[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF55378.1

[Show Plain Result]


## Summary of Sequence Search
    1::366
    1::363     6e-66  40%  366 aa  XYLB_PSEPU RecName: Full=Aryl-alcohol dehydrogenase;       
    2::360     6e-36  29%  360 aa  FADH_AMYME RecName: Full=NAD/mycothiol-dependent formaldehyde
   11::379     8e-36  32%  379 aa  ADH4_STRCA RecName: Full=Alcohol dehydrogenase 4;       
   11::375     2e-35  34%  375 aa  ADH1B_UROHA RecName: Full=Alcohol dehydrogenase 1B;       
   12::375     1e-34  31%  375 aa  ADH1B_PANTR RecName: Full=Alcohol dehydrogenase 1B;       
   12::375     1e-34  31%  375 aa  ADH1B_HUMAN RecName: Full=Alcohol dehydrogenase 1B;       
   11::374     1e-33  28%  374 aa  ADH1_ALLMI RecName: Full=Alcohol dehydrogenase 1;       
   12::375     1e-33  30%  375 aa  ADH1A_HUMAN RecName: Full=Alcohol dehydrogenase 1A;       
   12::375     1e-33  30%  375 aa  ADH1B_PAPHA RecName: Full=Alcohol dehydrogenase 1B;       
   11::375     2e-33  28%  375 aa  ADHL_GADMO RecName: Full=Alcohol dehydrogenase class-3 chain L;    
   12::375     4e-33  33%  375 aa  ADH1G_PAPHA RecName: Full=Alcohol dehydrogenase 1C;       
   11::375     5e-33  34%  375 aa  ADH1A_UROHA RecName: Full=Alcohol dehydrogenase 1A;       
   12::380     6e-33  31%  380 aa  ADH4_HUMAN RecName: Full=Alcohol dehydrogenase 4;       
   12::375     6e-33  33%  375 aa  ADH1A_PONAB RecName: Full=Alcohol dehydrogenase 1A;       
   12::376     8e-33  29%  376 aa  ADHX_SPAAU RecName: Full=Alcohol dehydrogenase class-3;       
   11::374     1e-32  35%  374 aa  ADH1_STRCA RecName: Full=Alcohol dehydrogenase 1;       
   10::378     3e-32  34%  378 aa  FRMA_HAEIN RecName: Full=S-(hydroxymethyl)glutathione
   12::379     4e-32  29%  379 aa  ADHP_RABIT RecName: Full=Alcohol dehydrogenase class-2 isozyme 1;  
   12::375     5e-32  32%  375 aa  ADH1_MOUSE RecName: Full=Alcohol dehydrogenase 1;       
   12::375     7e-32  32%  375 aa  ADH1_PERMA RecName: Full=Alcohol dehydrogenase 1;       
   12::377     9e-32  30%  377 aa  ADH4_MOUSE RecName: Full=Alcohol dehydrogenase 4;       
   12::375     9e-32  32%  375 aa  ADH1G_HUMAN RecName: Full=Alcohol dehydrogenase 1C;       
    1::369     1e-31  33%  369 aa  FRMA_SYNY3 RecName: Full=S-(hydroxymethyl)glutathione
    1::375     1e-31  33%  375 aa  FADH_PARDE RecName: Full=S-(hydroxymethyl)glutathione
   12::375     2e-31  33%  375 aa  ADH1A_MACMU RecName: Full=Alcohol dehydrogenase 1A;       
   12::375     2e-31  35%  375 aa  ADH1_APTAU RecName: Full=Alcohol dehydrogenase 1;       
   12::375     2e-31  29%  375 aa  ADH1E_HORSE RecName: Full=Alcohol dehydrogenase E chain;       
   12::377     3e-31  29%  377 aa  ADH4_RAT RecName: Full=Alcohol dehydrogenase 4;       
    1::369     3e-31  34%  369 aa  FRMA_ECOL6 RecName: Full=S-(hydroxymethyl)glutathione
   17::297     4e-31  35%  319 aa  TERPD_PSESP RecName: Full=Probable alcohol dehydrogenase;       
    1::369     4e-31  33%  369 aa  FRMA_ECOUT RecName: Full=S-(hydroxymethyl)glutathione
    1::369     4e-31  33%  369 aa  FRMA_ECOL5 RecName: Full=S-(hydroxymethyl)glutathione
    1::369     4e-31  33%  369 aa  FRMA_ECOK1 RecName: Full=S-(hydroxymethyl)glutathione
   12::379     4e-31  31%  379 aa  ADHQ_RABIT RecName: Full=Alcohol dehydrogenase class-2 isozyme 2;  
   12::374     6e-31  36%  374 aa  ADH7_MOUSE RecName: Full=Alcohol dehydrogenase class 4 mu/sigma
   12::374     6e-31  31%  376 aa  ADH1_CHICK RecName: Full=Alcohol dehydrogenase 1;       
   12::374     8e-31  31%  374 aa  ADH7_RAT RecName: Full=Alcohol dehydrogenase class 4 mu/sigma
    1::369     1e-30  33%  369 aa  FRMA_SHISS RecName: Full=S-(hydroxymethyl)glutathione
    1::369     1e-30  33%  369 aa  FRMA_ECOLI RecName: Full=S-(hydroxymethyl)glutathione
    1::369     1e-30  33%  369 aa  FRMA_ECOLC RecName: Full=S-(hydroxymethyl)glutathione
    1::369     1e-30  33%  369 aa  FRMA_ECOHS RecName: Full=S-(hydroxymethyl)glutathione
    1::369     1e-30  33%  369 aa  FRMA_ECO57 RecName: Full=S-(hydroxymethyl)glutathione
    1::369     1e-30  33%  369 aa  FRMA_ECO24 RecName: Full=S-(hydroxymethyl)glutathione
   11::373     1e-30  30%  375 aa  ADH1_COTJA RecName: Full=Alcohol dehydrogenase 1;       
    1::376     2e-30  32%  376 aa  ADHI_RHOS4 RecName: Full=Alcohol dehydrogenase class-3;       
   12::374     3e-30  28%  374 aa  ADH1S_HORSE RecName: Full=Alcohol dehydrogenase S chain;       
   11::375     5e-30  36%  375 aa  ADH1_NAJNA RecName: Full=Alcohol dehydrogenase 1;       
    1::369     6e-30  33%  369 aa  FRMA_ECOSM RecName: Full=S-(hydroxymethyl)glutathione
   12::375     6e-30  30%  375 aa  ADH1_RABIT RecName: Full=Alcohol dehydrogenase 1;       
   11::375     8e-30  35%  375 aa  ADH1_RANPE RecName: Full=Alcohol dehydrogenase 1;       
    1::369     1e-29  33%  369 aa  FRMA_PASPI RecName: Full=S-(hydroxymethyl)glutathione
   12::375     1e-29  27%  375 aa  ADH1_GEOAT RecName: Full=Alcohol dehydrogenase 1;       
   13::381     2e-29  39%  384 aa  ADHX_CAEEL RecName: Full=Alcohol dehydrogenase class-3;       
   12::374     2e-29  29%  374 aa  ADH7_HUMAN RecName: Full=Alcohol dehydrogenase class 4 mu/sigma
   12::375     5e-29  27%  375 aa  ADH1_GEOBU RecName: Full=Alcohol dehydrogenase 1;       
    8::377     7e-29  33%  378 aa  ADHX_OCTVU RecName: Full=Alcohol dehydrogenase class-3;       
   12::374     7e-29  25%  376 aa  ADHX_MYXGL RecName: Full=Alcohol dehydrogenase class-3;       
    9::373     9e-29  29%  373 aa  ADHX_UROHA RecName: Full=Alcohol dehydrogenase class-3;       
   12::375     2e-28  27%  375 aa  ADH1_GEOKN RecName: Full=Alcohol dehydrogenase 1;       
   11::373     3e-28  30%  375 aa  ADH1_GADCA RecName: Full=Alcohol dehydrogenase 1;       
   13::379     4e-28  31%  379 aa  ADHX_DROME RecName: Full=Alcohol dehydrogenase class-3;       
   13::386     5e-28  30%  394 aa  ADHL3_ARATH RecName: Full=Alcohol dehydrogenase-like 3;       
   11::375     8e-28  29%  375 aa  ADHH_GADMO RecName: Full=Alcohol dehydrogenase class-3 chain H;    
   10::372     1e-27  26%  374 aa  ADHX_HORSE RecName: Full=Alcohol dehydrogenase class-3;       
   14::378     4e-27  27%  381 aa  FADH_CANMA RecName: Full=S-(hydroxymethyl)glutathione
   10::380     7e-27  27%  386 aa  FADH_YEAST RecName: Full=S-(hydroxymethyl)glutathione
   12::376     1e-26  31%  376 aa  ADH1_RAT RecName: Full=Alcohol dehydrogenase 1;       
   10::372     2e-26  28%  374 aa  ADHX_RABIT RecName: Full=Alcohol dehydrogenase class-3;       
   12::377     2e-26  31%  379 aa  ADHX_DICDI RecName: Full=Alcohol dehydrogenase class-3;       
   10::372     3e-26  28%  374 aa  ADHX_RAT RecName: Full=Alcohol dehydrogenase class-3;       
   12::373     3e-26  30%  375 aa  ADH6_PONAB RecName: Full=Alcohol dehydrogenase 6;       
   13::376     3e-26  30%  380 aa  ADH1_PEA RecName: Full=Alcohol dehydrogenase 1;         EC=1.1.1.1;
   12::377     3e-26  32%  379 aa  FADH_PICPA RecName: Full=S-(hydroxymethyl)glutathione
   12::373     3e-26  27%  373 aa  ADH8_RANPE RecName: Full=NADP-dependent alcohol dehydrogenase;     
   11::374     7e-26  27%  378 aa  ADHX_PEA RecName: Full=Alcohol dehydrogenase class-3;       
   14::364     1e-25  27%  381 aa  ADHX_ORYSJ RecName: Full=Alcohol dehydrogenase class-3;       
   14::364     1e-25  27%  381 aa  ADHX_ORYSI RecName: Full=Alcohol dehydrogenase class-3;       
   10::372     2e-25  28%  374 aa  ADHX_MOUSE RecName: Full=Alcohol dehydrogenase class-3;       
   10::372     2e-25  28%  374 aa  ADHX_BOVIN RecName: Full=Alcohol dehydrogenase class-3;       
   13::376     2e-25  30%  380 aa  ADH1_TRIRP RecName: Full=Alcohol dehydrogenase 1;       
   12::359     2e-25  31%  368 aa  ADH6_HUMAN RecName: Full=Alcohol dehydrogenase 6;       
   12::373     3e-25  31%  378 aa  FADH1_SCHPO RecName: Full=Probable S-(hydroxymethyl)glutathione
   14::364     3e-25  31%  381 aa  ADHX_MAIZE RecName: Full=Alcohol dehydrogenase class-3;       
   18::380     5e-25  24%  381 aa  ADHL6_ARATH RecName: Full=Alcohol dehydrogenase-like 6;       
   12::376     6e-25  30%  379 aa  ADH1_ARATH RecName: Full=Alcohol dehydrogenase class-P;       
   21::387     8e-25  24%  390 aa  ADHL7_ARATH RecName: Full=Alcohol dehydrogenase-like 7;       
   10::372     1e-24  28%  374 aa  ADHX_HUMAN RecName: Full=Alcohol dehydrogenase class-3;       
   12::362     1e-24  27%  379 aa  ADHX_ARATH RecName: Full=Alcohol dehydrogenase class-3;       
   15::380     2e-23  27%  380 aa  FADH2_SCHPO RecName: Full=Putative S-(hydroxymethyl)glutathione
   12::373     2e-23  27%  375 aa  ADH6_PERMA RecName: Full=Alcohol dehydrogenase 6;       
   12::374     8e-23  25%  379 aa  ADH3_HORVU RecName: Full=Alcohol dehydrogenase 3;       
    1::370     1e-22  27%  375 aa  ADHB_MYCTU RecName: Full=Alcohol dehydrogenase B;       
    1::370     1e-22  27%  375 aa  ADHB_MYCBO RecName: Full=Alcohol dehydrogenase B;       
   14::379     1e-22  33%  382 aa  ADH1_PETHY RecName: Full=Alcohol dehydrogenase 1;       
   12::375     2e-22  32%  379 aa  ADH1_PENAM RecName: Full=Alcohol dehydrogenase 1;       
   16::382     5e-22  29%  386 aa  ADHL2_ARATH RecName: Full=Alcohol dehydrogenase-like 2;       
   12::375     6e-22  32%  379 aa  ADH1_MAIZE RecName: Full=Alcohol dehydrogenase 1;       
   12::369     8e-22  26%  373 aa  ADH2_HORVU RecName: Full=Alcohol dehydrogenase 2;       
   21::374     1e-21  35%  376 aa  ADH6_RAT RecName: Full=Alcohol dehydrogenase 6;         EC=1.1.1.1;
   12::375     2e-21  25%  379 aa  ADH2_MAIZE RecName: Full=Alcohol dehydrogenase 2;       
   12::375     3e-21  31%  379 aa  ADH1_ORYSJ RecName: Full=Alcohol dehydrogenase 1;       
   12::375     3e-21  31%  379 aa  ADH1_ORYSI RecName: Full=Alcohol dehydrogenase 1;       
   12::378     5e-21  34%  380 aa  ADHL4_ARATH RecName: Full=Alcohol dehydrogenase-like 4;       
   13::377     5e-21  33%  380 aa  ADH1_SOLTU RecName: Full=Alcohol dehydrogenase 1;       
   12::375     9e-21  32%  379 aa  ADH1_HORVU RecName: Full=Alcohol dehydrogenase 1;       
   13::377     1e-20  32%  380 aa  ADH3_SOLTU RecName: Full=Alcohol dehydrogenase 3;       
   13::377     1e-20  32%  380 aa  ADH2_SOLTU RecName: Full=Alcohol dehydrogenase 2;       
   18::384     2e-20  28%  388 aa  ADHL1_ARATH RecName: Full=Alcohol dehydrogenase-like 1;       
   13::377     3e-20  32%  380 aa  ADH2_SOLLC RecName: Full=Alcohol dehydrogenase 2;       
   19::385     6e-20  29%  389 aa  ADHL5_ARATH RecName: Full=Alcohol dehydrogenase-like 5;       
   13::376     1e-19  29%  380 aa  ADH_MALDO RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   13::377     2e-19  31%  380 aa  ADH_FRAAN RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   12::375     4e-18  23%  379 aa  ADH2_ORYSJ RecName: Full=Alcohol dehydrogenase 2;       
   12::375     4e-18  23%  379 aa  ADH2_ORYSI RecName: Full=Alcohol dehydrogenase 2;       
    3::328     1e-17  32%  337 aa  ADH1_BACST RecName: Full=Alcohol dehydrogenase;       
    3::328     2e-16  32%  339 aa  ADH3_BACST RecName: Full=Alcohol dehydrogenase;       
    3::328     4e-16  26%  339 aa  ADH2_BACST RecName: Full=Alcohol dehydrogenase;         Short=ADH; 
   14::289     7e-16  35%  293 aa  ADH1_ZEALU RecName: Full=Alcohol dehydrogenase 1;       
    3::185     4e-14  31%  185 aa  ADH1_ANAPL RecName: Full=Alcohol dehydrogenase 1;       
    7::275     4e-13  31%  353 aa  DHSO_BACSU RecName: Full=Sorbitol dehydrogenase;       
  161::315     8e-12  30%  346 aa  BDHA_BACSU RecName: Full=(R,R)-butanediol dehydrogenase;       
    7::338     5e-11  25%  339 aa  YJMD_BACSU RecName: Full=Uncharacterized zinc-type alcohol
   23::241     5e-11  29%  336 aa  ADH_STAAW RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   23::241     5e-11  29%  336 aa  ADH_STAAS RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   23::241     5e-11  29%  336 aa  ADH_STAAR RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   23::241     5e-11  29%  336 aa  ADH_STAAN RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   23::241     5e-11  29%  336 aa  ADH_STAAM RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   23::241     5e-11  29%  336 aa  ADH_STAAC RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   23::241     5e-11  29%  336 aa  ADH_STAAB RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   23::241     5e-11  29%  336 aa  ADH_STAA8 RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   23::241     5e-11  29%  336 aa  ADH_STAA3 RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
