQPVAKSVTLVHRRPEF--
TRXB_HAEIN      -ASARYIGLPSEENYKGRGVSACATCDGFFYRNKPVGVIGGGNTAVEEALYLANIASTVHLIHRRDSFLI
PAO_MAIZE       ----------------------------------------------------------------------
GLSN_MEDSA      ----------------------------------------------------------------------
GLF1_KLEPN      ----------------------------------------------------------------------
GLTB_BACSU      ----------------------------------------------------------------------
CZCO_BACA2      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PRMERKYTDGEKRLFQRNPHVIENLRSELFWGGENTFAQRRAIPRFLAEGKKLALDHLAAQVSDEELRAK
Y916_MYCBO      PWPNPRYSK-LARVFHRAFPCLGSLAYKAYSLSFETFAVALSNPGLHRKLVGAVCXXXXXXXXXXXXXXX
Y892_MYCTU      PWPNPRYSK-LARVFHRAFPCLGSLAYKAYSLSFETFAVALSNPGLHRKLVGAVCXXXXXXXXXXXXXXX
HAPMO_PSEFL     PTLHEKISDSCKWLLAHVPHYSLWYRVAMAMPQSVGFLEDVMVPTELARNDRLRQDWMEPQFADRDLREV
Y4ID_RHISN      PKFQKPVPEPMQFLFREVPHYEWLYRLRLSWIYDSEVHEARSVNAVNDRDREAYTQYIEGQLAGRDLIAK
PAMO_THEFY      PREESRNTPGGTHRYQGPKSALEVSDEELYWGGPDILAAYRDILRDRDANERVARNKIRNTVRDPEVAER
CYMO_ACISP      PEDVKKIKDNDKSLFALNESTVPAMRKAVFWGGGETFGDIATNMEANIEAQNFIKGKIAEIVKDPAIAQK
STCW_EMENI      GAPTKIYSEAERAQFRSNPSALKSIEAEVMWGARDSMAQKGASAFF--------RQRMASIIKDDRLAKG
CPNB_COMTE      PMHQKQLSEDNLRMKPELPAAFER-RGKCFAGFDFDFIAKNATELSAAERTEILRDKVRARIKDPKVAEK
CPNB_COMS9      PMHQKQLSEDNLRMKPELPAAFER-RGKCFAGFDFDFIAKNATELSAAERTEILRDKVRARIKDPKVAEK
FMO5_RAT        NRVGKRGYPIDILLSSRITNYLSKICGSAL---KNRYMEKQLNQRF-----------------DHEMFG-
FMO2_MOUSE      SRI-------------------------------------------------------------------
FMO2_RABIT      SRI-------------------------------------------------------------------
FMO2_CAVPO      SRISEDGYPWDMVFHTRFKSMLRNILP-------------RTVSKWMME-QQLNRWFNHANYSLEPKNKY
FMO5_RABIT      NRVGDHGYPIDILLSSRFSQFLKKITGETI---ANSFLERKMNQRF---------DHAMFGLKPKHRALS
FMO2_RAT        SRI-------------------------------------------------------------------
FMO2_MACMU      SRV-------------------------------------------------------------------
FMO5_MOUSE      NRV-------------------------------------------------------------------
FMO2_PONAB      SRI-------------------------------------------------------------------
FMO5_CAVPO      NRVGKHGYPTDVLLSSRFTYFLSKILGQSL---SNAYVEKQMNERF-----------------DHEMFG-
FMO2_HUMAN      SRI-------------------------------------------------------------------
FMO2_GORGO      SRI-------------------------------------------------------------------
FMO2_PANTR      SRI-------------------------------------------------------------------
FMO3_RAT        --MSRVWNDG------------------------------------------------------------
FMO5_HUMAN      NRVGDYGYPADVLFSSRLTHFIWKICGQSL---ANKYLEKKINQRF-----------------DHEMFG-
FMO3_MOUSE      --MSRVWDDG------------------------------------------------------------
FMO4_HUMAN      GRSSDWGYPYNMMVTRRCCSFIAQVLPSRFL---NWIQERKLNKRFNHEDYGL-----------------
FMO3_CANFA      --MSRVWDDG------------------------------------------------------------
FMO1_HUMAN      SRIFDSGYPWDMVFMTRFQNMLRNLPTPIV-----TWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDE
FMO3_MACMU      SRV-------------------------------------------------------------------
FMO6_HUMAN      --MSRVWDDG------------------------------------------------------------
FMO3_PANTR      SRV-------------------------------------------------------------------
FMO1_RABIT      SRV-------------------------------------------------------------------
FMO3_HUMAN      SRV-------------------------------------------------------------------
FMO4_RABIT      SRSSNGGYPFNMMITRRCLNVIEQVLPSCFWINERQMNKR------------------------------
FMO3_RABIT      --MSRVWDDG------------------------------------------------------------
FMO1_RAT        SRV-------------------------------------------------------------------
FMO4_MOUSE      SR--------------------------------------------------------------------
Y968_MYCBO      ----------------------------------------------------------------------
Y943_MYCTU      ----------------------------------------------------------------------
FMO1_PIG        SRV-------------------------------------------------------------------
FMO1_CANFA      SRV-------------------------------------------------------------------