  198::332     3e-10  30%  338 aa  XYLD_MORMO RecName: Full=D-xylulose reductase;       
   89::340     5e-09  22%  341 aa  TDH_SHEON RecName: Full=L-threonine 3-dehydrogenase;       
   15::343     6e-09  24%  347 aa  YDJJ_ECOLI RecName: Full=Uncharacterized zinc-type alcohol
   89::340     1e-08  22%  341 aa  TDH_SHEPC RecName: Full=L-threonine 3-dehydrogenase;       
   97::270     1e-08  39%  347 aa  TDH_BACA2 RecName: Full=L-threonine 3-dehydrogenase;       
   19::241     1e-08  30%  340 aa  ADH_STAES RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   89::265     2e-08  24%  341 aa  TDH_SHEWM RecName: Full=L-threonine 3-dehydrogenase;       
   89::340     2e-08  21%  341 aa  TDH_SHESR RecName: Full=L-threonine 3-dehydrogenase;       
   89::340     2e-08  21%  341 aa  TDH_SHESM RecName: Full=L-threonine 3-dehydrogenase;       
   89::340     2e-08  21%  341 aa  TDH_SHESA RecName: Full=L-threonine 3-dehydrogenase;       
   89::280     2e-08  24%  341 aa  TDH_SHEB9 RecName: Full=L-threonine 3-dehydrogenase;       
   89::266     2e-08  24%  341 aa  TDH_SHEB8 RecName: Full=L-threonine 3-dehydrogenase;       
   89::280     2e-08  24%  341 aa  TDH_SHEB5 RecName: Full=L-threonine 3-dehydrogenase;       
   89::280     2e-08  24%  341 aa  TDH_SHEB2 RecName: Full=L-threonine 3-dehydrogenase;       
   89::280     3e-08  23%  341 aa  TDH_SHESW RecName: Full=L-threonine 3-dehydrogenase;       
   19::241     3e-08  30%  340 aa  ADH_STAEQ RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
  205::352     4e-08  35%  353 aa  YPHC_ECOLI RecName: Full=Uncharacterized zinc-type alcohol
   89::280     4e-08  24%  341 aa  TDH_SHESH RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     4e-08  23%  341 aa  TDH_SHEPA RecName: Full=L-threonine 3-dehydrogenase;       
   89::280     4e-08  23%  341 aa  TDH_SHEHH RecName: Full=L-threonine 3-dehydrogenase;       
   89::280     4e-08  24%  341 aa  TDH_SHEAM RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     9e-08  24%  341 aa  TDH_SHELP RecName: Full=L-threonine 3-dehydrogenase;       
   97::274     9e-08  25%  344 aa  TDH_MESSB RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     9e-08  24%  343 aa  DHSO_BACHD RecName: Full=Sorbitol dehydrogenase;       
   97::269     1e-07  36%  346 aa  TDH_BACLD RecName: Full=L-threonine 3-dehydrogenase;       
   17::365     1e-07  24%  366 aa  ADH_RALEU RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   89::265     3e-07  24%  341 aa  TDH_CHRVO RecName: Full=L-threonine 3-dehydrogenase;       
   77::257     3e-07  27%  378 aa  ADHB_BACSU RecName: Full=Uncharacterized zinc-type alcohol
   46::313     4e-07  34%  374 aa  ADH3_KLULA RecName: Full=Alcohol dehydrogenase 3, mitochondrial;   
   18::267     6e-07  31%  348 aa  TDH_PYRAB RecName: Full=Probable L-threonine 3-dehydrogenase;      
    1::136     8e-07  26%  349 aa  YAHK_ECOLI RecName: Full=Uncharacterized zinc-type alcohol
  206::278     8e-07  39%  363 aa  XYL2_PICST RecName: Full=D-xylulose reductase;       
   89::265     8e-07  23%  341 aa  TDH_SHEFN RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     8e-07  23%  341 aa  TDH_PSEHT RecName: Full=L-threonine 3-dehydrogenase;       
   89::266     8e-07  23%  340 aa  TDH_PSEA6 RecName: Full=L-threonine 3-dehydrogenase;       
   24::272     8e-07  30%  348 aa  ADH2_KLULA RecName: Full=Alcohol dehydrogenase 2;       
   89::265     1e-06  23%  341 aa  TDH_PHOLL RecName: Full=L-threonine 3-dehydrogenase;       
   18::267     1e-06  29%  348 aa  TDH_PYRHO RecName: Full=Probable L-threonine 3-dehydrogenase;      
   98::270     1e-06  36%  347 aa  TDH_BACSU RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     1e-06  24%  341 aa  TDH_ALTMD RecName: Full=L-threonine 3-dehydrogenase;       
   26::274     1e-06  35%  350 aa  ADH1_KLULA RecName: Full=Alcohol dehydrogenase 1;       
   89::337     2e-06  23%  341 aa  TDH_YERPY RecName: Full=L-threonine 3-dehydrogenase;       
   89::337     2e-06  23%  341 aa  TDH_YERPS RecName: Full=L-threonine 3-dehydrogenase;       
   89::337     2e-06  23%  341 aa  TDH_YERPP RecName: Full=L-threonine 3-dehydrogenase;       
   89::337     2e-06  23%  341 aa  TDH_YERPN RecName: Full=L-threonine 3-dehydrogenase;       
   89::337     2e-06  23%  341 aa  TDH_YERPG RecName: Full=L-threonine 3-dehydrogenase;       
   89::337     2e-06  23%  341 aa  TDH_YERPE RecName: Full=L-threonine 3-dehydrogenase;       
   89::337     2e-06  23%  341 aa  TDH_YERPB RecName: Full=L-threonine 3-dehydrogenase;       
   89::337     2e-06  23%  341 aa  TDH_YERPA RecName: Full=L-threonine 3-dehydrogenase;       
   89::337     2e-06  23%  341 aa  TDH_YERP3 RecName: Full=L-threonine 3-dehydrogenase;       
    7::269     2e-06  26%  347 aa  TDH_THETN RecName: Full=L-threonine 3-dehydrogenase;       
   89::338     2e-06  21%  343 aa  TDH_BURXL RecName: Full=L-threonine 3-dehydrogenase;       
   89::338     2e-06  21%  343 aa  TDH_BURPP RecName: Full=L-threonine 3-dehydrogenase;       
   89::338     2e-06  21%  342 aa  TDH_BURP8 RecName: Full=L-threonine 3-dehydrogenase;       
   26::224     2e-06  24%  336 aa  ADHP_ECOLI RecName: Full=Alcohol dehydrogenase,
   31::275     2e-06  36%  350 aa  ADH1_CANAL RecName: Full=Alcohol dehydrogenase 1;       
  209::339     3e-06  29%  343 aa  TDH_THET8 RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     3e-06  22%  341 aa  TDH_SHISS RecName: Full=L-threonine 3-dehydrogenase;       
   18::267     3e-06  30%  348 aa  TDH_PYRFU RecName: Full=Probable L-threonine 3-dehydrogenase;      
   94::289     3e-06  27%  351 aa  TDH_FRATN RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     3e-06  23%  341 aa  TDH_CITK8 RecName: Full=L-threonine 3-dehydrogenase;       
   89::338     3e-06  21%  343 aa  TDH_BURPS RecName: Full=L-threonine 3-dehydrogenase;       
   89::338     3e-06  21%  343 aa  TDH_BURP6 RecName: Full=L-threonine 3-dehydrogenase;       
   89::338     3e-06  21%  343 aa  TDH_BURP1 RecName: Full=L-threonine 3-dehydrogenase;       
   89::338     3e-06  21%  343 aa  TDH_BURP0 RecName: Full=L-threonine 3-dehydrogenase;       
   89::338     3e-06  21%  343 aa  TDH_BURMS RecName: Full=L-threonine 3-dehydrogenase;       
   89::338     3e-06  21%  343 aa  TDH_BURMA RecName: Full=L-threonine 3-dehydrogenase;       
   89::338     3e-06  21%  343 aa  TDH_BURM9 RecName: Full=L-threonine 3-dehydrogenase;       
   89::338     3e-06  21%  343 aa  TDH_BURM7 RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     3e-06  22%  342 aa  TDH_AERS4 RecName: Full=L-threonine 3-dehydrogenase;       
    1::261     3e-06  23%  337 aa  ADH1_ZYMMO RecName: Full=Alcohol dehydrogenase 1;       
  198::345     4e-06  30%  351 aa  TDH_SYMTH RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     4e-06  23%  341 aa  TDH_SALAR RecName: Full=L-threonine 3-dehydrogenase;       
   89::337     4e-06  28%  341 aa  TDH_PROMH RecName: Full=L-threonine 3-dehydrogenase;       
   94::289     4e-06  27%  351 aa  TDH_FRATW RecName: Full=L-threonine 3-dehydrogenase;       
   94::289     4e-06  27%  351 aa  TDH_FRATT RecName: Full=L-threonine 3-dehydrogenase;       
   94::289     4e-06  27%  351 aa  TDH_FRATO RecName: Full=L-threonine 3-dehydrogenase;       
   94::289     4e-06  27%  351 aa  TDH_FRATM RecName: Full=L-threonine 3-dehydrogenase;       
   94::289     4e-06  27%  351 aa  TDH_FRATH RecName: Full=L-threonine 3-dehydrogenase;       
   94::289     4e-06  27%  351 aa  TDH_FRATF RecName: Full=L-threonine 3-dehydrogenase;       
   94::289     4e-06  27%  351 aa  TDH_FRAT1 RecName: Full=L-threonine 3-dehydrogenase;       
  209::339     5e-06  28%  343 aa  TDH_THET2 RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     5e-06  31%  341 aa  TDH_IDILO RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     5e-06  22%  341 aa  TDH_ECOLU RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  22%  341 aa  TDH_YERE8 RecName: Full=L-threonine 3-dehydrogenase;       
   91::267     6e-06  22%  343 aa  TDH_VIBPA RecName: Full=L-threonine 3-dehydrogenase;       
    1::266     6e-06  31%  342 aa  TDH_STRCO RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  22%  341 aa  TDH_SHIFL RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  22%  341 aa  TDH_SHIF8 RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  22%  341 aa  TDH_SHIBS RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  22%  341 aa  TDH_SHIB3 RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  23%  341 aa  TDH_SALTY RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  23%  341 aa  TDH_SALTI RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  23%  341 aa  TDH_SALSV RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  23%  341 aa  TDH_SALPK RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  23%  341 aa  TDH_SALPC RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  23%  341 aa  TDH_SALPB RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  23%  341 aa  TDH_SALPA RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  23%  341 aa  TDH_SALNS RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  23%  341 aa  TDH_SALHS RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  23%  341 aa  TDH_SALEP RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  23%  341 aa  TDH_SALDC RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  23%  341 aa  TDH_SALCH RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  23%  341 aa  TDH_SALA4 RecName: Full=L-threonine 3-dehydrogenase;       
   97::274     6e-06  22%  345 aa  TDH_RHIL3 RecName: Full=L-threonine 3-dehydrogenase;       
   18::267     6e-06  29%  350 aa  TDH_PYRKO RecName: Full=Probable L-threonine 3-dehydrogenase;      
   89::265     6e-06  22%  341 aa  TDH_ENTS8 RecName: Full=L-threonine 3-dehydrogenase;       
   89::267     6e-06  22%  341 aa  TDH_EDWI9 RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  22%  341 aa  TDH_ECOUT RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  22%  341 aa  TDH_ECOSM RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  22%  341 aa  TDH_ECOSE RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  22%  341 aa  TDH_ECOLI RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  22%  341 aa  TDH_ECOLC RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  22%  341 aa  TDH_ECOL6 RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  22%  341 aa  TDH_ECOL5 RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  22%  341 aa  TDH_ECOK1 RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  22%  341 aa  TDH_ECOHS RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  22%  341 aa  TDH_ECODH RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  22%  341 aa  TDH_ECOBW RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  22%  341 aa  TDH_ECO8A RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  22%  341 aa  TDH_ECO81 RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  22%  341 aa  TDH_ECO7I RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  22%  341 aa  TDH_ECO5E RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  22%  341 aa  TDH_ECO57 RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  22%  341 aa  TDH_ECO55 RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  22%  341 aa  TDH_ECO45 RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     6e-06  22%  341 aa  TDH_ECO27 RecName: Full=L-threonine 3-dehydrogenase;       
   89::338     6e-06  21%  342 aa  TDH_BURVG RecName: Full=L-threonine 3-dehydrogenase;       
    1::267     6e-06  26%  340 aa  ADHA_RHIME RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   89::338     8e-06  21%  343 aa  TDH_BURTA RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     8e-06  22%  342 aa  TDH_AERHH RecName: Full=L-threonine 3-dehydrogenase;       
   81::329     8e-06  25%  334 aa  QOR_YEAST RecName: Full=Probable quinone oxidoreductase;       
  200::335     8e-06  31%  344 aa  ADH_SULAC RecName: Full=NAD-dependent alcohol dehydrogenase;       
  195::266     1e-05  32%  342 aa  Y053_HAEIN RecName: Full=Uncharacterized zinc-type alcohol
   89::265     1e-05  22%  341 aa  TDH_ECO24 RecName: Full=L-threonine 3-dehydrogenase;       
   89::338     1e-05  21%  342 aa  TDH_BURS3 RecName: Full=L-threonine 3-dehydrogenase;       
   89::338     1e-05  21%  342 aa  TDH_BURCJ RecName: Full=L-threonine 3-dehydrogenase;       
   89::338     1e-05  21%  342 aa  TDH_BURCH RecName: Full=L-threonine 3-dehydrogenase;       
   89::338     1e-05  21%  342 aa  TDH_BURCC RecName: Full=L-threonine 3-dehydrogenase;       
   89::338     1e-05  21%  342 aa  TDH_BURCA RecName: Full=L-threonine 3-dehydrogenase;       
   89::338     1e-05  21%  342 aa  TDH_BURA4 RecName: Full=L-threonine 3-dehydrogenase;       
  214::277     1e-05  37%  358 aa  YDJL_ECOLI RecName: Full=Uncharacterized zinc-type alcohol
  204::277     1e-05  33%  350 aa  TDH_THEON RecName: Full=Probable L-threonine 3-dehydrogenase;      
   97::274     1e-05  21%  345 aa  TDH_RHIEC RecName: Full=L-threonine 3-dehydrogenase;       
   97::274     1e-05  21%  345 aa  TDH_RHIE6 RecName: Full=L-threonine 3-dehydrogenase;       
   94::289     1e-05  26%  351 aa  TDH_FRAP2 RecName: Full=L-threonine 3-dehydrogenase;       
   89::338     1e-05  21%  342 aa  TDH_BURM1 RecName: Full=L-threonine 3-dehydrogenase;       
   89::338     1e-05  20%  342 aa  TDH_BURCM RecName: Full=L-threonine 3-dehydrogenase;       
  204::348     1e-05  30%  357 aa  DHSO_MOUSE RecName: Full=Sorbitol dehydrogenase;       
  199::344     1e-05  30%  348 aa  DHSO_BOMMO RecName: Full=Sorbitol dehydrogenase;       
  167::276     1e-05  30%  357 aa  DHSO2_YEAST RecName: Full=Sorbitol dehydrogenase 2;       
  167::276     1e-05  30%  357 aa  DHSO1_YEAST RecName: Full=Sorbitol dehydrogenase 1;       
    6::274     1e-05  30%  349 aa  ADHA_BACSU RecName: Full=Probable formaldehyde dehydrogenase adhA; 
   89::265     2e-05  22%  341 aa  TDH_SERP5 RecName: Full=L-threonine 3-dehydrogenase;       
   97::274     2e-05  22%  345 aa  TDH_RHISN RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     2e-05  22%  341 aa  TDH_KLEP7 RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     2e-05  22%  341 aa  TDH_KLEP3 RecName: Full=L-threonine 3-dehydrogenase;       
   26::275     2e-05  30%  350 aa  ADH_SCHPO RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   89::265     2e-05  22%  341 aa  TDH_COLP3 RecName: Full=L-threonine 3-dehydrogenase;       
   91::267     3e-05  20%  343 aa  TDH_VIBCM RecName: Full=L-threonine 3-dehydrogenase;       
   91::267     3e-05  20%  343 aa  TDH_VIBCH RecName: Full=L-threonine 3-dehydrogenase;       
   91::267     3e-05  20%  343 aa  TDH_VIBC3 RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     3e-05  22%  341 aa  TDH_ENT38 RecName: Full=L-threonine 3-dehydrogenase;       
   97::274     3e-05  21%  345 aa  TDH_AGRRK RecName: Full=L-threonine 3-dehydrogenase;       
   93::268     4e-05  27%  340 aa  TDH_STRMK RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     4e-05  22%  341 aa  TDH_SALG2 RecName: Full=L-threonine 3-dehydrogenase;       
   97::274     4e-05  22%  344 aa  TDH_RHIME RecName: Full=L-threonine 3-dehydrogenase;       
   89::267     4e-05  23%  344 aa  TDH_DEIDV RecName: Full=L-threonine 3-dehydrogenase;       
  214::356     4e-05  30%  366 aa  IDND_VITVI RecName: Full=L-idonate 5-dehydrogenase;       
  203::348     4e-05  28%  357 aa  DHSO_RAT RecName: Full=Sorbitol dehydrogenase;       
   97::274     5e-05  21%  345 aa  TDH_RHILW RecName: Full=L-threonine 3-dehydrogenase;       
  202::330     5e-05  29%  347 aa  ADH_SULSR RecName: Full=NAD-dependent alcohol dehydrogenase;       
  188::269     7e-05  33%  350 aa  YCJQ_SHIFL RecName: Full=Uncharacterized zinc-type alcohol
  188::269     7e-05  33%  350 aa  YCJQ_ECOLI RecName: Full=Uncharacterized zinc-type alcohol
   91::267     7e-05  22%  343 aa  TDH_PHOPR RecName: Full=L-threonine 3-dehydrogenase;       
   97::274     9e-05  23%  344 aa  TDH_RHILO RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     1e-04  20%  361 aa  TDH_ERWCT RecName: Full=L-threonine 3-dehydrogenase;       
   28::149     2e-04  28%  363 aa  MTDH3_STYHU RecName: Full=Probable mannitol dehydrogenase 3;       
  202::246     2e-04  39%  347 aa  ADH_SULTO RecName: Full=NAD-dependent alcohol dehydrogenase;       
   97::274     3e-04  21%  344 aa  TDH_SINMW RecName: Full=L-threonine 3-dehydrogenase;       
    1::39      3e-04  41%   41 aa  ADHN_AMYME RecName: Full=NDMA-dependent alcohol dehydrogenase;   
  106::210     4e-04  38%  439 aa  CAD8C_ORYSJ RecName: Full=Probable cinnamyl alcohol dehydrogenase
  199::264     5e-04  34%  346 aa  YGD6_SCHPO RecName: Full=Zinc-type alcohol dehydrogenase-like
  195::265     5e-04  26%  343 aa  TDH_PECCP RecName: Full=L-threonine 3-dehydrogenase;       
  195::265     5e-04  26%  341 aa  TDH_MARMS RecName: Full=L-threonine 3-dehydrogenase;       
  118::268     6e-04  37%  342 aa  TDH_SILPO RecName: Full=L-threonine 3-dehydrogenase;       
  197::340     6e-04  20%  344 aa  TDH_PSYIN RecName: Full=L-threonine 3-dehydrogenase;       
  214::347     6e-04  26%  365 aa  QORL2_NEMVE RecName: Full=Quinone oxidoreductase-like protein 2
   89::265     8e-04  22%  342 aa  TDH_COXBU RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     8e-04  22%  342 aa  TDH_COXBR RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     8e-04  22%  342 aa  TDH_COXBN RecName: Full=L-threonine 3-dehydrogenase;       
   89::265     8e-04  22%  342 aa  TDH_COXB2 RecName: Full=L-threonine 3-dehydrogenase;       
    1::109     8e-04  26%  346 aa  ADHC_MYCTU RecName: Full=NADP-dependent alcohol dehydrogenase C;   
    1::109     8e-04  26%  346 aa  ADHC_MYCBO RecName: Full=NADP-dependent alcohol dehydrogenase C;   
    1::366

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQTLAAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPXXXXXXXXXXXXXX
XYLB_PSEPU      MEIKAAIVRQKNGPFLLEHVALNEPAEDQVLVRLVATGLCHTDLVCRDQHYPVPLPMVFGHEGAGVVERV
FADH_AMYME      -QTVRGVIARSKAPVELTDIVIPDPGPSEVTALIATCAVCHTDLTYREGGINDEFPFLLGHEAAGTVESV
ADH4_STRCA      ----AAIAWEAGKPLSVEEIEVSPPKDHEVRVKIVATGVCRTD---EHAINPSFFPVILGHEGAGIVESI
ADH1B_UROHA     ----AAVVWEPKKPFSIVEIEVAPPKAHEVRIKILASGICRSDDHVLSGALKVNFPIILXXXXXXXXXXX
ADH1B_PANTR     ----AAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICRTDDHVVSGNLVTPLPAILGHEAAGIVESV
ADH1B_HUMAN     ----AAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICRTDDHVVSGNLVTPLPVILGHEAAGIVESV
ADH1_ALLMI      ----AAITWEIKKPFSIEEIEVAPPKAHEVRIKILATGICRSDDHVTAGLLTMPLPMILGHEAAGVVEST
ADH1A_HUMAN     ----AAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAVGICGTDDHVVSGTMVTPLPVILGHEAAGIVESV
ADH1B_PAPHA     ----AAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICRTDDHVVSGNLVSPLPAILGHEAAGIVESV
ADHL_GADMO      ----AAVAWEAGKPLSMEEVEVAPPQAGEVRIKIVATGICHTDAYTLSGSDPEVFPSVLGHEGAGIVESV
ADH1G_PAPHA     ----AAVLWEVKKPFSIEEVEVAPPKAHEVRIKMVAVGICRSDDHVVSGTLVTPLPAILGHEAAXXXXXX
ADH1A_UROHA     ----AAIAWEIKKPLSIEQIEVAPPKAHEVRIKILATGICRSDDHVISGAFKMPLPMVLXXXXXXXXXXX
ADH4_HUMAN      ----AAIAWEAGKPLCIEEVEVAPPKAHEVRIQIIATSLCHTDATVIDSKFEGLFPVIVGHEAAGIVESI
ADH1A_PONAB     ----AAVLWELKKPFSIEEVEVAPPKAQEVRIKMVAVGICGTDDHVVSGTMVTPLPAILGHEAAGIVESV
ADHX_SPAAU      ----AAVAWEPGKPLSIEEVEVAPPNAHEVRIKLFATGVCHTDAYTLSGSDPEGLPVILGHEGAGTVESV
ADH1_STRCA      ----AAVLWEPKKPFSIEEVEVAPPKAHEVRVKIIATGICRSDDHVISGVLVMPFPIILGHXXXXXXXXX
FRMA_HAEIN      IKSRAAVAFAPNQPLQIVEIDVEMPRKGEVLIRNTHTGVCHTDAFTLSGSDPEVFPXXXXXXXXXXXXXX
ADHP_RABIT      ----AAIAWEAGKPLSIEEVEVAPPKAHEVRVQINAAGLCRSDTVINPKFEGAFLPVILGHEGAGIVESV
ADH1_MOUSE      ----AAVLWELHKPFTIEDIEVAPPKAHEVRIKMVATGVCRSDDHVVSGTLVTPLPAVLGHEGAGIVESV
ADH1_PERMA      ----AAVLWEPHKPFSIEDIEVAPPKAHEVRIKMVATGVCRSDDHVVSRSLASPLPAVLGHEGAGIVESV
ADH4_MOUSE      ----AAIAWKTGSPLCIEEIEVSPPKACEVRIQVIATCVCPTDINATDPKKKALFPVVLGHECAGIVESV
ADH1G_HUMAN     ----AAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDEHVVSGNLVTPLPVILGHEAAGIVESV
FRMA_SYNY3      MKSRAAVAFEVGKPLQIVEIDVAPPQQGEVLVKITHTGVCHTDAFTLSGDDPEGLPVVLXXXXXXXXXXX
FADH_PARDE      MRTRAAVALEAGKPLEVMEVNLEGPKAGEVMVEIKATGICHTDEFTLSGADPEGLPSILXXXXXXXXXXX
ADH1A_MACMU     ----AAVLWEVMKPFSIEDVEVAPPKAYEVRIKMVTVGICGTDDHVVSGTMVTPLPVILGHEAAXXXXXX
ADH1_APTAU      ----AAVLWEPKKPFSIEEVEVAPPKAHEVRIKILATGICRSDDHVITGALVRPFPIILGHXXXXXXXXX
ADH1E_HORSE     ----AAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTPLPVIAGHEAAGIVESI
ADH4_RAT        ----AAIAWKTDSPLCIEEIEVSPPKAHEVRIKVIATCVCPTDINATNPKKKALFPVVLGHECAGIVESV
FRMA_ECOL6      MKSRAAVAFAPGKPLEIVEIDVAPPKKGEVLIKVTHTGVCHTDAFTLSGDDPEVFPXXXXXXXXXXXXXX
TERPD_PSESP     --------------------------------------VCHTDLAIKDGVLPFPLPAVLGHEGSGIVEAV
FRMA_ECOUT      MKSRAAVAFAPGKPLEIVEIDVAPPKKGEVLIKVTHTGVCHTDAFTLSGDDPEVFPXXXXXXXXXXXXXX
FRMA_ECOL5      MKSRAAVAFAPGKPLEIVEIDVAPPKKGEVLIKVTHTGVCHTDAFTLSGDDPEVFPXXXXXXXXXXXXXX
FRMA_ECOK1      MKSRAAVAFAPGKPLEIVEIDVAPPKKGEVLIKVTHTGVCHTDAFTLSGDDPEVFPXXXXXXXXXXXXXX
ADHQ_RABIT      ----AAIAWEAGKPLSIEEVEVAPPKAHEVRVQIIAASVCRSDTYV---INPAFLPVILGHECAGIVESV
ADH7_MOUSE      ----AAVLWGVNQPFSIEEIEVAPPKAKEVRVKILATGICRTDHIIKGSMVSKF-PVIXXXXXXXXXXXX
ADH1_CHICK      ----AAVLWEANKPFSLEEVEVAPPKAHEVRIKIVATGICRSDDHVVTGALAMPFPIILGHEAAGVIESV
ADH7_RAT        ----AAVLWGTNQPFSIEDIEVAPPKAKEVRVKILATGICGTDDHVIKGTMVSKFPVIVGHEAVGIVESV
FRMA_SHISS      MKSRAAVAFAPGKPLEIVEIDVAPPKKGEVLIKVTHTGVCHTDAFTLSGDDPEVFPXXXXXXXXXXXXXX
FRMA_ECOLI      MKSRAAVAFAPGKPLEIVEIDVAPPKKGEVLIKVTHTGVCHTDAFTLSGDDPEVFPXXXXXXXXXXXXXX
FRMA_ECOLC      MKSRAAVAFAPGKPLEIVEIDVAPPKKGEVLIKVTHTGVCHTDAFTLSGDDPEVFPXXXXXXXXXXXXXX
FRMA_ECOHS      MKSRAAVAFAPGKPLEIVEIDVAPPKKGEVLIKVTHTGVCHTDAFTLSGDDPEVFPXXXXXXXXXXXXXX
FRMA_ECO57      MKSRAAVAFAPGKPLEIVEIDVAPPKKGEVLIKVTHTGVCHTDAFTLSGDDPEVFPXXXXXXXXXXXXXX
FRMA_ECO24      MKSRAAVAFAPGKPLEIVEIDVAPPKKGEVLIKVTHTGVCHTDAFTLSGDDPEVFPXXXXXXXXXXXXXX
ADH1_COTJA      ----AAVLWEANKPFSLEEVEVAPPKAHEVRIKIVATGICRSDDHVVTGALAMPFPVILGHEAAGVVESV
ADHI_RHOS4      MRTRAAVAVEAGKPLEIMEVNLEGPKAGEVMVEIKATGICHTDEFTLSGADPEMFPAILXXXXXXXXXXX
ADH1S_HORSE     ----AAVLWEQKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDDHVVSGTLVAPLPVIAGHEAAGIVESI
ADH1_NAJNA      ----AAIAWELNKPLSIEQIEVAPPKAHEVRIKILATGVCRSDEHVISGAFRMPLPMVLXXXXXXXXXXX
FRMA_ECOSM      MKSRAAVAFAPGKPLEIVEIDVAPPKKGEVLIKVTHTGVCHTDAFTLSGDDPEVFPXXXXXXXXXXXXXX
ADH1_RABIT      ----AAVLWQLNKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHAVTGSIAVPLPVILGHEAAGIVESI
ADH1_RANPE      ----AAVCWGPKQPLSIEEIEVAPPKRHEVRVKIVATGICRSDHVISGALSDMKFPVILXXXXXXXXXXX
FRMA_PASPI      MKSRAAVAFGPGLPLEIVEIDVAPPKKGEVLVKISHTGVCHTDAYTLSGDDPEGLPXXXXXXXXXXXXXX
ADH1_GEOAT      ----AAVLWEKNKPFSIEEVEVAPPKAYEVRIKIVATGICRSDDHVVNGSIITPLPAILGHEAGGIVESI
ADHX_CAEEL      ----AAVAWSAKAPLSIETIQVAPPKAHEVRVKILYTAVCHTDAYTLDGHDPEGLPVVLXXXXXXXXXXX
ADH7_HUMAN      ----AAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICRTDDHVIKGTMVSKFPVIVGHEATGIVESI
ADH1_GEOBU      ----AAVLWEKNKPFSIEEVEVAPPKAYEVRIKIVATGICRSDDHVVNGSIITPLPAILGHEAGGIVESI
ADHX_OCTVU      IKCMAAIAWEAKKPLSIEEVEVAPPKSGEVRIKILHSGVCHTDAYTLEGIDPEIFPVILGHEGAGIVESI
ADHX_MYXGL      ----AAVAWEAKKPLSLEEIEVAPPKAHEVRMKVLATAVCHTDAYTLSGVDPESFPVVLGHEGAGIVESV
ADHX_UROHA      ----AAVAWEAGKPLSIEEIEVAPPKAHEVRVKIIATAVCHTDAYTLSGADPESFPVILGHEGAGIVESV
ADH1_GEOKN      ----AAVLWEKNKPFSIEEVEVVPPKAYEVRIKIVATGICRSDDHVVNGSIITPLPAILGHEAGGIVESI
ADH1_GADCA      ----AAVAWEANKPLVIEEIEVDVPHANEIRIKIIATGVCHTDLYLFEGKHKDGFPVVLGHEGAGIVESV
ADHX_DROME      ----AAVAWEAKKPLVIEDIEVAPPKAHEVRIKITATGVCHTDAFTLSGADPEGLPVVLGHEGAGIVESV
ADHL3_ARATH     ----AAVVWGPKVPLVIQEICVDPPQKMEVRVKILYSSICHTDTNEAERAFPRIL----GHEAVGIVESV
ADHH_GADMO      ----AAVAWEAGKPLSLEEVEVAPPRAGEVRIKVVATGVCHTDAYTLSGSDPEAFPVILGHEGAGLVESV
ADHX_HORSE      ----AAVAWEAGKPVSIEEVEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPESFPVILGHEGAGIVESV
FADH_CANMA      ----AAVAWEAAKPLSIEDVTVAPPKRHEVRIKLYDTGVCHTDAYTLSGVDPEAFPVILGHEGAGIVESI
FADH_YEAST      IKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLPCVLGHEGAGIVESV
ADH1_RAT        ----AAVLWEPHKPFTIEDIEVAPPKAHEVRIKMVATGVCRSDDHAVSGSLFTPLPAVLGHEGAGIVESI
ADHX_RABIT      ----AAVAWEAGKPLSIEEIEVAPPKAHEVRIKIFATAVCHTDAYTLSGADPECFPVILGHEGAGIVESV
ADHX_DICDI      ----AAVAWEAKKPLVIEDIEVQPPQKGEVRIKILYTGVCHTDSYTLSGSDPEIFPCILXXXXXXXXXXX
ADHX_RAT        ----AAVAWEAGKPLSIEEIEVAPPQAHEVRIKIIATAVCHTDAYTLSGADPECFPVILGHEGAGIVESV
ADH6_PONAB      ----AAILWKPGAPFSIEEVEVAPPKAKEVRIKVVATGLCGTEMKVLDLLYPTIL----GHEGAGIVESI
ADH1_PEA        ----AAVAWEAGKPLVIEEVEVAPPQAGEVRLKILFTSLCHTDVYFWEAKGQTPLPRIFGHEAGGIVESV
FADH_PICPA      ----AAVAWEAGKDLSIEEIEVLPPRAHEVRVKVEFTGVCHTDAYTLSDAEGSFPVVFXXXXXXXXXXXX
ADH8_RANPE      ----AAVAWEPHKPLSLETITVAPPKAHEVRIKILASGICGSDSSVLKEIIPSKFPVILGHEAVGVVESI
ADHX_PEA        ----AAVAWEPNKPLTIEDVEVAPPQANEVRIQILFTALCHTDAYTLGGKDPEGLPCILGHEAAGIVESV
ADHX_ORYSJ      ----AAVAWEANRPMTIEDVQVAPPQAGEVRVKILFTALCHTDHYTWSGKDPEGLPCILGHEAAGIVESV
ADHX_ORYSI      ----AAVAWEANKPMTIEDVQVAPPQAGEVRVKILFTALCHTDHYTWSGKDPEGLPCILGHEAAGIVESV