FMO3_BOVIN      SRV-------------------------------------------------------------------
FMO4_RAT        SR--------------------------------------------------------------------
FMO1_MOUSE      SRV-------------------------------------------------------------------
FMO1_ARATH      ----------------------------------------------------------------------
GSOX3_ARATH     ----------------------------------------------------------------------
GSOX2_ARATH     ----------------------------------------------------------------------
FMO2_ARATH      PHYWR-----------------------------------------------------------------
CZCO_GEOKA      ----------------------------------------------------------------------
GSOX1_ARATH     ----------------------------------------------------------------------
GSOX4_ARATH     ----------------------------------------------------------------------
GSOX5_ARATH     ----------------------------------------------------------------------
CZCO_BACSU      ----------------------------------------------------------------------
FMO1_YEAST      ----------------------------------------------------------------------
IUCD_ECOLX      ----------------------------------------------------------------------
FENR_MAGSA      ----RAAPESEARLKQ------------------------------------------------------
GLT1_SCHPO      ----------------------------------------------------------------------
GLF8_KLEPN      ----------------------------------------------------------------------
FENR_RHILO      ----------------------------------------------------------------------
TRXB_HAEIN      DRLYKKVEEGK-----------------------------------------------------------
PAO_MAIZE       ----------------------------------------------------------------------
GLSN_MEDSA      ----------------------------------------------------------------------
GLF1_KLEPN      ----------------------------------------------------------------------
GLTB_BACSU      ----------------------------------------------------------------------
CZCO_BACA2      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LTPSYEPGCKRVLISNTYYPALQSPITTLEASALSSINGSTVRAASGEEYELDILIFATGFEATEPPYAQ
Y916_MYCBO      XTPDYEPMCKRLVMSGGFYRAIQRDDVELVTAGIDHVEHRGIVTDDGVLHEVDVIVLATGFDSHAFFRPM
Y892_MYCTU      XTPDYEPMCKRLVMSGGFYRAIQRDDVELVTAGIDHVEHRGIVTDDGVLHEVDVIVLATGFDSHAFFRPM
HAPMO_PSEFL     LIPDSPVGGKRIVRDNTWISTLKRDNVSMIRQPIEVITPKGICCVDGTEHEFDLIVYGTGFHASKFLMPI
Y4ID_RHISN      VIPSYPPFGKRMLLDNGWYRTLLKPHVTLVDGAAARVEGRSIHAIDDETHEADLIIVASGYDTTRYLLPV
PAMO_THEFY      LVPKGYPGTKRLILEIDYYEMFNRDNVHLVDTLSAPIETITPRGVSEREYELDSLVLATGFDALTGALFK
CYMO_ACISP      LMPQ-DLYAKRPLCDSGYYNTFNRDNVRLEANPIVEITENGVKLENGDFVELDMLICATGFDAVDGNYVR
STCW_EMENI      FTPTFGFGCRRITPGDPYMHAIQQANVDVHFTAVASCTEDGIVGADGIERLVDTIVCASGFDNTYRPQFP
CPNB_COMTE      LAPMKKPGAKRPSLEQWYYEIFNQNNVTLNETPVLRITEKGIVTAEGEA-EFDLIVFATGFDAVTGGLTS
CPNB_COMS9      LAPMKKPGAKRPSLEQWYYEIFNQNNVTLNETPVLRITEKGIVTAEGEA-EFDLIVFATGFDAVTGGLTS
FMO5_RAT        LKPKHSALGQHPTINDDLPNRIISGLVKVKGNVKEFTETAAIFEDGSREDDIDVVIFATGYSFAFP----
FMO2_MOUSE      ----------------------------------------------------------------------
FMO2_RABIT      ----------------------------------------------------------------------
FMO2_CAVPO      LMK--EPILNDDLPSRILYGAVKSRVTQLETSAL--FEDGTV------EEDIDVIVFATGYTFSFP----
FMO5_RABIT      QHPTVNDDLPNRIISGSV--KIKGNVKEFTETAAIFEDGS-------REDDIDAVIFATGYSFSFP----
FMO2_RAT        ----------------------------------------------------------------------
FMO2_MACMU      ----------------------------------------------------------------------
FMO5_MOUSE      ----------------------------------------------------------------------
FMO2_PONAB      ----------------------------------------------------------------------
FMO5_CAVPO      LKPKHRAMSQHPTVNDDLPNRIIAGMVKVKGNVKEFTETAAIFEDGSREDDIDAVIFATGYSFDFP----
FMO2_HUMAN      ----------------------------------------------------------------------
FMO2_GORGO      ----------------------------------------------------------------------
FMO2_PANTR      ----------------------------------------------------------------------
FMO3_RAT        ----------------------------------------------------------------------