ADHX_MOUSE      ----AAVAWEAGKPLSIEEIEVAPPKAHEVRIKILATAVCHTDAYTLSGADPECFPVILGHEGAGIVESV
ADHX_BOVIN      ----AAVAWEAGKPLSIEEVEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPENYPVILGHEGAGIVESV
ADH1_TRIRP      ----AAVAWEAGKPLVIEEVEVAPPQAGEVRLKILFTSLCHTDVYFWEAKGQTPLPRIFGHEAGGIVESV
ADH6_HUMAN      ----AAILWKPGAPFSIEEVEVAPPKAKEVRIKVVATGLCGTEMKVLDLLYPTIL----GHEGAGIVESI
FADH1_SCHPO     ----AAVAWGAKEPLSIEDIQVAPPKAHEVRVKVDWSAVCHTDAYTLSGVDPEAFPIVLGHEGAGIVESI
ADHX_MAIZE      ----AAVAYEPNKPLVIEDVQVAPPQAGEVRVKILFTALCHTDHYTWSGKDPEGLPCILGHEAAGIVESV
ADHL6_ARATH     ----AAVAWRAGEPLVMEEVEVSPPQPLEIRIKVVCTSLCRSDLSAWES--QSLLPRIFGHEAAGIVESI
ADH1_ARATH      ----AAVAWEAGKPLVIEEVEVAPPQKHEVRIKILFTSLCHTDVYFWEAKGQTPLPRIFGHEAGGIVESV
ADHL7_ARATH     ----AAVSRKAGEPLVMEEIMVAPPQPFEVRIRIICTALCHSDVTFKLQVPPACFPRILGHEAIGVVESV
ADHX_HUMAN      ----AAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPECFPVILGHEGAGIVESV
ADHX_ARATH      ----AAVAYEPNKPLVIEDVQVAPPQAGEVRIKILYTALCHTDAYTWSGKDPEGLPCILGHEAAGIVESV
FADH2_SCHPO     ----AAVAWQPAAPLSIENVQVFPPRVHEVRIKIVNSGVCHTDAYTLSGKDPEGLPVILGHEGAGIVESV
ADH6_PERMA      ----AAVLWKPGAPLTMEEIDVAPPKGKEVRVKMVAAGICGTDSLDNKKLAP-FCPIIMGHEGTGIVESV
ADH3_HORVU      ----AAVAWEAGKPLSIEEVEVAPPQAMEVRVKILYTALCHTDVYFWEAKGQTVFPRILGHEAGGIVESV
ADHB_MYCTU      MKTKGALIWEFNQPWSVEEIEIGDPRKDEVKIQMEAAGMCRSDHLVTGDIPMAGFPVLGGHEGAGIVTEV
ADHB_MYCBO      MKTKGALIWEFNQPWSVEEIEIGDPRKDEVKIQMEAAGMCRSDHLVTGDIPMAGFPVLGGHEGAGIVTEV
ADH1_PETHY      ----AAVAWEAGKPLVIEEVEVAPPQKMEVRLKILFTSLCHTDVYFWEAKGQTPLPRIFGHEAGGIVESV
ADH1_PENAM      ----AAVAWEAGKPLSIEEVEVAPPQAMEVRVKILYTSLCHTDVYFWEAKGQTVFPRIFGHEAGGIIESV
ADHL2_ARATH     ----AAILRKAGEPLVIEEIQVDPPQAYEVRIKILCTSLCHTDVTFLDSGPLARFPRILGHEAVGVVESI
ADH1_MAIZE      ----AAVAWEAGKPLSIEEVEVAPPQAMEVRVKILFTSLCHTDVYFWEAKGQTVFPRIFGHEAGGIIESV
ADH2_HORVU      ----AAVAWEAGKPLSMEEVEDAPPQAMEVRDKILYTALCHTDVYFWEANGQTVFPRILGHEAGGIVESV
ADH6_RAT        -------------PLAIEEIEVAPPKAKEVRIKMVATGVCGTDIKHLDQELSKFCPMIMXXXXXXXXXXX
ADH2_MAIZE      ----AAVTWEAGKPLSIEEVEVAPPQAMEVRIKILYTALCHTDVYFWEAKGQTVFPRILGHEAGGIVESV
ADH1_ORYSJ      ----AAVAWEAAKPLVIEEVEVAPPQAMEVRVKILFTSLCHTDVYFWEAKGQTVFPRIFGHEAGGIVESV
ADH1_ORYSI      ----AAVAWEAAKPLVIEEVEVAPPQAMEVRVKILFTSLCHTDVYFWEAKGQTVFPRIFGHEAGGIVESV
ADHL4_ARATH     ----AAVAWGAGEPLVMEDVKVDPPQRLEVRIRILFTSICHTDLSAAQRAYPRIL---GHXXXXXXXXXX
ADH1_SOLTU      ----AAVAWEAGKPLVMEEVDVAPPQKMEVRLKILYTSLCHTDAKGQNPVFPRIL----GHEAAGIVESV
ADH1_HORVU      ----AAVAWEAGKPLTMEEVEVAPPQAMEVRVKILFTSLCHTDVYAKGQI-PMF-PRIFGHEAGGIVESV
ADH3_SOLTU      ----AAVAWEAGKPLVMEEVDVAPPQKMEVRLKILYTSLCHTDAKGQNPVFPRIL----GHEAAGIVESV
ADH2_SOLTU      ----AAVAWEAGKPLVMEEVDVAPPQKMEVRLKILYTSLCHTDAKGQNPVFPRIL----GHEAAGIVESV
ADHL1_ARATH     ----AAICRKAGEALVIEDIHVDPPQAYEVRIKILCTSLCHTDLTFWKLSFGPIFPRILGHEAVGVVESI
ADH2_SOLLC      ----AAVAWEAGKPLVMEEVDVAPPQKMEVRLKILYTSLCHTDAKGQNPVFPRIL----GHEAAGIVESV
ADHL5_ARATH     ----AAVSRKPGEALVIEEIHVDPPQAYEVRIKIICTSLCHTDVSFSDSGPLARFPRILGHEAVGVIESI
ADH_MALDO       ----AAVAWEAGKPLVIEEVEVAPPQANEVRIKILFTSLCHTDVYFWEAKNPLF-PRIYGHEAGGIVESV
ADH_FRAAN       ----AAVAWEAGKPLVIEEVEVAPPQANVVRVKILYTSLCHTDVYFWEAKNPLF-PRIYGHEAGGIVESV
ADH2_ORYSJ      ----AAVAWEAGKPLSIEEVEVAPPQAMEVRVKILYTALCHTDVYFWEAKGQTVFPRILGHEAGGIVESV
ADH2_ORYSI      ----AAVAWEAGKPLSIEEVEVAPPQAMEVRVKILYTALCHTDVYFWEAKGQTVFPRILGHEAGGIVESV
ADH1_BACST      ----AAVVEQFKKPLQVKEVEKPKISYGEVLVRIKACGVCHTDLHAAHGDWPVKLPLXXXXXXXXXXXXX
ADH3_BACST      ----AAVVEQFKEPLKIKEVEKPTISYGEVLVRIKACGVCHTDLHAAHGDWPVKLPLXXXXXXXXXXXXX
ADH2_BACST      ----AAVVNEFKKALEIKEVERPKLEEGEVLVKIEACGVCHTDLHAAHGDWPPKLPLIPGHEGVGIVVEV
ADH1_ZEALU      ----------------------------------------------------------------------
ADH1_ANAPL      ----------------------------------------------------------------------
DHSO_BACSU      -QNMKAAVMHNTREIKIETLPVPDINHDEVLIKVMAVGICGSDLHYRIGNYVVEKPFILGHECAGEIAAV
BDHA_BACSU      ----------------------------------------------------------------------
YJMD_BACSU      -----------RKAYDLVTAEVKKPKDDEVLVKVKRVGICGSDMHIYHGTNPATLPRVIGHEVTGQVEAV
ADH_STAAW       -------------------------KPGEALVQTEYCGVCHTDLHVKNADFGDVTGVTLGHEGIGKVIEV
ADH_STAAS       -------------------------KPGEALVQTEYCGVCHTDLHVKNADFGDVTGVTLGHEGIGKVIEV
ADH_STAAR       -------------------------KPGEALVQTEYCGVCHTDLHVKNADFGDVTGVTLGHEGIGKVIEV
ADH_STAAN       -------------------------KPGEALVQTEYCGVCHTDLHVKNADFGDVTGVTLGHEGIGKVIEV
ADH_STAAM       -------------------------KPGEALVQTEYCGVCHTDLHVKNADFGDVTGVTLGHEGIGKVIEV
ADH_STAAC       -------------------------KPGEALVQTEYCGVCHTDLHVKNADFGDVTGVTLGHEGIGKVIEV
ADH_STAAB       -------------------------KPGEALVQTEYCGVCHTDLHVKNADFGDVTGVTLGHEGIGKVIEV
ADH_STAA8       -------------------------KPGEALVQTEYCGVCHTDLHVKNADFGDVTGVTLGHEGIGKVIEV
ADH_STAA3       -------------------------KPGEALVQTEYCGVCHTDLHVKNADFGDVTGVTLGHEGIGKVIEV
XYLD_MORMO      ----------------------------------------------------------------------
TDH_SHEON       ----------------------------------------------------------------------
YDJJ_ECOLI      ---------------KIISAEIPVPKEDEVLIKVEYVGICGSD--VHGFESGPFIPPKDPNQEIGLGHEC
TDH_SHEPC       ----------------------------------------------------------------------
TDH_BACA2       ----------------------------------------------------------------------
ADH_STAES       ---------------------LRELRPGEALVKTEYCGVCHTDLHVKNADFGDVTGVTLGHEGIGRVIKI
TDH_SHEWM       ----------------------------------------------------------------------
TDH_SHESR       ----------------------------------------------------------------------
TDH_SHESM       ----------------------------------------------------------------------
TDH_SHESA       ----------------------------------------------------------------------
TDH_SHEB9       ----------------------------------------------------------------------
TDH_SHEB8       ----------------------------------------------------------------------
TDH_SHEB5       ----------------------------------------------------------------------
TDH_SHEB2       ----------------------------------------------------------------------
TDH_SHESW       ----------------------------------------------------------------------
ADH_STAEQ       ---------------------LRELKPGEALVKTEYCGVCHTDLHVKNADFGDVTGVTLGHEGIGRVIEV
YPHC_ECOLI      ----------------------------------------------------------------------
TDH_SHESH       ----------------------------------------------------------------------
TDH_SHEPA       ----------------------------------------------------------------------
TDH_SHEHH       ----------------------------------------------------------------------
TDH_SHEAM       ----------------------------------------------------------------------
TDH_SHELP       ----------------------------------------------------------------------
TDH_MESSB       ----------------------------------------------------------------------
DHSO_BACHD      ---MKALVKTQHGTGHFAVQEKPEPTPGQVKIKVKYTGVCGSDIHTYEGHYPVAAPVTLGHEFSGEIVEL
TDH_BACLD       ----------------------------------------------------------------------
ADH_RALEU       ---------------ELADKPIPDIGPNDALVRITTTTICGTDVHILKGEYPVAKGLTVGHEPVGIIEKL
TDH_CHRVO       ----------------------------------------------------------------------
ADHB_BACSU      ----------------------------------------------------------------------
ADH3_KLULA      ---------------EYKDIPVPKPKPNEILINVKYSGVCHTDAWKGDWPLPTKLPLXXXXXXXXXXXXX
TDH_PYRAB       ---------------ELVEVDVPKPGPGEVLIKVIATSICGTDLHIQSRIKP---PQIMXXXXXXXXXXX
YAHK_ECOLI      MKIKAVGAYSAKQPLEPMDITRREPGPNDVKIEIAYCGVCHSDLQVRSEWAGTVYPCVPGHEIVGRVVAV
XYL2_PICST      ----------------------------------------------------------------------
TDH_SHEFN       ----------------------------------------------------------------------
TDH_PSEHT       ----------------------------------------------------------------------
TDH_PSEA6       ----------------------------------------------------------------------
ADH2_KLULA      -------------------IPVPKPKANELLINVKYSGVCHTDAWKGDWPLPTKLPLXXXXXXXXXXXXX
TDH_PHOLL       ----------------------------------------------------------------------
TDH_PYRHO       ---------------ELVEVDVPKPGPGEVLIKVLATSICGTDLHIQSRIKP---PQIMGHXXXXXXXXX
TDH_BACSU       ----------------------------------------------------------------------
TDH_ALTMD       ----------------------------------------------------------------------
ADH1_KLULA      -------------------IPVPKPKANELLINVKYSGVCHTDAWKGDWPLPTKLPLXXXXXXXXXXXXX
TDH_YERPY       ----------------------------------------------------------------------
TDH_YERPS       ----------------------------------------------------------------------
TDH_YERPP       ----------------------------------------------------------------------
TDH_YERPN       ----------------------------------------------------------------------
TDH_YERPG       ----------------------------------------------------------------------
TDH_YERPE       ----------------------------------------------------------------------
TDH_YERPB       ----------------------------------------------------------------------
TDH_YERPA       ----------------------------------------------------------------------
TDH_YERP3       ----------------------------------------------------------------------
TDH_THETN       ----AVVKQYHKEGADIVKKEIPKIGPDEVLIKVKATSICGTDVHIKSRIKP---PKTMGHEFVGEVVEI
TDH_BURXL       ----------------------------------------------------------------------
TDH_BURPP       ----------------------------------------------------------------------
TDH_BURP8       ----------------------------------------------------------------------
ADHP_ECOLI      ----------------------------EALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEGIGVVAEV
ADH1_CANAL      ------------------------PKPNELLIHVKYSGVCHTDLHARKGDWPTKLPLXXXXXXXXXXXXX
TDH_THET8       ----------------------------------------------------------------------
TDH_SHISS       ----------------------------------------------------------------------
TDH_PYRFU       ---------------ELVEVDVPKPGPGEVLIKILATSICGTDLHIYERIRP---PQIMXXXXXXXXXXX
TDH_FRATN       ----------------------------------------------------------------------
TDH_CITK8       ----------------------------------------------------------------------
TDH_BURPS       ----------------------------------------------------------------------
TDH_BURP6       ----------------------------------------------------------------------
TDH_BURP1       ----------------------------------------------------------------------
TDH_BURP0       ----------------------------------------------------------------------
TDH_BURMS       ----------------------------------------------------------------------
TDH_BURMA       ----------------------------------------------------------------------
TDH_BURM9       ----------------------------------------------------------------------
TDH_BURM7       ----------------------------------------------------------------------
TDH_AERS4       ----------------------------------------------------------------------
ADH1_ZYMMO      ---MKAAVITKDHTIEVKDTKLRPLKYGEALLEMEYCGVCHTDLHVKNGDFGDETGRITGHEGIGIVKQV
TDH_SYMTH       ----------------------------------------------------------------------
TDH_SALAR       ----------------------------------------------------------------------
TDH_PROMH       ----------------------------------------------------------------------
TDH_FRATW       ----------------------------------------------------------------------
TDH_FRATT       ----------------------------------------------------------------------
TDH_FRATO       ----------------------------------------------------------------------
TDH_FRATM       ----------------------------------------------------------------------
TDH_FRATH       ----------------------------------------------------------------------
TDH_FRATF       ----------------------------------------------------------------------
TDH_FRAT1       ----------------------------------------------------------------------
TDH_THET2       ----------------------------------------------------------------------
TDH_IDILO       ----------------------------------------------------------------------
TDH_ECOLU       ----------------------------------------------------------------------
TDH_YERE8       ----------------------------------------------------------------------
TDH_VIBPA       ----------------------------------------------------------------------
TDH_STRCO       ---MKALVKENAEP-GLWLADVPEPTSGDVLIKVLRTGICGTDLHIRQQAIRT--PLVVGHEFVGEVVDT
TDH_SHIFL       ----------------------------------------------------------------------
TDH_SHIF8       ----------------------------------------------------------------------