FMO5_HUMAN      LKPKHRALSQHPTLNDDLPNRIISGLVKVKGNVKEFTETAAIFEDGSREDDIDAVIFATGYSFDFP----
FMO3_MOUSE      ----------------------------------------------------------------------
FMO4_HUMAN      ---SITKGKKAKFIVNDELPCILCGAITMKTSVIEFTETSAVFEDGTVEENIDVVIFTTGYTFSFP----
FMO3_CANFA      ----------------------------------------------------------------------
FMO1_HUMAN      L-----PG--RIITGKVF----------IRPSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFP----
FMO3_MACMU      ----------------------------------------------------------------------
FMO6_HUMAN      ----------------------------------------------------------------------
FMO3_PANTR      ----------------------------------------------------------------------
FMO1_RABIT      ----------------------------------------------------------------------
FMO3_HUMAN      ----------------------------------------------------------------------
FMO4_RABIT      ----------------------------------------------------------------------
FMO3_RABIT      ----------------------------------------------------------------------
FMO1_RAT        ----------------------------------------------------------------------
FMO4_MOUSE      ----------------------------------------------------------------------
Y968_MYCBO      ----------------------EHPAVAWATAAIDALTSSGIRTSDGVEHPVDAIIYGTGFAIADQVGDQ
Y943_MYCTU      ----------------------EHPAVAWATAAIDALTSSGIRTSDGVEHPVDAIIYGTGFAIADQVGDQ
FMO1_PIG        ----------------------------------------------------------------------
FMO1_CANFA      ----------------------------------------------------------------------
FMO3_BOVIN      ----------------------------------------------------------------------
FMO4_RAT        ----------------------------------------------------------------------
FMO1_MOUSE      ----------------------------------------------------------------------
FMO1_ARATH      ----------------------------------------------------------------------
GSOX3_ARATH     ----------------------------------------------------------------------
GSOX2_ARATH     ----------------------------------------------------------------------
FMO2_ARATH      ----------------------------------------------------------------------
CZCO_GEOKA      ----------------------------------------------------------------------
GSOX1_ARATH     ----------------------------------------------------------------------
GSOX4_ARATH     ----------------------------------------------------------------------
GSOX5_ARATH     ----------------------------------------------------------------------
CZCO_BACSU      ----------------------------------------------------------------------
FMO1_YEAST      ----------------------------------------------------------------------
IUCD_ECOLX      ----------------------------------------------------------------------
FENR_MAGSA      ----------------------------------------------------------------------
GLT1_SCHPO      ----------------------------------------------------------------------
GLF8_KLEPN      ----------------------------------------------------------------------
FENR_RHILO      ----------------------------------------------------------------------
TRXB_HAEIN      ----------------------------------------------------------------------
PAO_MAIZE       ----------------------------------------------------------------------
GLSN_MEDSA      ----------------------------------------------------------------------
GLF1_KLEPN      ----------------------------------------------------------------------
GLTB_BACSU      ----------------------------------------------------------------------
CZCO_BACA2      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LIDGCDGLNLSEHWERGMQAYQSVAVAGFPNLLSINGPNTSLGHNSIVYIIESQIEYILGAMDYMSAIGA
Y916_MYCBO      QLTGRDGIRIDDVWQDGPHAHQTVAIPGFPNFFMMLGPHSPVGNFPLTAVAESQAEHIVQWIKRWRHGEF
Y892_MYCTU      QLTGRDGIRIDDVWQDGPHAHQTVAIPGFPNFFMMLGPHSPVGNFPLTAVAESQAEHIVQWIKRWRHGEF
HAPMO_PSEFL     NVTGRDGVALHDVWKDDARAYLGMTVPQFPNMFCMYGPNTGLVYSTVIQFSEMTASYIVDAVRLLLEGGH
Y4ID_RHISN      EVIGRNGRTVRDVWDDDCQAYLGTVVAGFPNFFMLYGPNTALGHGSFIFTIESQIDYVLSVLRQMGEKRL
PAMO_THEFY      IIRGVGNVALKEKWAAGPRTYLGLSTAGFPNLFFIAGPGSPSALSNMLVSIEQHVEWVTDHIAYMFKNGL
CYMO_ACISP      MIQGKNGLAMKDYWKEGPSSYMGVTVNNYPNMFMVLGPNGPF--TNLPPSIESQVEWISDTIQYTVENNV
STCW_EMENI      II-GRRGVDLRDKWKTNPEAYLGLAVPDMPNYITFIGPSWPIQNGSVMAPLHSVSEYAIQFLKKMQNENI
CPNB_COMTE      IFRNNQGQSFKDVWSDGIRTQLGVATAGFPNLLFGYGPQSPAGFCNGPSSAEYQGDLLIQLMNYLRDNNI
CPNB_COMS9      IFRNNQGQSFKDVWSDGIRTQLGVATAGFPNLLFGYGPQSPAGFCNGPSSAEYQGDLLIQLMNYLRDNNI
FMO5_RAT        ----------------------------------------------------------------------
FMO2_MOUSE      ----------------------------------------------------------------------
FMO2_RABIT      ----------------------------------------------------------------------
FMO2_CAVPO      ----------------------------------------------------------------------
FMO5_RABIT      ----------------------------------------------------------------------
FMO2_RAT        ----------------------------------------------------------------------
FMO2_MACMU      ----------------------------------------------------------------------
FMO5_MOUSE      ----------------------------------------------------------------------
FMO2_PONAB      ----------------------------------------------------------------------
FMO5_CAVPO      ----------------------------------------------------------------------
FMO2_HUMAN      ----------------------------------------------------------------------
FMO2_GORGO      ----------------------------------------------------------------------
FMO2_PANTR      ----------------------------------------------------------------------
FMO3_RAT        ----------------------------------------------------------------------
FMO5_HUMAN      ----------------------------------------------------------------------
FMO3_MOUSE      ----------------------------------------------------------------------
FMO4_HUMAN      ----------------------------------------------------------------------
FMO3_CANFA      ----------------------------------------------------------------------
FMO1_HUMAN      ----------------------------------------------------------------------
FMO3_MACMU      ----------------------------------------------------------------------
FMO6_HUMAN      ----------------------------------------------------------------------
FMO3_PANTR      ----------------------------------------------------------------------
FMO1_RABIT      ----------------------------------------------------------------------
FMO3_HUMAN      ----------------------------------------------------------------------
FMO4_RABIT      ----------------------------------------------------------------------
FMO3_RABIT      ----------------------------------------------------------------------
FMO1_RAT        ----------------------------------------------------------------------
FMO4_MOUSE      ----------------------------------------------------------------------
Y968_MYCBO      TLVGAGGVTIRQAWDDGMEPYLGVAVHGFPNYFFITGPDTA-----------AQARCVVECMKLMERTAS
Y943_MYCTU      TLVGAGGVTIRQAWDDGMEPYLGVAVHGFPNYFFITGPDTA-----------AQARCVVECMKLMERTAS
FMO1_PIG        ----------------------------------------------------------------------
FMO1_CANFA      ----------------------------------------------------------------------
FMO3_BOVIN      ----------------------------------------------------------------------
FMO4_RAT        ----------------------------------------------------------------------
FMO1_MOUSE      ----------------------------------------------------------------------
FMO1_ARATH      ----------------------------------------------------------------------
GSOX3_ARATH     ----------------------------------------------------------------------
GSOX2_ARATH     ----------------------------------------------------------------------
FMO2_ARATH      ----------------------------------------------------------------------
CZCO_GEOKA      ----------------------------------------------------------------------
GSOX1_ARATH     ----------------------------------------------------------------------
GSOX4_ARATH     ----------------------------------------------------------------------
GSOX5_ARATH     ----------------------------------------------------------------------
CZCO_BACSU      ----------------------------------------------------------------------
FMO1_YEAST      ----------------------------------------------------------------------