TDH_SHIBS       ----------------------------------------------------------------------
TDH_SHIB3       ----------------------------------------------------------------------
TDH_SALTY       ----------------------------------------------------------------------
TDH_SALTI       ----------------------------------------------------------------------
TDH_SALSV       ----------------------------------------------------------------------
TDH_SALPK       ----------------------------------------------------------------------
TDH_SALPC       ----------------------------------------------------------------------
TDH_SALPB       ----------------------------------------------------------------------
TDH_SALPA       ----------------------------------------------------------------------
TDH_SALNS       ----------------------------------------------------------------------
TDH_SALHS       ----------------------------------------------------------------------
TDH_SALEP       ----------------------------------------------------------------------
TDH_SALDC       ----------------------------------------------------------------------
TDH_SALCH       ----------------------------------------------------------------------
TDH_SALA4       ----------------------------------------------------------------------
TDH_RHIL3       ----------------------------------------------------------------------
TDH_PYRKO       ---------------ELVEVDVPKPGPGEVLIKVLATSICGTDLHIQSRIKP---PQIMXXXXXXXXXXX
TDH_ENTS8       ----------------------------------------------------------------------
TDH_EDWI9       ----------------------------------------------------------------------
TDH_ECOUT       ----------------------------------------------------------------------
TDH_ECOSM       ----------------------------------------------------------------------
TDH_ECOSE       ----------------------------------------------------------------------
TDH_ECOLI       ----------------------------------------------------------------------
TDH_ECOLC       ----------------------------------------------------------------------
TDH_ECOL6       ----------------------------------------------------------------------
TDH_ECOL5       ----------------------------------------------------------------------
TDH_ECOK1       ----------------------------------------------------------------------
TDH_ECOHS       ----------------------------------------------------------------------
TDH_ECODH       ----------------------------------------------------------------------
TDH_ECOBW       ----------------------------------------------------------------------
TDH_ECO8A       ----------------------------------------------------------------------
TDH_ECO81       ----------------------------------------------------------------------
TDH_ECO7I       ----------------------------------------------------------------------
TDH_ECO5E       ----------------------------------------------------------------------
TDH_ECO57       ----------------------------------------------------------------------
TDH_ECO55       ----------------------------------------------------------------------
TDH_ECO45       ----------------------------------------------------------------------
TDH_ECO27       ----------------------------------------------------------------------
TDH_BURVG       ----------------------------------------------------------------------
ADHA_RHIME      MTMTAAVVREFGKPLVIEEXXXXXXXXXXXLIKYEATGVCHTDLHAAKGDWPVRPPFIPGHEGVGYVAKL
TDH_BURTA       ----------------------------------------------------------------------
TDH_AERHH       ----------------------------------------------------------------------
QOR_YEAST       ----------------------------------------------------------------------
ADH_SULAC       ----------------------------------------------------------------------
Y053_HAEIN      ----------------------------------------------------------------------
TDH_ECO24       ----------------------------------------------------------------------
TDH_BURS3       ----------------------------------------------------------------------
TDH_BURCJ       ----------------------------------------------------------------------
TDH_BURCH       ----------------------------------------------------------------------
TDH_BURCC       ----------------------------------------------------------------------
TDH_BURCA       ----------------------------------------------------------------------
TDH_BURA4       ----------------------------------------------------------------------
YDJL_ECOLI      ----------------------------------------------------------------------
TDH_THEON       ----------------------------------------------------------------------
TDH_RHIEC       ----------------------------------------------------------------------
TDH_RHIE6       ----------------------------------------------------------------------
TDH_FRAP2       ----------------------------------------------------------------------
TDH_BURM1       ----------------------------------------------------------------------
TDH_BURCM       ----------------------------------------------------------------------
DHSO_MOUSE      ----------------------------------------------------------------------
DHSO_BOMMO      ----------------------------------------------------------------------
DHSO2_YEAST     ----------------------------------------------------------------------
DHSO1_YEAST     ----------------------------------------------------------------------
ADHA_BACSU      -QTRVLSVSHAKAKFEQTTIERRGLRPHDVLIDIKFSGICHSDISAFDEWGGGIFPMVPGHEIXXXXXXX
TDH_SERP5       ----------------------------------------------------------------------
TDH_RHISN       ----------------------------------------------------------------------
TDH_KLEP7       ----------------------------------------------------------------------
TDH_KLEP3       ----------------------------------------------------------------------
ADH_SCHPO       -------------------VPVAEPGQDEVLVNIKYTGVCHTDALQGDWPLPAKMPLIXXXXXXXXXXXX
TDH_COLP3       ----------------------------------------------------------------------
TDH_VIBCM       ----------------------------------------------------------------------
TDH_VIBCH       ----------------------------------------------------------------------
TDH_VIBC3       ----------------------------------------------------------------------
TDH_ENT38       ----------------------------------------------------------------------
TDH_AGRRK       ----------------------------------------------------------------------
TDH_STRMK       ----------------------------------------------------------------------
TDH_SALG2       ----------------------------------------------------------------------
TDH_RHIME       ----------------------------------------------------------------------
TDH_DEIDV       ----------------------------------------------------------------------
IDND_VITVI      ----------------------------------------------------------------------
DHSO_RAT        ----------------------------------------------------------------------
TDH_RHILW       ----------------------------------------------------------------------
ADH_SULSR       ----------------------------------------------------------------------
YCJQ_SHIFL      ----------------------------------------------------------------------
YCJQ_ECOLI      ----------------------------------------------------------------------
TDH_PHOPR       ----------------------------------------------------------------------
TDH_RHILO       ----------------------------------------------------------------------
TDH_ERWCT       ----------------------------------------------------------------------
MTDH3_STYHU     -------------PFNFSRRDIGE---EDVALEVLYCGICHTDLMAKNDFGNSIYPYVPGHEVIGIVAEV
ADH_SULTO       ----------------------------------------------------------------------
TDH_SINMW       ----------------------------------------------------------------------
ADHN_AMYME      MKTKAAVLHSAGKPFEIEELELDGPREHEVLIKYTATGL-------------------------------
CAD8C_ORYSJ     -------------------------KDDDVTIKVLYCGICHTDLIVKNDWGNAMYPVVPGHEIXXXXXXX
YGD6_SCHPO      ----------------------------------------------------------------------
TDH_PECCP       ----------------------------------------------------------------------
TDH_MARMS       ----------------------------------------------------------------------
TDH_SILPO       ----------------------------------------------------------------------
TDH_PSYIN       ----------------------------------------------------------------------
QORL2_NEMVE     ----------------------------------------------------------------------
TDH_COXBU       ----------------------------------------------------------------------
TDH_COXBR       ----------------------------------------------------------------------
TDH_COXBN       ----------------------------------------------------------------------
TDH_COXB2       ----------------------------------------------------------------------
ADHC_MYCTU      MSTVAAYAASATEPLTKTTITRRDPGPHDVAIDIKFAGICHSDITVKAEWGQPNYPVVPGHEIAGVVTAV
ADHC_MYCBO      MSTVAAYAASATEPLTKTTITRRDPGPHDVAIDIKFAGICHSDITVKAEWGQPNYPVVPGHEIAGVVTAV


                         .         .         *         .         .         .         .:140
query           XXXXXXXKPDDKVVLGFNSCGQCLKCLGGKPAYCEKFYDRNFACTRDDGSTAFSEDGEQVGSHFFGQSTF
XYLB_PSEPU      GSAVKKVQPGDHVVLTFYTCGSCDACLSGDPTSCANSFGPNFMGRSVTGETIHDHQGAEVGASFFGQSSF
FADH_AMYME      GEGVDSVQPGDYVVLNWRACGQCRACKRGRPQYCFSTFNATQKMTLTDGTEL---------TPALGIGAF
ADH4_STRCA      GQGVSKFKPGDKVILYMPQCGHCKFCLNPKTNLCEKISKIKTPISMSDGTSRFTCKGKPI-YHFMGTSTF
ADH1B_UROHA     XXXXTSMKPGDKVIPIFPQCGECNSCRHPRGNVCKKSELGPFTGLLYDGTSRFTYQGKPV-YHFVRTGTF
ADH1B_PANTR     GEGVTTVKPGDKVIPLFTQCGKCRVCKNPESNYCLKNDLGNPRGTLQDGTRRFTCRGKPI-HHFLGTSTF
ADH1B_HUMAN     GEGVTTVKPGDKVIPLFTQCGKCRVCKNPESNYCLKNDLGNPRGTLQDGTRRFTCRGKPI-HHFLGTSTF
ADH1_ALLMI      GEGVTSLKPGDKVILFVPQCGECMPCLKSNGNLCIRNDLGSPSGLMADGTSRFTCKGKDI-HHFIGTSTF
ADH1A_HUMAN     GEGVTTVKPGDKVILAIPQCGKCRICKNPESNYCLKNDVSNPQGTLQDGTSRFTCRRKPI-HHFLGISTF
ADH1B_PAPHA     GEGVTTVKPGDKVIPLFTQCGKCRVCKSPEGNYCVKNDLSNPRGTLQDGTRRFTCRGKPI-HHFVGTSTF
ADHL_GADMO      GEGVTKFKSGDAVILYVPQCGECKFCKNPKTNLCQKIRLTQGKGLMPNGTSRFSCNG-QVLFHFMGSSTF
ADH1G_PAPHA     XXXXXXXKPGDKVIPLFTQCGKCRVCKNPESNYCFKNDLSNPRGTMQDGTRRFTCGGKPI-HHFLGISTF
ADH1A_UROHA     XXXXTCVKPGDKVILFVPQCGKCSSCRSTRGNLCTSNDLSAATGLMPDGTSRFTCKGKSL-HHFISTSSF
ADH4_HUMAN      GPGVTNVKPGDKVILYAPLCRKCKFCLSPLTNLCGKISNLKSPASMEDKTSRFTCKGKPV-YHFFGTSTF
ADH1A_PONAB     GEGVTTVKPGDKVILAVPQCGKCRICKNPESNYCLKNDVSNPQGTLQDGTSRFTCRGKPI-HHFLGISTF
ADHX_SPAAU      GEGVTKFKPGDTVILYVPQCGECKFCKNPKTNLCQKIRITQGQGLLPDKTSRFTCKGKQV-FHFMGTSTF
ADH1_STRCA      XXXXXXXKPGDKVILFVPQCGECSVCLSTKGNLCRKNDIGPASALMPDGTSRFTCKGKAI-HHFAGTSTF
FRMA_HAEIN      XXXXXXXKPGDHVIPLYTACGECEFCRSGKTNLCVSVRDTQGKGLMPDCTTRFSYQGQPI-YHYMGCSTF
ADHP_RABIT      GPGVTNVKPGDKVILYIPHCKKCKFCLSPLTNFCEKFCKGKNPLIEEDKTSRFTCKGKSI-YHFFGISAF
ADH1_MOUSE      GEGVTCVKPGDKVIPLFSQCGECRICKHPESNFCSRSDLLMPRGTLREGTSRFSCKGKQI-HNFISTSTF
ADH1_PERMA      GEGVTSVKPGDKVIPLFTQCGKCRICKHPEYNLCMKNDLMQPRGTLLDGTSRFTCRGKAI-HNFISTSTF
ADH4_MOUSE      GPGVTNFKPGDKVIPFFAQCKRCKLCLSPLTNLCGKL--RNFKYPTEDRTSRFTCKGRSI-YHFMGVSSF
ADH1G_HUMAN     GEGVTTVKPGDKVIPLFTQCGKCRICKNPESNYCLKNDLGNPRGTLQDGTRRFTCSGKPI-HHFVGVSTF
FRMA_SYNY3      XXXXXXXQLGDHVIPLYTACGKCLFCRSGKTNLCVAVRATQGKGVMPDGTSRFSYNGQSL-YHYMGCSTF
FADH_PARDE      XXXXTSVKPGNHVILYTPECRQCASCLSGKTNLCTAIRATQGQGLMPDGTSRFSMDGTPI-FHYMGCSTF
ADH1A_MACMU     XXXXXXXXXXDKVILALPQCGKCRICKTPERNYCLKNDVSNPRGTLQDGTSRFTCRGKPI-HHFLGVSTF
ADH1_APTAU      XXXXXXXKPGDKVILFVPQCGECSACLSTKGNLCSKNDIGSASGLMPDGTTRFTCKGKAI-HHFIGTSTF
ADH1E_HORSE     GEGVTTVRPGDKVIPLFTQCGKCRVCKHPEGNFCLKNDLSMPRGTMQDGTSRFTCRGKPI-HHFLGTSTF
ADH4_RAT        GPGVTNFKPGDKVIPFFAQCKKCKLCLSPLTNLCGKL--RNFKYPTEDRTSRFTSKERSI-YHFMGVSSF
FRMA_ECOL6      XXXXTSVKPGDHVILYTEXCGECEFCRSGKTNLCVAVRETQGKGLMPDGTTRFSYNGQPL-YHYMGCSTF
TERPD_PSESP     GPGVKHLKPGDAVVMTFASCGHCASCEHERPSYCLDFGAQNYSAQRADGPVLLSQGDEVIXXXXXXXXXX
FRMA_ECOUT      XXXXTSVKPGDHVIPLYTACGECEFCRSGKTNLCVAVRETQGKGLMPDGTTRFSYNGQPL-YHYMGCSTF
FRMA_ECOL5      XXXXTSVKPGDHVIPLYTACGECEFCRSGKTNLCVAVRETQGKGLMPDGTTRFSYNGQPL-YHYMGCSTF
FRMA_ECOK1      XXXXTSVKPGDHVIPLYTACGECEFCRSGKTNLCVAVRETQGKGLMPDGTTRFSYNGQPL-YHYMGCSTF
ADHQ_RABIT      GPGVNNFKPGDKVILYVPHCRKCKFCQSPLTNFCTKFSEHKNPIIEDDKTSRFTCKGKSI-YHFLGISAF
ADH7_MOUSE      XXXXXXXRPGDKVILFLPQCRECNACLNPEGNLCIR-SDLTGCGVLADGTTRFTCKGKPV-QHFMNTSTF
ADH1_CHICK      GEKVTSLKPGDAVILFVPQCGECRSCLSTKGNLCIK-NDLSSSPTMADGTTRFTCKGKAI-HHFVGTSTF