IUCD_ECOLX      ----------------------------------------------------------------------
FENR_MAGSA      ----------------------------------------------------------------------
GLT1_SCHPO      ----------------------------------------------------------------------
GLF8_KLEPN      ----------------------------------------------------------------------
FENR_RHILO      ----------------------------------------------------------------------
TRXB_HAEIN      ----------------------------------------------------------------------
PAO_MAIZE       ----------------------------------------------------------------------
GLSN_MEDSA      ----------------------------------------------------------------------
GLF1_KLEPN      ----------------------------------------------------------------------
GLTB_BACSU      ----------------------------------------------------------------------
CZCO_BACA2      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           SIIEPTAEAEEAYVEHIQRNAVGTVWLDGGCNSWYVDQRTGRLTLIWPDFGYAFRDANGTFDAEGYEFRx
Y916_MYCBO      DTMEPKSAATEAYNTVLRAAMPNTVWTT-GCDSWYLNK--DGIPEVWPFAPAKHRAMLANLHPEEYDLR-
Y892_MYCTU      DTMEPKSAATEAYNTVLRAAMPNTVWTT-GCDSWYLNK--DGIPEVWPFAPAKHRAMLANLHPEEYDLR-
HAPMO_PSEFL     QSMEVKTPVFESYNQRVDEGNALRAWGFSKVNSWYKNSK-GRVTQNFPFTAVEFWQRTHSVEPTDYQ---
Y4ID_RHISN      VEVECRQDIYQHYNRKIQQMHQQMIWSHEGMSTFFRNDR-GRI---------------------------
PAMO_THEFY      TRSEAVLEKEDEWVEHV--NEIADETLYPMTASWYTGANVPRVFMLYVGGFHRYRQICDEVAAKGYE---
CYMO_ACISP      ESIEATKEAEEQWTQ-------------------------------------------------------
STCW_EMENI      RAWAPRQQITDRFNEHVQEWVKHTVWSD------------------------------------------
CPNB_COMTE      SRIEAQSEAQEEW---------------------------------------------------------
CPNB_COMS9      SRIEAQSEAQEEW---------------------------------------------------------
FMO5_RAT        ----------------------------------------------------------------------
FMO2_MOUSE      ----------------------------------------------------------------------
FMO2_RABIT      ----------------------------------------------------------------------
FMO2_CAVPO      ----------------------------------------------------------------------
FMO5_RABIT      ----------------------------------------------------------------------
FMO2_RAT        ----------------------------------------------------------------------
FMO2_MACMU      ----------------------------------------------------------------------
FMO5_MOUSE      ----------------------------------------------------------------------
FMO2_PONAB      ----------------------------------------------------------------------
FMO5_CAVPO      ----------------------------------------------------------------------
FMO2_HUMAN      ----------------------------------------------------------------------
FMO2_GORGO      ----------------------------------------------------------------------
FMO2_PANTR      ----------------------------------------------------------------------
FMO3_RAT        ----------------------------------------------------------------------
FMO5_HUMAN      ----------------------------------------------------------------------
FMO3_MOUSE      ----------------------------------------------------------------------
FMO4_HUMAN      ----------------------------------------------------------------------
FMO3_CANFA      ----------------------------------------------------------------------
FMO1_HUMAN      ----------------------------------------------------------------------
FMO3_MACMU      ----------------------------------------------------------------------
FMO6_HUMAN      ----------------------------------------------------------------------
FMO3_PANTR      ----------------------------------------------------------------------
FMO1_RABIT      ----------------------------------------------------------------------
FMO3_HUMAN      ----------------------------------------------------------------------
FMO4_RABIT      ----------------------------------------------------------------------
FMO3_RABIT      ----------------------------------------------------------------------
FMO1_RAT        ----------------------------------------------------------------------
FMO4_MOUSE      ----------------------------------------------------------------------
Y968_MYCBO      RRIEVRRSSQQVFNERAQ----------------------------------------------------
Y943_MYCTU      RRIEVRRSSQQVFNERAQ----------------------------------------------------
FMO1_PIG        ----------------------------------------------------------------------
FMO1_CANFA      ----------------------------------------------------------------------
FMO3_BOVIN      ----------------------------------------------------------------------
FMO4_RAT        ----------------------------------------------------------------------
FMO1_MOUSE      ----------------------------------------------------------------------
FMO1_ARATH      ----------------------------------------------------------------------
GSOX3_ARATH     ----------------------------------------------------------------------
GSOX2_ARATH     ----------------------------------------------------------------------
FMO2_ARATH      ----------------------------------------------------------------------
CZCO_GEOKA      ----------------------------------------------------------------------
GSOX1_ARATH     ----------------------------------------------------------------------
GSOX4_ARATH     ----------------------------------------------------------------------
GSOX5_ARATH     ----------------------------------------------------------------------
CZCO_BACSU      ----------------------------------------------------------------------
FMO1_YEAST      ----------------------------------------------------------------------
IUCD_ECOLX      ----------------------------------------------------------------------
FENR_MAGSA      ----------------------------------------------------------------------
GLT1_SCHPO      ----------------------------------------------------------------------
GLF8_KLEPN      ----------------------------------------------------------------------
FENR_RHILO      ----------------------------------------------------------------------
TRXB_HAEIN      ----------------------------------------------------------------------
PAO_MAIZE       ----------------------------------------------------------------------
GLSN_MEDSA      ----------------------------------------------------------------------
GLF1_KLEPN      ----------------------------------------------------------------------
GLTB_BACSU      ----------------------------------------------------------------------
CZCO_BACA2      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxx
Y916_MYCBO      ---------
Y892_MYCTU      ---------
HAPMO_PSEFL     ---------
Y4ID_RHISN      ---------
PAMO_THEFY      ---------
CYMO_ACISP      ---------
STCW_EMENI      ---------
CPNB_COMTE      ---------
CPNB_COMS9      ---------
FMO5_RAT        ---------
FMO2_MOUSE      ---------
FMO2_RABIT      ---------
FMO2_CAVPO      ---------
FMO5_RABIT      ---------
FMO2_RAT        ---------
FMO2_MACMU      ---------
FMO5_MOUSE      ---------
FMO2_PONAB      ---------
FMO5_CAVPO      ---------
FMO2_HUMAN      ---------
FMO2_GORGO      ---------
FMO2_PANTR      ---------
FMO3_RAT        ---------
FMO5_HUMAN      ---------
FMO3_MOUSE      ---------
FMO4_HUMAN      ---------
FMO3_CANFA      ---------
FMO1_HUMAN      ---------
FMO3_MACMU      ---------
FMO6_HUMAN      ---------
FMO3_PANTR      ---------
FMO1_RABIT      ---------
FMO3_HUMAN      ---------
FMO4_RABIT      ---------
FMO3_RABIT      ---------
FMO1_RAT        ---------
FMO4_MOUSE      ---------
Y968_MYCBO      ---------
Y943_MYCTU      ---------
FMO1_PIG        ---------
FMO1_CANFA      ---------
FMO3_BOVIN      ---------
FMO4_RAT        ---------
FMO1_MOUSE      ---------
FMO1_ARATH      ---------
GSOX3_ARATH     ---------
GSOX2_ARATH     ---------
FMO2_ARATH      ---------
CZCO_GEOKA      ---------
GSOX1_ARATH     ---------
GSOX4_ARATH     ---------
GSOX5_ARATH     ---------
CZCO_BACSU      ---------
FMO1_YEAST      ---------
IUCD_ECOLX      ---------
FENR_MAGSA      ---------
GLT1_SCHPO      ---------
GLF8_KLEPN      ---------
FENR_RHILO      ---------
TRXB_HAEIN      ---------
PAO_MAIZE       ---------
GLSN_MEDSA      ---------
GLF1_KLEPN      ---------
GLTB_BACSU      ---------
CZCO_BACA2      ---------