ADH7_RAT        GEEVTTVRPGDKVILFLPQCRECNPCRNPEGNLCIR-SDLTGRGVLADGTTRFTCKGKPV-QHFMNTSTF
FRMA_SHISS      XXXXTSVKPGDHVIPLYTACGECEFCRSGKTNLCVAVRETQGKGLMPDGTTRFSYNGQPL-YHYMGCSTF
FRMA_ECOLI      XXXXTSVKPGDHVIPLYTACGECEFCRSGKTNLCVAVRETQGKGLMPDGTTRFSYNGQPL-YHYMGCSTF
FRMA_ECOLC      XXXXTSVKPGDHVIPLYTACGECEFCRSGKTNLCVAVRETQGKGLMPDGTTRFSYNGQPL-YHYMGCSTF
FRMA_ECOHS      XXXXTSVKPGDHVIPLYTACGECEFCRSGKTNLCVAVRETQGKGLMPDGTTRFSYNGQPL-YHYMGCSTF
FRMA_ECO57      XXXXTSVKPGDHVIPLYTACGECEFCRSGKTNLCVAVRETQGKGLMPDGTTRFSYNGQPL-YHYMGCSTF
FRMA_ECO24      XXXXTSVKPGDHVIPLYTACGECEFCRSGKTNLCVAVRETQGKGLMPDGTTRFSYNGQPL-YHYMGCSTF
ADH1_COTJA      GEKVTLLKPGDAVILFVPQCGECRSCLSTKGNLCIK-NDLSSSPTMADGTTRFTCKGKAI-HHFIGTSTF
ADHI_RHOS4      XXXXTSVKPGDHVILYTPECRQCPSCLSQKTNLCTAIRGTQGQGLMPDGTSRFSMDGTPI-LHYMGCSTF
ADH1S_HORSE     GEGVTTVRPGDKVILFIPQCGKCSVCKHPEGNLCLKNLSMPRG-TMQDGTSRFTCRGKPI-HHFLGTSTF
ADH1_NAJNA      XXXXTCVKPGDKVIPLFAQCGKCRACQSPKGNLCTSNDLNSGSGLMPDGTSRFTCKGKSI-HHFISTSTF
FRMA_ECOSM      XXXXTSVKPGDHVIPLYTACGECEFCRSGKTNLCVAVRETQGKGLMPDGTTRFSYNGQPL-YHYMGCSTF
ADH1_RABIT      GEGVTTVKPGDKVIPLFTQCGKCRIC---------KHPESNFCLINDDGTSRFTCKGKPI-HHFIGTSTF
ADH1_RANPE      XXXXTKFKPGDKVILFVPQCGECRCCKNPESNLCYKNDIGKYDGVLLDKTSRFTCKGKSI-HNFISTSTF
FRMA_PASPI      XXXXTSVKPGDHVIPLYTACGECDFCTSGKTNLCVAVRETQGKGVMPDATSRFFVNGQPL-YHYMGCSTF
ADH1_GEOAT      GEGVTTVKPGDKVILFVPQCGKCRACKHPESNLCTHGDLGRAQGTLMDGTSRFTCKGKPI-HHFLGVTTF
ADHX_CAEEL      XXXXXXFAPGDHVVLYVPQCKECEYCKNPKTNLCQKIRISQGNGFMPDGSSRFTCNGKQL-FHFMGCSTF
ADH7_HUMAN      GEGVTTVKPGDKVILFLPQCRECNACRNPDGNLCIR-SDITGRGVLADGTTRFTCKGKPV-HHFMNTSTF
ADH1_GEOBU      GEGVTTVKPGDKVILFVPQCGKCRACKHPESNLCKHGDLGRAQGTLMDGTSRFTCKGKPI-HHFLGVTTF
ADHX_OCTVU      GEGVTSVKPGDTVILYVPQCYECKFCLNPKTNLCQKIRVTQGKGVMPDGTTRFTCKGKEV-FHFMGCSTF
ADHX_MYXGL      GEGVTKFKPGDSVILYIPQCGECKFCLNPKTNLCQKIRVTQGKGMMPDGTSRLTCRGKSL-YHFMGASTF
ADHX_UROHA      GEGVTKFKPGDTVILYIPQCGECKFCLNPKTNLCQKIRVTQGKGVMPDGTSRFTCKGKQV-LHFMGTSTF
ADH1_GEOKN      GEGVTTVKPGDKVILFVPQCGKCRACKHPESNLCTHGDLGRAQGTLMDGTSRFTCKGKPI-HHFLGVTTF
ADH1_GADCA      GPGVTEFQPGEKVILFISQCGECRFCQSPKTNQCVKGWANESPDVMSPKETRFTCKGRKV-LQFLGTSTF
ADHX_DROME      GEGVTNFKAGDHVILYIPQCNECKFCKSGKTNLCQKIRLTQGAGVMPEGTSRLSCKGQQL-FHFMGTSTF
ADHL3_ARATH     GEGVKDVKEGDYVIPTFNGCGECKVCKREESNLCERYHDPMKRVMVNDGGTRFSKDGGSSQSHFLNTSTF
ADHH_GADMO      GEGVTKFKAGDTVILYVPQCGECKFCKNPKTNLCQKIRVTQGRGLMPDNTSRFTCKGKQL-FHFMGTSTF
ADHX_HORSE      GEGVTKLKAGDTVILYIPQCGECKFCLNPQTNLCQKIRTTQGKGLMPDGTSRFTCKGKTI-LHYMGTSTF
FADH_CANMA      GEGVTNVKVGDHVIALYTECGECKFCKSGKTNLCGKIRATQGKGVMPDGTSRFTCKGKEI-LHFMGCSTF
FADH_YEAST      GDDVITVKPGDHVIALYTACGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFNAKGEDI-YHFMGCSTF
ADH1_RAT        GEGVTCVKPGDKVIPLFSQCGKCRICKHPESNLCCQ--TKNLTQPKGDGTSRFSCRGKPI-HHFISTSTF
ADHX_RABIT      GEGVTNLKAGDTVILYIPQCGECKFCLNPKTNLCQKIRVTQGKGLMPDGTSRFTCKGKTI-LHYMGTSTF
ADHX_DICDI      XXXXTSVKVGDHVILYIPECGTCKFCTSNKTNLCSKIRITQGKGQMPDGTTRFKCKGKEI-FHFMGTSTF
ADHX_RAT        GEGVTKLKAGDTVILYIPQCGECKFCLNPKTNLCQKIRVTQGKGLMPDGTSRFTCKGKPI-LHFMGTSTF
ADH6_PONAB      GEGVSTVKPGDKVILFLPQCGECTSCLNSEGNFCIQF-KQSETQLMSDGTSRFTCKGKSI-YHFGNTSTF
ADH1_PEA        GEGVTHLKPGDHALPVFTGCGECPHCKSEESNMCDLLINTDRGVMLNDNKSRFSIKGQPV-HHFVGTSTF
FADH_PICPA      XXXXXXXXXXXXXLLYTPECRECKFCLSGKTNLCGKIRATQGKGLLPDGTSRFRCKGKDL-FHYMGCSSF
ADH8_RANPE      GAGVTCVKPGDKVILFVPQCGSCRACKSSNSNFCEKNDMGAKTGLMADMTSRFTCRGKPI-YNLVGTSTF
ADHX_PEA        GEGVTDVKPGDHVIPSYQACGECKFCKSPKTNLCGKVRAATVGVMMADRKSRFSVKGKPI-YHFMGTSTF
ADHX_ORYSJ      GEGVTEVQPGDHVIPCYQACRECKFCKSGKTNLCGKVRAATVGVMMNDRKSRFSINGKPI-YHFMGTSTF
ADHX_ORYSI      GEGVTEVQPGDHVIPCYQACRECKFCKSGKTNLCGKVRAATVGVMMNDRKSRFSINGKPI-YHFMGTSTF
ADHX_MOUSE      GEGVTKLKAGDTVILYIPQCGECKFCLNPKTNLCQKIRVTQGKGLMPDGTSRFTCKGKSV-FHFMGTSTF
ADHX_BOVIN      GEGVTKLKAGDTVILYIPQCGECKFCLNPKTNLCQKIRVTQGKGLMPDGTSRFTCKGKTI-LHYMGTSTF
ADH1_TRIRP      GEGVTHLKPGDHALPVFTGCGECPHCKSEESNMCNLLINTDRGVMINDNKSRFSIKGQPV-HHFVGTSTF
ADH6_HUMAN      GEGVSTVKPGDKVILFLPQCGECTSCLNSEGNFCIQF-KQSKTQLMSDGTSRFTCKGKSI-YHFGNTSTF
FADH1_SCHPO     GEGVINVRPGDHVILLYTECKECKFCRSGKTNLCSKIRETQGRGLMPDGTSRFS-CRDKTLLHYMGCSSF
ADHX_MAIZE      GEGVTDVQPGDHVIPCYQACKECKFCKSGKTNLCGKVRSATVGVMMNDMKSRFSVNGKPI-YHFMGTSTF
ADHL6_ARATH     GEGVTEFEKGDHVLAVFGECGSCRHCISGKSNMCQVLGMERKGLMHSDQKTRFSIKGKPV-YHYCAVSSF
ADH1_ARATH      GEGVTDLQPGDHVLPIFTGCGECRHCHSEESNMCDLLINTERGGMIHDGESRFSINGKPI-YHFLGTSTF
ADHL7_ARATH     GENVKEVVEGDTVLPTFMDCGDCVDCKSHKSNLCSKFFKVSPWMPRYDNSSRFTDLNGETLFHFLNVSSF
ADHX_HUMAN      GEGVTKLKAGDTVILYIPQCGECKFCLNPKTNLCQKIRVTQGKGLMPDGTSRFTCKGKTI-LHYMGTSTF
ADHX_ARATH      GEGVTEVQAGDHVIPCYQACRECKFCKSGKTNLCGKVRSATVGIMMNDRKSRFSVNGKPI-YHFMGTSTF
FADH2_SCHPO     GPQVTTVQVGDPVIALYTECKTCKFCKSGKTNLCGRIRTTQGKGLMPDGTSRFSCNGNTL-LHFMGCSTF
ADH6_PERMA      GEGVSTVKTGDKVILCLPQCGECNTCLNSKNNICKEVRLSGTHLT-SEGNSRITCKGKTT-YQYITTGTF
ADH3_HORVU      GEGVTELVPGDHVLPVFTGCKDCAHCKSEESNLCDLLVDRGVMI--GDGQSRFTINGKPI-FHFVGTSTF
ADHB_MYCTU      GPGVDDFAPGDHVVLAFPSCGKCPSCQAGMRNLCDLGAGLLAGESVTDGSFRIQARGQNVYPMTL-LGTF
ADHB_MYCBO      GPGVDDFAPGDHVVLAFPSCGKCPSCQAGMRNLCDLGAGLLAGESVTDGSFRIQARGQNVYPMTL-LGTF
ADH1_PETHY      GEGVTDLKPGDHVLPVFTGCQQCRHCKSEESNMCDLLINTDRGVMIHDGQTRFSKDGKPI-YHFVGTSTF
ADH1_PENAM      GEGVTDVAPGDHVLPVFTGCKECPHCKSAESNMCDLLRINTVRGVMGDGKSRFSINGKPI-YHFVGTSTF
ADHL2_ARATH     GEKVDGFKQGDVVLPVFHQCEECKECISPKSNWCTKYTNDYLSNTRRYGMTSRFKDGEDI-HHFIFVSSF
ADH1_MAIZE      GEGVTDVAPGDHVLPVFTGCKECAHCKSAESNMCDLLRDRGVMIA--DGKSRFSINGKPI-YHFVGTSTF
ADH2_HORVU      GEGVTELVPGDHVLPVFTGCKECAHCMSEESNLCDLLVDRGVMI--DDGQSRFTIDGKPI-FHFLGTSTF
ADH6_RAT        XXXXXXXRTGDKVILCIPQCGECKTCLNSKNNICTEIR-LSKTHLASEGTSRITCKGKLV-HQYIALGSF
ADH2_MAIZE      GEGVTDVAPGDHVLPVFTGCKECAHCKSEESNMCDLLVDRGVMI--GDGKSRFTISGQPI-FHFVGTSTF
ADH1_ORYSJ      GEGVTDLAPGDHVLPVFTGCKECAHCKSAESNMCDLLINTDRGVMIGDGKSRFSINGKPI-YHFVGTSTF
ADH1_ORYSI      GEGVTDLAPGDHVLPVFTGCKECAHCKSAESNMCDLLINTDRGVMIGDGKSRFSINGKPI-YHFVGTSTF
ADHL4_ARATH     XXXXXXXXXDHVLPIFTGECGDCRVCKRDGANLCERFVDPMKKVMVTDGKTRFSKDNKPI-YHFLNTSTF
ADH1_SOLTU      GEGVTELGPGDHVLPVFGECKDCAHCKSEESNMCSLLINTDRGVMINDGQSRFSINGKPI-YHFVGTSTF
ADH1_HORVU      GEGVTDVAPGDHVLPVFTGCKECPHCKSAESNMCDLLINTDRGVMIGDGKSRFSIGGKPI-YHFVGTSTF
ADH3_SOLTU      GEGVTELAPGDHVLPVFGECKDCAHCKSEESNMCSLLINTDRGVMINDGQSRFSINGKPI-YHFVGTSTF
ADH2_SOLTU      GEGVTELAPGDHVLPVFGECKDCAHCKSEESNMCSLLINTDRGVMINDGQSRFSINGKPI-YHFVGTSTF
ADHL1_ARATH     GENVDGFKQGDVVLPVFHPCEECKDCKSSKTNWCDRYAEDFISNTRRYGASRFKDSSGEVIHHFLFVSSF
ADH2_SOLLC      GEGVTDLAPGDHVLPVFGECKDCAHCKSEESNMCSLLINTDRGVMLNDGKSRFSINGNPI-YHFVGTSTF
ADHL5_ARATH     GEHVNGFQQGDVVLPVFHPCEECRDCKSSKSNWCARFADDFLSNTRRYGMTSRFKDGEDI-YHFLFVSSF
ADH_MALDO       GEGVTDLKAGDHVLPVFTGCKDCAHCKSEESNMCDLLINTDRGVMLSDGKSRFSIKGKPI-YHFVGTSTF
ADH_FRAAN       GEGVTDLKAGDHVLPVFTGCKECDHCKSEESNMCDLLINTDRGVMLNDGKSRFSIKGKPI-YHFVGTSTF
ADH2_ORYSJ      GEGVTELAPGDHVLPVFTGCKECDHCKSEESNMCDLLVDRGVMI--GDGKSRFTIKGKPI-FHFVGTSTF
ADH2_ORYSI      GEGVTELAPGDHVLPVFTGCKECDHCKSEESNMCDLLVDRGVMI--GDGKSRFTIKGKPI-FHFVGTSTF
ADH1_BACST      XXXXTHLKVGDRVGIPYSACGHCDYCLSGQETLCER-----------QQNAGYSVDG-----------GY
ADH3_BACST      XXXXTHLKVGDRVGIPYSACGHCDYCLSGQETLCE--HQKNAGYSVDGG--------------------Y
ADH2_BACST      AKGVKSIKVGDRVGIPYSACGECEYCLTGQETLCP----------------------HQLNGGYSVDGGY
ADH1_ZEALU      --------PGDHVLPVFTGCKECAHCKSAESNMCDLLINTDRGVMIGDGKSRFSINGKPI-YHFVGTSTF
ADH1_ANAPL      ----------------------------------------------------------------------
DHSO_BACSU      GSSVDQFKVGDRVAVEPGTCGRCEACKEGRYNLCP---DVQFLATPPDGA-------------------F
BDHA_BACSU      ----------------------------------------------------------------------
YJMD_BACSU      GANVQSLKPGDHVVIEISYCGSCYACRKGRPNVCAKL--SVFGVHEDGG--------------------M
ADH_STAAW       AEDVESLKIGDRVSIAFESCGRCEYCTTGRETLCRSVKNAGYTV---DGAMA-----EQV----------
ADH_STAAS       AEDVESLKIGDRVSIAFESCGRCEYCTTGRETLCRSVKNAGYTV---DGAMA-----EQV----------
ADH_STAAR       AEDVESLKIGDRVSIAFESCGRCEYCTTGRETLCRSVKNAGYTV---DGAMA-----EQV----------
ADH_STAAN       AEDVESLKIGDRVSIAFESCGRCEYCTTGRETLCRSVKNAGYTV---DGAMA-----EQV----------
ADH_STAAM       AEDVESLKIGDRVSIAFESCGRCEYCTTGRETLCRSVKNAGYTV---DGAMA-----EQV----------
ADH_STAAC       AEDVESLKIGDRVSIAFESCGRCEYCTTGRETLCRSVKNAGYTV---DGAMA-----EQV----------
ADH_STAAB       AEDVESLKIGDRVSIAFESCGRCEYCTTGRETLCRSVKNAGYTV---DGAMA-----EQV----------
ADH_STAA8       AEDVESLKIGDRVSIAFESCGRCEYCTTGRETLCRSVKNAGYTV---DGAMA-----EQV----------
ADH_STAA3       AEDVESLKIGDRVSIAFESCGRCEYCTTGRETLCRSVKNAGYTV---DGAMA-----EQV----------
XYLD_MORMO      ----------------------------------------------------------------------
TDH_SHEON       ---------------GHITCGHCRNCRAGRTHLC-----------RNTSGVGVNREG-----------SF
YDJJ_ECOLI      AGTVVAVKPGDRVNIEPGPCGHCRYCLEGKYNICP---DVDFMATQPNYRGALT--------HYLCHPES
TDH_SHEPC       ---------------GHITCGHCRNCRAGRTHLC-----------RNTSGVGVNREG-----------SF
TDH_BACA2       -------------------CGTCVPCLTGK----------HHVCTHT----------KILGVDTAG--SF
ADH_STAES       ADNVDSLKVGDRVSIAYAACGNCEYCTTGRETLC-----------RDVLNAGYTVDG-----------AM
TDH_SHEWM       ---------------GHITCGHCRNCRAGRTHLC-----------RNTSGVGVNRDG-----------AF
TDH_SHESR       ---------------GHITCGHCRNCRAGRTHLC-----------RNTSGVGVNREG-----------SF
TDH_SHESM       ---------------GHITCGHCRNCRAGRTHLC-----------RNTSGVGVNREG-----------SF
TDH_SHESA       ---------------GHITCGHCRNCRAGRTHLC-----------RNTSGVGVNREG-----------SF
TDH_SHEB9       ---------------GHITCGHCRNCRAGRTHLC-----------RNTSGVGVNREG-----------SF
TDH_SHEB8       ---------------GHITCGHCRNCRAGRTHLC-----------RNTSGVGVNREG-----------SF
TDH_SHEB5       ---------------GHITCGHCRNCRAGRTHLC-----------RNTSGVGVNREG-----------SF
TDH_SHEB2       ---------------GHITCGHCRNCRAGRTHLC-----------RNTSGVGVNREG-----------SF
TDH_SHESW       ---------------GHITCGHCRNCRAGRTHLC-----------RNTSGVGVNREG-----------SF
ADH_STAEQ       ADNVDSLKVGDRVSIAYAACGNCEYCTTGRETLC-----------RDVLNAGYTVDG-----------AM
YPHC_ECOLI      ----------------------------------------------------------------------
TDH_SHESH       ---------------GHITCGHCRNCRGGRTHLC-----------RNTSGVGVNRDG-----------AF
TDH_SHEPA       ---------------GHITCGHCRNCRGGRTHLC-----------RNTSGVGVNREG-----------AF
TDH_SHEHH       ---------------GHITCGHCRNCRGGRTHLC-----------RNTSGVGVNREG-----------AF
TDH_SHEAM       ---------------GHITCGHCRNCRAGRTHLC-----------RNTTGVGVNREG-----------SF
TDH_SHELP       ---------------GHITCGHCRNCRAGRTHLC-----------RNTSGVGVNREG-----------AF
TDH_MESSB       -------------------CGHCRNCRAGRGHLCRNTLG--------------------VGVHRPG--AF
DHSO_BACHD      GEGVTGFNVGDRVTTTYSICGKCSYCTSGDYNLCSH---RKGLGNQQDGS-------------------F
TDH_BACLD       -------------------CGKCLPCLTGKEHVCKKTL-----------ILGVDTDG-----------CF
ADH_RALEU       GSAVTGYREGQRVIAG---------------AICPNFYAAQDGVASQDGSYLMASG--QCGCHGYKATTQ
TDH_CHRVO       ---------------GHITCGYCRNCRAGRRHLC-----------RNTTGVGVNREG-----------AF
ADHB_BACSU      -------KKGDRVIIPFNACGECFFCKNQLESQCDQ-----------------SNDNGEMGAYFYLRVPF
ADH3_KLULA      XXXXKGWNIGDFAGIKWLN-GSCMSC-----EYCELSNESN---CPDADLSGYTHDG-----------SF
TDH_PYRAB       XXXXXXXXXXDYVSVETHICGKCYACRRGQYHVCQN-------------TKIFGVDTDGV---------F
YAHK_ECOLI      GDQVEKYAPGDLVGVGVDSCKHCEECEDGLENYCDHMTGTYNSPTPDEPGHTLGGYSQQIVVH-------
XYL2_PICST      ----------------------------------------------------------------------
TDH_SHEFN       ---------------GHITCGHCRNCRAGRTHLC-----------RNTSGVGVNRDG-----------AF
TDH_PSEHT       ---------------GHITCGHCRNCRAGRVHLC-----------RNTTGVGVNREG-----------AF
TDH_PSEA6       ---------------GHITCGHCRNCRAGRRHLC-----------RNTSGVGVNRAG-----------AF
ADH2_KLULA      XXXXKGWNIGDFAGIKWLN-GSCMSC-----EYCELSNESN---CPDADLSGYTHDG-----------SF
TDH_PHOLL       ---------------GHITCGYCRNCRGGRTHLCRN----------------------TIGVGVNRAGCF
TDH_PYRHO       XXXXXXXXXXDYVSVETHICGKCYACRRGQYHVCQN-------------TKIFGVDTDGV---------F
TDH_BACSU       -------------------CGECVPCLTGKSHVCT--------------NTAI------IGVDTAG--CF
TDH_ALTMD       ---------------GHITCGHCRNCRAGRVHLCR--------------------NTEGVGVNRPG--AF
ADH1_KLULA      XXXXKGWKIGDFAGIKWLN-GSCMSC-----EYCELSNESN--CPEADLS-GYTHDG-----------SF
TDH_YERPY       ---------------GHITCGHCRNCRGGRTHLCRN----------------------TVGVGVNRPGSF
TDH_YERPS       ---------------GHITCGHCRNCRGGRTHLCRN----------------------TVGVGVNRPGSF
TDH_YERPP       ---------------GHITCGHCRNCRGGRTHLCRN----------------------TVGVGVNRPGSF
TDH_YERPN       ---------------GHITCGHCRNCRGGRTHLCRN----------------------TVGVGVNRPGSF
TDH_YERPG       ---------------GHITCGHCRNCRGGRTHLCRN----------------------TVGVGVNRPGSF
TDH_YERPE       ---------------GHITCGHCRNCRGGRTHLCRN----------------------TVGVGVNRPGSF
TDH_YERPB       ---------------GHITCGHCRNCRGGRTHLCRN----------------------TVGVGVNRPGSF
TDH_YERPA       ---------------GHITCGHCRNCRGGRTHLCRN----------------------TVGVGVNRPGSF
TDH_YERP3       ---------------GHITCGHCRNCRGGRTHLCRN----------------------TVGVGVNRPGSF
TDH_THETN       GENVTSVKVGDLVSAETHICGKCRACRTGNAHICENTL-----------ILGVDTDG-----------AF
TDH_BURXL       ---------------GHITCGFCRNCRAGRRHLCRN----------------------TVGVGVNREGAF
TDH_BURPP       ---------------GHITCGFCRNCRAGRRHLCRN----------------------TVGVGVNREGAF
TDH_BURP8       ---------------GHITCGFCRNCRAGRRHLCRN----------------------TVGVGVNREGAF
ADHP_ECOLI      GPGVTSLKPGDRASVAYEGCGHCEYCNSGNETLC-----------RSVKNAGYSVDGGM-----------
ADH1_CANAL      XXXXKGWKIGDFAGIKWLN-GSCMSC-----EFCQQGAEPN--CGEADLS-GYTHDG-----------SF
TDH_THET8       ----------------------------------------------------------------------
TDH_SHISS       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTIGVGVNRPGCF
TDH_PYRFU       XXXXXXXXXXDYVSVETHICGKCYACKRGQYHVCQN-------------TKIFGVDTDGV---------F
TDH_FRATN       -------------------CGQCRNCRAGKRHLCRK----------------------TIGIGVNVQGAF
TDH_CITK8       ---------------GHITCGHCRNCRGGRTHLCRN----------------------TLGVGVNRPGCF
TDH_BURPS       ---------------GHITCGFCRNCRAGRRHLCRN----------------------TVGVGVNREGAF
TDH_BURP6       ---------------GHITCGFCRNCRAGRRHLCRN----------------------TVGVGVNREGAF
TDH_BURP1       ---------------GHITCGFCRNCRAGRRHLCRN----------------------TVGVGVNREGAF
TDH_BURP0       ---------------GHITCGFCRNCRAGRRHLCRN----------------------TVGVGVNREGAF
TDH_BURMS       ---------------GHITCGFCRNCRAGRRHLCRN----------------------TVGVGVNREGAF
TDH_BURMA       ---------------GHITCGFCRNCRAGRRHLCRN----------------------TVGVGVNREGAF
TDH_BURM9       ---------------GHITCGFCRNCRAGRRHLCRN----------------------TVGVGVNREGAF
TDH_BURM7       ---------------GHITCGFCRNCRAGRRHLCRN----------------------TVGVGVNREGAF
TDH_AERS4       ---------------GHITCGHCRNCRAGRTHLCRN----------------------TIGVGVNRPGSF
ADH1_ZYMMO      GEGVTSLKVGDRASVAFKGCGHCEYCVSGNETLC-----------RNVENAGYTVDG-----------AM
TDH_SYMTH       ----------------------------------------------------------------------
TDH_SALAR       ---------------GHITCGHCRNCRGGRTHLC-----------RNTTGVGVNRPG-----------CF
TDH_PROMH       ---------------GHITCGHCRNCRGGRTHLCRN----------------------TIGVGVNRPGCF
TDH_FRATW       -------------------CGQCRNCRAGKRHLCRK----------------------TIGIGVNVQGAF
TDH_FRATT       -------------------CGQCRNCRAGKRHLCRK----------------------TIGIGVNVQGAF
TDH_FRATO       -------------------CGQCRNCRAGKRHLCRK----------------------TIGIGVNVQGAF
TDH_FRATM       -------------------CGQCRNCRAGKRHLCRK----------------------TIGIGVNVQGAF
TDH_FRATH       -------------------CGQCRNCRAGKRHLCRK----------------------TIGIGVNVQGAF
TDH_FRATF       -------------------CGQCRNCRAGKRHLCRK----------------------TIGIGVNVQGAF
TDH_FRAT1       -------------------CGQCRNCRAGKRHLCRK----------------------TIGIGVNVQGAF
TDH_THET2       ----------------------------------------------------------------------
TDH_IDILO       ---------------GHITCGHCRNCRAGRRHLCRNTYG--------------------VGVNRPG--AF
TDH_ECOLU       ---------------GHITCGHCRNCRGGRTHLCRN----------------------TIGVGVNRPGCF
TDH_YERE8       ---------------GHITCGHCRNCRGGRTHLCRN----------------------TVGVGVNRPGSF
TDH_VIBPA       ---------------GHITCGHCRNCRGGRTHLCRN----------------------TIGVGVNREGAF
TDH_STRCO       GRDVTDIKAGDRVSEGHLVCGKCRNCLAGRRHLCRA----------------------TVGLGVGRDGAF
TDH_SHIFL       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTIGVGVNRPGCF
TDH_SHIF8       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTIGVGVNRPGCF
TDH_SHIBS       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTIGVGVNRPGCF
TDH_SHIB3       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTIGVGVNRPGCF
TDH_SALTY       ---------------GHITCGHCRNCRGGRTHLC-----------RNTTGVGVNRPG-----------CF
TDH_SALTI       ---------------GHITCGHCRNCRGGRTHLC-----------RNTTGVGVNRPG-----------CF
TDH_SALSV       ---------------GHITCGHCRNCRGGRTHLC-----------RNTTGVGVNRPG-----------CF
TDH_SALPK       ---------------GHITCGHCRNCRGGRTHLC-----------RNTTGVGVNRPG-----------CF
TDH_SALPC       ---------------GHITCGHCRNCRGGRTHLC-----------RNTTGVGVNRPG-----------CF
TDH_SALPB       ---------------GHITCGHCRNCRGGRTHLC-----------RNTTGVGVNRPG-----------CF
TDH_SALPA       ---------------GHITCGHCRNCRGGRTHLC-----------RNTTGVGVNRPG-----------CF
TDH_SALNS       ---------------GHITCGHCRNCRGGRTHLC-----------RNTTGVGVNRPG-----------CF
TDH_SALHS       ---------------GHITCGHCRNCRGGRTHLC-----------RNTTGVGVNRPG-----------CF
TDH_SALEP       ---------------GHITCGHCRNCRGGRTHLC-----------RNTTGVGVNRPG-----------CF
TDH_SALDC       ---------------GHITCGHCRNCRGGRTHLC-----------RNTTGVGVNRPG-----------CF
TDH_SALCH       ---------------GHITCGHCRNCRGGRTHLC-----------RNTTGVGVNRPG-----------CF
TDH_SALA4       ---------------GHITCGHCRNCRGGRTHLC-----------RNTTGVGVNRPG-----------CF
TDH_RHIL3       -------------------CGKCRNCRAGRGHLCRN----------------------TLGVGVNRPGSF
TDH_PYRKO       XXXXXDLQVGDYISVETHICGKCYACKHNRYHVCQN-------------TKIFGVDMDGV---------F
TDH_ENTS8       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTVGVGVNRPGCF
TDH_EDWI9       ---------------GHITCGHCRNCRAGRTHLCRN----------------------TIGVGVNRQGAF
TDH_ECOUT       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTIGVGVNRPGCF
TDH_ECOSM       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTIGVGVNRPGCF
TDH_ECOSE       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTIGVGVNRPGCF
TDH_ECOLI       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTIGVGVNRPGCF
TDH_ECOLC       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTIGVGVNRPGCF
TDH_ECOL6       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTIGVGVNRPGCF
TDH_ECOL5       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTIGVGVNRPGCF
TDH_ECOK1       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTIGVGVNRPGCF
TDH_ECOHS       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTIGVGVNRPGCF
TDH_ECODH       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTIGVGVNRPGCF
TDH_ECOBW       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTIGVGVNRPGCF
TDH_ECO8A       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTIGVGVNRPGCF
TDH_ECO81       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTIGVGVNRPGCF
TDH_ECO7I       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTIGVGVNRPGCF
TDH_ECO5E       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTIGVGVNRPGCF
TDH_ECO57       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTIGVGVNRPGCF
TDH_ECO55       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTIGVGVNRPGCF
TDH_ECO45       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTIGVGVNRPGCF
TDH_ECO27       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTIGVGVNRPGCF
TDH_BURVG       ---------------GHITCGFCRNCRAGRRHLCRN----------------------TVGVGVNREGAF
ADHA_RHIME      GAEVTRLKEGDRVGVPWTACGCCTPCRTGWETLCGS-----------QQNTGYSVDG-----------TF
TDH_BURTA       ---------------GHITCGFCRNCRAGRRHLCRN----------------------TVGVGVNREGAF
TDH_AERHH       ---------------GHITCGHCRNCRAGRTHLCRN----------------------TIGVGVNRPGAF
QOR_YEAST       ------------------------------------------------GVTNF-EVGDQVA--YISNSTF
ADH_SULAC       ----------------------------------------------------------------------
Y053_HAEIN      ----------------------------------------------------------------------
TDH_ECO24       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTIGVGVNRPGCF
TDH_BURS3       ---------------GHITCGFCRNCRAGRRHLCRN----------------------TVGVGVNREGAF
TDH_BURCJ       ---------------GHITCGFCRNCRAGRRHLCRN----------------------TVGVGVNREGAF
TDH_BURCH       ---------------GHITCGFCRNCRAGRRHLCRN----------------------TVGVGVNREGAF
TDH_BURCC       ---------------GHITCGFCRNCRAGRRHLCRN----------------------TVGVGVNREGAF
TDH_BURCA       ---------------GHITCGFCRNCRAGRRHLCRN----------------------TVGVGVNREGAF
TDH_BURA4       ---------------GHITCGFCRNCRAGRRHLCRN----------------------TVGVGVNREGAF
YDJL_ECOLI      ----------------------------------------------------------------------
TDH_THEON       ----------------------------------------------------------------------
TDH_RHIEC       -------------------CGKCRNCRAGRGHLCRN----------------------TLGVGVNRPGSF
TDH_RHIE6       -------------------CGKCRNCRAGRGHLCRN----------------------TLGVGVNRPGSF
TDH_FRAP2       -------------------CGQCRNCRAGKRHLCRK----------------------TIGIGVNVQGAF
TDH_BURM1       ---------------GHITCGFCRNCRAGRRHLCRN----------------------TVGVGVNREGAF
TDH_BURCM       ---------------GHITCGFCRNCRAGRRHLCRN----------------------TVGVGVNREGAF
DHSO_MOUSE      ----------------------------------------------------------------------
DHSO_BOMMO      ----------------------------------------------------------------------
DHSO2_YEAST     ----------------------------------------------------------------------
DHSO1_YEAST     ----------------------------------------------------------------------
ADHA_BACSU      XXXXXXXXXGDRVGVGVDSCGECEYCLNAEEQFCTKGVVQTYNSVDYDGNPTYGGYSQKI----------
TDH_SERP5       ---------------GHITCGHCRNCRGGRTHLC-----------RNTTGVGVNRPG-----------SF
TDH_RHISN       -------------------CGKCRNCRAGRGHLCRN----------------------TLGVGVNRPGSF
TDH_KLEP7       ---------------GHITCGHCRNCRAGRTHLCRN----------------------TIGVGVNRPGCF
TDH_KLEP3       ---------------GHITCGHCRNCRAGRTHLCRN----------------------TIGVGVNRPGCF
ADH_SCHPO       XXXXTRLKIGDRVGVKWSSCGNCEYCMKAEETICPHIQ-----------LSGYTVDG-----------TF
TDH_COLP3       ---------------GHITCGHCRNCRGGRTHLCRN----------------------TVGVGVNRAGSF
TDH_VIBCM       ---------------GHITCGHCRNCRGGRTHLCRN----------------------TIGVGVNRTGCF
TDH_VIBCH       ---------------GHITCGHCRNCRGGRTHLCRN----------------------TIGVGVNRTGCF
TDH_VIBC3       ---------------GHITCGHCRNCRGGRTHLCRN----------------------TIGVGVNRTGCF
TDH_ENT38       ---------------GHITCGHCRNCRGGRTHLCR----------------------NTVGVGVNRPGCF
TDH_AGRRK       -------------------CGKCRNCRAGRGHLCRN----------------------TLGVGVNRPGSF
TDH_STRMK       -------------------CGHCRNCRGGRPHLCPN----------------------TVGIGVNVNGAF
TDH_SALG2       ---------------GHITCGHCRNCRGGRTHLC-----------RNTTGVGVNRPG-----------CF
TDH_RHIME       -------------------CGKCRNCRAGRGHLCRN----------------------TLGVGVNRPGSF
TDH_DEIDV       ---------------GHVTCGHCRNCRAGRRHLCRN----------------------TLGVGVNRPGSF
IDND_VITVI      ----------------------------------------------------------------------
DHSO_RAT        ----------------------------------------------------------------------
TDH_RHILW       -------------------CGKCRNCRAGRGHLCRN----------------------TLGVGVNRPGSF
ADH_SULSR       ----------------------------------------------------------------------
YCJQ_SHIFL      ----------------------------------------------------------------------
YCJQ_ECOLI      ----------------------------------------------------------------------
TDH_PHOPR       ---------------GHITCGHCRNCRGGRTHLC-----------RNTTGVGVNRDG-----------AF
TDH_RHILO       -------------------CGHCRNCRAGRGHLCRN----------------------TLGVGVNRPGAF
TDH_ERWCT       ---------------GHITCGYCRNCRAGRRHLCRN----------------------AIGVGVNRPGSF
MTDH3_STYHU     GSKVEKYKVGDKVGVGYESCRSCQNCIDNLENYCPKHIDKHI-----DGTTTYGSDSMVVDEHF------
ADH_SULTO       ----------------------------------------------------------------------
TDH_SINMW       -------------------CGKCRNCRAGRGHLCRN----------------------TLGVGVNRPGSF
ADHN_AMYME      ----------------------------------------------------------------------
CAD8C_ORYSJ     XXXXXKFKAGDTVGVGYASCRGCECCGNGYENYCAKMVTTCNGVDHDHGGGAATQGG-------------
YGD6_SCHPO      ----------------------------------------------------------------------
TDH_PECCP       ----------------------------------------------------------------------
TDH_MARMS       ----------------------------------------------------------------------
TDH_SILPO       ------------------------------------------------------------------QGAF
TDH_PSYIN       ----------------------------------------------------------------------
QORL2_NEMVE     ----------------------------------------------------------------------
TDH_COXBU       ---------------GHITCGDCRNCRAGKRHLCRY----------------------TVGVGVNRPGAF
TDH_COXBR       ---------------GHITCGDCRNCRAGKRHLCRY----------------------TVGVGVNRPGAF
TDH_COXBN       ---------------GHITCGDCRNCRAGKRHLCRY----------------------TVGVGVNRPGAF
TDH_COXB2       ---------------GHITCGDCRNCRAGKRHLCRY----------------------TVGVGVNRPGAF
ADHC_MYCTU      GSEVTKYRQGDRVGVGVDSCRECNSCTRGIEQYCK-----------------------------------
ADHC_MYCBO      GSEVTKYRQGDRVGVGVDSCRECNSCTRGIEQYCK-----------------------------------


                         +         .         .         .         .         *         .:210
query           ANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILNSLGVRAGDTVAVFGXXXXXXXXXXXXXXXXX
XYLB_PSEPU      ATYALSYERNTVKVTKDVPLELLGPLGCGIQTGAGSVLNALNPPXXXXXXXXXXXXXXLSAVMAAVVAGC
FADH_AMYME      ADKTLVHAGQCTKVDPAADPAVAGLLGCGVMAGLGAAVNTGAVSRGDSVAVIGCGAVGDAVIAGARLAGA
ADH4_STRCA      SEYTVVSESSLAKIDAAAPLDKVCLIGCGFSTGYGAAINTAQVEPGSTCAVFGLGGVGLSAVMGCKAAGA
ADH1B_UROHA     TEYTVAPEDSVVKIDASAPLEKVCLIGCGFSTGYGAAINSAKVQPGSTCAVFGLGGVGLSAVMGCKAAGA
ADH1B_PANTR     SQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGLGGVGLSAVMGCKAAGA
ADH1B_HUMAN     SQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGLGGVGLSAVMGCKAAGA
ADH1_ALLMI      TEYTVVHETAVARIDAAAPLEKVCLIGCGFSTGYGAAVKDAKVEPGSTCAVFGLGGVGLSTIMGCKAAGA
ADH1A_HUMAN     SQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGLGGVGLSAIMGCKAAGA
ADH1B_PAPHA     SQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSVCAVFGLGGVGLSAVMGCKAAGA
ADHL_GADMO      SEYTVVAEISLAKVHEKAPLDKVCLLGCAISTGYGAALNTAKVEAGSTCAVFGLGALGLAVIMGCQAAGA
ADH1G_PAPHA     SQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGPAVKVAKVTPGSTCAVFGLGGVGLSAVMGCKAAGA
ADH1A_UROHA     TEYTVVHENSVVKIDAAAPLEKVCLIGCGFSTGYGAAVETAKVEPGSTCAVFGLGGVGLSAVMGCKAAGA
ADH4_HUMAN      SQYTVVSDINLAKIDDDANLERVCLLGCGFSTGYGAAINNAKVTPGSTCAVFGLGGVGLSAVMGCKAAGA
ADH1A_PONAB     SQYTVVDENAVAKIDAASPLAKVCLIGCGFSTGYGSAVNVAKVTPGSTCAXXXXXXXXXXXXXXCKAAGA
ADHX_SPAAU      SEYTVVADISLAKVNEKAPMDKVCLLGCGISTGYGAALNTAKVEPGSTCAVFGLGAVGLAVIMGCKVAGA
ADH1_STRCA      TEYTVLHETAVAKIDAAAPLEKVCLIGCGFSTGYGAALQTAKVEPGSTCAXXXXXXXXXXXXXXCKAAGA
FRMA_HAEIN      SEYSVVAEVSLAKINPEANHEQVCLLGCGVTTGIGAVHNTAKVQEGDSVAVFGLGAIGLAVVQGARQAKA
ADHP_RABIT      SQYTVVKDVNLAKIDDDANLERVCLIGCGFSTGYGAAINTAKVTPGSTCAVFGLGGVGLSAIMGCKTAGA
ADH1_MOUSE      SQYTVVDDIAVAKIDGASPLDKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFXXXXXXXXXXXXCKAAGA
ADH1_PERMA      SQYTVVDEMAVAKIDGASPLEKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFXXXXXXXXXXXXCKAAGA
ADH4_MOUSE      SQYTVVSEANLARVDDEANLERVCLIGCGFSSGYGAAINTAKVTPGSTCAVFGLGCVGLSAIIGCKIAGA
ADH1G_HUMAN     SQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTPGSTCAXXXXXXXXXXXXXXCKAAGA
FRMA_SYNY3      SEYTVVAEVSLAKINPEANHEHVCLLGCGVTTGIGAVHNTAKVQPGDSVAVFGLGGIGLAVVQGARQAKA
FADH_PARDE      SNYTVLPEIAVAKVREDAPFDKICYIGCGVTTGIGAVINTAKVEIGAKAVVFGLGGIGLNVLQGLRLAGA
ADH1A_MACMU     SQYTVVDENAVAKIDAASPMEKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFGLGGVGLSAVMGCKAAGA
ADH1_APTAU      TEYTVVHETAVAKIAAAAPLEKVCLIGCGFSTGYGAAVQTAKVEPGSTCAXXXXXXXXXXXXXXCKAAGA
ADH1E_HORSE     SQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGA
ADH4_RAT        SQYTVVSEANLARVDDEANLERVCLIGCGFTSGYGAAINTAKVTPGSACAVFGLGCVGLSAVIGCKIAGA
FRMA_ECOL6      SEYTVVAEVSLAKINPEANHEHVCLLGCGVTTGIGAVHNTAKVQPGDSVAVFGLGAIGLAVVQGARQAKA
TERPD_PSESP     XXMAMAREHNLVKIDDDAPIELLGPLGCGVQTGAGAVMISLDVRAGRSFXXXXXXXXXXXXXXXXKLRGC
FRMA_ECOUT      SEYTVVAEVSLAKINPEANHEHVCLLGCGVTTGIGAVHNTAKVQPGDSVAVFGLGAIGLAVVQGARQAKA
FRMA_ECOL5      SEYTVVAEVSLAKINPEANHEHVCLLGCGVTTGIGAVHNTAKVQPGDSVAVFGLGAIGLAVVQGARQAKA
FRMA_ECOK1      SEYTVVAEVSLAKINPEANHEHVCLLGCGVTTGIGAVHNTAKVQPGDSVAVFGLGAIGLAVVQGARQAKA
ADHQ_RABIT      SQYTVVKDINLAKIDDDANLKRVCLIGCGFSTGYGAAINDAKVTPGSTCAVFGLGGVGLSAVIGCKTAGA
ADH7_MOUSE      TEYTVLDESSVAKVDGAAPPEKACLIGCGFSTGYGAAVKTAKVTPGSTCXXXXXXXXXXXXIMGCKAAGA
ADH1_CHICK      TEYTVVHETAAAKIDSAAPLEKVCLIGCGFSTGYGAVLQTAKVEAGSTCAXXXXXXXXXXXXXXCKAAGA
ADH7_RAT        TEYTVLDESSVAKIDAEAPPEKACLIGCGFSTGYGAAVKTAKVSPGSTCAXXXXXXXXXXXXXXCKAAGA
FRMA_SHISS      SEYTVVAEVSLAKINPEANHEHVCLLGCGVTTGIGAVHNTAKVQPGDSVAVFGLGAIGLAVVQGARQAKA
FRMA_ECOLI      SEYTVVAEVSLAKINPEANHEHVCLLGCGVTTGIGAVHNTAKVQPGDSVAVFGLGAIGLAVVQGARQAKA
FRMA_ECOLC      SEYTVVAEVSLAKINPEANHEHVCLLGCGVTTGIGAVHNTAKVQPGDSVAVFGLGAIGLAVVQGARQAKA
FRMA_ECOHS      SEYTVVAEVSLAKINPEANHEHVCLLGCGVTTGIGAVHNTAKVQPGDSVAVFGLGAIGLAVVQGARQAKA
FRMA_ECO57      SEYTVVAEVSLAKINPEANHEHVCLLGCGVTTGIGAVHNTAKVQPGDSVAVFGLGAIGLAVVQGARQAKA
FRMA_ECO24      SEYTVVAEVSLAKINPEANHEHVCLLGCGVTTGIGAVHNTAKVQPGDSVAVFGLGAIGLAVVQGARQAKA
ADH1_COTJA      TEYTVVHETAAAKIDSAAPLEKVCLIGCGFSTGYGAVLQTAKVEPGSTCAXXXXXXXXXXXXXXCKAAGA
ADHI_RHOS4      SNYTVLPEIAVAKVRPDAPFDKICYIGCGVTTGIGAVINTAKVEIGAKAVVFGLGGIGLNVIQGLKLAGA
ADH1S_HORSE     SQYTVVDEISVAKIDAASPLEKVCLVGCGFSTGYGSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGA
ADH1_NAJNA      TEYTVVHENSVVKIDPSAPLEKVCLIGCGFSTGYGAAMQTAKVEPGSICAXXXXXXXXXXXXXXCKAAGA
FRMA_ECOSM      SEYTVVAEVSLAKINPEANHEHVCLLGCGVTTGIGAVHNTAKVQPDDSVAVFGLGAIGLAVVQGARQAKA
ADH1_RABIT      SQYTVVDEIAVAKIDAAAPLEKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFGLGGVGLSVIMGCKAAGA
ADH1_RANPE      TEYTVLDEIAVAKIHEDAPLEKVCLIGCGFSTGYGSAVNTGKVKPGSTCAVFXXXXXXXXXXXXCKVAGA
FRMA_PASPI      SEYTVVAEVSLAKINPQANAEQVCLLGCGVTTGIGAVHNTAKVQEGDSVAVFGLGGIGLAVVQGARQAKA
ADH1_GEOAT      SEYTVVSEISVTKIDAASPLEKVCLIGCGFSTGYGSAVKVGKVARGSICACVWSGRVGLSAIIGCKAAGA
ADHX_CAEEL      SEYTVVADISLCKVNPEAPLEKVSLLGCGISTGYGAVLNTCKVEEGSTVAVWGLGAVGLXXXXXXXXXXX
ADH7_HUMAN      TEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGYGAAVKTGKVKPGSTCXXXXXXXXXXXXIMGCKSAGA
ADH1_GEOBU      SEYTVVSEISVTKIDATSPLEKVCLIGCGFSTGYGSAVKVGKVARGSICSCVWSGRVGLSAIIGCKAAGA
ADHX_OCTVU      SEFTVVAEISIAKVNPKAALDKVCLLGCGISTGYGAALNTAAVEKGSNCXXXXXXXXXXXXXXXXXXXXX
ADHX_MYXGL      SEYAVVADISLCRVAPEAPPDRVCLLGCGVSTGYGAPLNTAKVEPGSTCAIFGLGAVGLAAIMGCRVAGA
ADHX_UROHA      SEYTVVADISLTKINASAPLDKVCLLGCGVSTGYGAALNTAKVEPGSTCXXXXXXXXXXXXIMGCKVAGA
ADH1_GEOKN      SEYTVVSEISVTKIDAASPLEKVCLIGCGFSTGYGSAVKVGKVARGSICSCVWSGRVGLSAIIGCKAAGA
ADH1_GADCA      SQYTVVNQIAVAKIDPSAPLDTVCLLGCGVSTGFGAAVNTAKVEPGSTCXXXXXXXXXXXXXXXCHSAGA
ADHX_DROME      AEYTVVADISLTKINEKAPLEKVCLLGCGISTGYGAALNTAKVEAGSTCXXXXXXXXXXXXXXXCKKAGA
ADHL3_ARATH     TEYTVLDSACVVKIDPNSPLKQMSLLSCGVSTGVGAAWNIANVKEGKSTAVFGLGSVGLAVAEGARARGA
ADHH_GADMO      SEYTVVADISLANVDPKAPLDKVCLLGCGISTGYGAALNTAKVEPGSTCXXXXXXXXXXXXIMGCKVAGA
ADHX_HORSE      SEYTVVADISVAKIDPLAPLDKVCLLGCGVSTGYGAAVNTAKVEPGSTCAIFGLGGVGLAVIMGCKVAGA
FADH_CANMA      SQYTVVADISVVAINPKAEFDKACLLXXXXXXXXXXXXXXXNVQKGDNVAVFGGGIVGLSVIQGCAERGA
FADH_YEAST      SEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGA
ADH1_RAT        SQYTXXXXXXXXXXXXXXPLDKVCLIGCGFSTGYGSAVQVAKVTPGSTCAXXXXXXXXXXXXXXCKTAGA
ADHX_RABIT      SEYTVVADISVAKIDPSAPLDKVCLLGCGISTGYGAALNTAKVEPGSTCXXXXXXXXXXXXIMGCKAAGA
ADHX_DICDI      SQYTVLPEISCCVVREDAPLDKVCLLGCGITTGFGAAKITAKVEEGSTVAIFGLGAVGLSVAQGAVDCGA
ADHX_RAT        SEYTVVADISVAKIDPSAPLDKVCLLGCGISTGYGAAVNTAKVEPGSTCXXXXXXXXXXXXIMGCKVAGA
ADH6_PONAB      CEYTVIKEISVAKIDAVAPLEKVCLISCGFSTGFGAAINTAKVTPGSTCAXXXXXXXXXXXXXXCKAAGA
ADH1_PEA        SEYTVVHAGCVAKINPDAPLDKVCILSCGICTGLGATINVAKPKPGSSVAIFXXXXXXXXXXXXXRISGA
FADH_PICPA      SQYTVVADISVVKVQDEAPKDKTCLLGCGVTTGYGAAINTAKISKGDKIGVFGAGCIGLSVIQGAVSKGA
ADH8_RANPE      TEYTVVADIAVAKIDPKA-PLESCLIGCGFATGYGAAVNTAKVTPGSTCAVFGLGGVGFSAIVGCKAAGA
ADHX_PEA        SQYTVVHDVSVAKIHPDAPLDKVCLLGCGVPTGLGAVWNTAKVEPGSIVAIFGLGTVGLAVAEGAKSAGA
ADHX_ORYSJ      SQYTVVHDVSVAKINPQAPLDKVCLLGCGVSTGLGAVWNTAKVEAGSIVAIFGLGTVGLAVAEGAKSAGA
ADHX_ORYSI      SQYTVVHDVSVAKINPQAPLDKVCLLGCGVSTGLGAVWNTAKVEAGSIVAIFGLGTVGLAVAEGAKSAGA
ADHX_MOUSE      SEYTVVADISVAKIDPSAPLDKVCLLGCGISTGYGAAVNTAKVEPGSTCXXXXXXXXXXXXIMGCKVAGA
ADHX_BOVIN      SEYTVVADISVAKIDPLAPLDKVCLLGCGISTGYGAALNAAKVEPGSTCXXXXXXXXXXXXIMGCKMAGA
ADH1_TRIRP      SEYTVVHAGCVAKINPDAPLDKVCILSCGICTGLGATVNVAKPKPGSSVAIFXXXXXXXXXXXXXRMSGA
ADH6_HUMAN      CEYTVIKEISVAKIDAVAPLEKVCLISCGFSTGFGAAINTAKVTPGSTCAXXXXXXXXXXXXXXCKAAGA
FADH1_SCHPO     SQYTVVADISLVAISHSAPLRSICLLGCGVTTGFGAVTHSAKVESGSTXXXXXXXXXXXXXXXXXXXXXX
ADHX_MAIZE      SQYTVVHDVSVAKINPQAPLDKVCLLGCGVPTGLGAVWNTAKVESGSVVAVFGLGTVXXXXXXXXXXXXX
ADHL6_ARATH     SEYTVVHSGCAVKVDPLAPLHKICLLSCGVAAGLGAAWNVADVQKGSSVVIFGLGTVGLSVAQGAKLRGA
ADH1_ARATH      SEYTVVHSGQVAKINPDAPLDKVCIVSCGLSTGLGATLNVAKPKKGQSXXXXXXXXXXXXXXXXXRIAGA
ADHL7_ARATH     SEYTVLDVANVVKIDSSIPPSRACLLSCGVSTGVGAAWETAKVEKGSTVVIFGLGSIGLAVAEGARLCGA
ADHX_HUMAN      SEYTVVADISVAKIDPLAPLDKVCLLGCGISTGYGAAVNTAKLEPGSXXXXXXXXXXXXXXIMGCKVAGA
ADHX_ARATH      SQYTVVHDVSVAKIDPTAPLDKVCLLGCGVPTGLGAVWNTAKVEPGSNVAIFGLGTVGLAVAEGAKTAGA
FADH2_SCHPO     SEYTVVADISVVAIERLAPLDSVCLLGCXXXXXXXXXXXXXXXKEGDSVAVFGLGSVGLAVIQGAVKKRA
ADH6_PERMA      SEYIVIKEISVAKVDEDALLEKACIIGCGFATGFGAAINSAKVSPGSTCAVFGLGGVGLSVIMGCKAAGA
ADH3_HORVU      SEYTVIHVGCLAKINPEAPLDKVCVLSCGLSTGLGATLNVAKPKKGSTVAIFGLGAVGLAAMEGARMAGA
ADHB_MYCTU      SPYMVVHRSSVVKIDPSVPFEVACLVGCGVTTGYGSAVRTADVRPGDDVAIVGLGGVGMAALQGAVSAGA
ADHB_MYCBO      SPYMVVHRSSVVKIDPSVPFEVACLVGCGVTTGYGSAVRTADVRPGDDVAIVGLGGVGMAALQGAVSAGA
ADH1_PETHY      SEYTVCHSGCVTKIDPQAPLDKVCVLSCGISTGLGATLNVAKPTKGSTVXXXXXXXXXXXXXXXXXXXXX
ADH1_PENAM      SEYTVMHVGCVAKINPEAPLDKVCVLSCGISTGLGASINVAKPPKGSTVXXXXXXXXXXXXXXXXXXXXX
ADHL2_ARATH     TEYTVVDIAHLVKISPEIPVDIAALLSCSVATGLGAAWKVADVEEGSTVVIFXXXXXXXXXXXXXXXRGA
ADH1_MAIZE      SEYTVMHVGCVAKINPQAPLDKVCVLSCGYSTGLGASINVAKPPKGSTXXXXXXXXXXXXXXXXXXXXXX
ADH2_HORVU      SEYTVIHVGCVAKIDPEAPLDKVCLLSCGISTGLGATLNVTKPKKGMTVAIFGLGAVGLAAMEGARMSGA
ADH6_RAT        SEYTVLKEISVAKIDEGAPLEKVCIIGCGFATGYGAAINSAKVTPGSTCAVFXXXXXXXXXXXXCKAAGA
ADH2_MAIZE      SEYTVIHVGCLAKINPEAPLDKVCILSCGISTGLGATLNVAKPAKGSTVAIFGLGAVGLAAMEGARLAGA
ADH1_ORYSJ      SEYTVMHVGCVAKINPAAPLDKVCVLSCGISTGLGATINVAKPPKGSTXXXXXXXXXXXXXXXXXXXXXX
ADH1_ORYSI      SEYTVMHVGCVAKINPAAPLDKVCVLSCGISTGLGATINVAKPPKGSTXXXXXXXXXXXXXXXXXXXXXX
ADHL4_ARATH     SEYTVIDSACVLKVDPLFPLEKISLLSCGVSTGVGAAWNVADIQPASTVAIFXXXXXXXXXXXXXXXXXX
ADH1_SOLTU      SEYTVVHVGCVAKINPLAPLDKVCVLSCGISTGLGATLNVAKPTKGSSVXXXXXXXXXXXXXXXXXXXXX
ADH1_HORVU      SEYTVMHVGCVAKINPEAPLDKVCVLSCGISTGLGASINVAKPPKGSTVXXXXXXXXXXXXXXXXXXXXX
ADH3_SOLTU      SEYTVVHVGCVAKINPLAPLDKVCVLSCGISTGLGATLNVAKPTKGSSVXXXXXXXXXXXXXXXXXXXXX
ADH2_SOLTU      SEYTVVHVGCVAKINPLAPLDKVCVLSCGISTGLGATLNVAKPTKGSSVXXXXXXXXXXXXXXXXXXXXX
ADHL1_ARATH     SEYTVVDIAHLVKISPEIPVDKAALLSCGVSTGIGAAWKVANVEEGSTIAIFXXXXXXXXXXXXXRLRGA
ADH2_SOLLC      SEYTVVHVGCVAKINPLAPLDKVCVLSCGISTGLGASLNVAKPTKGSSVXXXXXXXXXXXXXXXXXXXXX
ADHL5_ARATH     SEYTVVDIAHLVKISPDIPVDKAALLSCGVSTGIGAAWKVANVEKGSTXXXXXXXXXXXXXXXXXRLRGA
ADH_MALDO       SEYTVVHVGCLAKINPSAPLDKVCLLSCGISTGLGATLNVAKPKKGSTXXXXXXXXXXXXXXXXXXXSGA
ADH_FRAAN       SVYTVTHVGCLAKINPQSPLDKVCILSCGISTGLGATLNVRKPKKGSTXXXXXXXXXXXXXXXXXXXXXX
ADH2_ORYSJ      SEYTVIHVGCLAKINPEAPLDKVCILSCGFSTGFGATVNVAKPKKGQTVAIFGLGAVGLAAMEGARLSGA
ADH2_ORYSI      SEYTVIHVGCLAKINPEAPLDKVCILSCGFSTGFGATVNVAKPKKGQTVAIFGLGAVGLAAMEGARLSGA
ADH1_BACST      AEYCRAAADYVVKIPDNLSFEEAAPIFCAGVTTYKA-LKVTGAKPGEWVAIYG-IGGLGHVAVQYAKAMG
ADH3_BACST      AEYCRAAADYVVKIPDNLSFEEAAPIFCAGVTTYKA-LKVTGAKPGEWVAIYG-IGGLGHVAVQYAKAMG
ADH2_BACST      AEYCKAPADYVAKIPDNLDPVEVAPILCAGVTTYKALKVS-GARPGEWVAIYG-IGGLGHIALQYAKAMG
ADH1_ZEALU      SEYTVMHVGCVAKINPQAPLDKVCVLSCGISTGLGASINVAKPPKGSTXXXXXXXXXXXXXXXXXXXXXX
ADH1_ANAPL      ---------------------------------------------GSTCAVFGLGGVGLSVIMGCKAAGA
DHSO_BACSU      VQYIKMRQDFVFLIPDSLSYEEAALIEPF-SVGIHAAARTK-LQPGSTIAIMGMGPVGLMXXXXXXXXXX
BDHA_BACSU      -------------------------------------VRSSKLKAGDKAAVFGCGPIGLLVIEALKAAGA
YJMD_BACSU      REYIVLPERQLHAVSKDLPWEEAVMAEPY-TIGAQAVWRGQ-VEKGDTVLIQGAGPIGICVLKMAKLAGA
ADH_STAAW       ----IVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVS-NVKPGQWLGVFGIGGLGNLALQYAKNVMG
ADH_STAAS       ----IVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVS-NVKPGQWLGVFGIGGLGNLALQYAKNVMG
ADH_STAAR       ----IVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVS-NVKPGQWLGVFGIGGLGNLALQYAKNVMG
ADH_STAAN       ----IVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVS-NVKPGQWLGVFGIGGLGNLALQYAKNVMG
ADH_STAAM       ----IVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVS-NVKPGQWLGVFGIGGLGNLALQYAKNVMG
ADH_STAAC       ----IVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVS-NVKPGQWLGVFGIGGLGNLALQYAKNVMG
ADH_STAAB       ----IVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVS-NVKPGQWLGVFGIGGLGNLALQYAKNVMG
ADH_STAA8       ----IVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVS-NVKPGQWLGVFGIGGLGNLALQYAKNVMG
ADH_STAA3       ----IVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVS-NVKPGQWLGVFGIGGLGNLALQYAKNVMG
XYLD_MORMO      ----------------------------------------------------------------------
TDH_SHEON       AEYLVIPAFNAFKIPDDISDDLASIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVCRHVGA
YDJJ_ECOLI      FTY---------KLPDNMDTMEGALVEPAAVGMHAAMLAD--VKPGKKIIILGAGCIGLMTLQACKCLGA
TDH_SHEPC       AEYLVIPAFNAFKIPDDISDDLASIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVCRHVGA
TDH_BACA2       AEYVKVPARNVWKNPADMDPAVASVQEPLGNA-VHTVLESSQL-AGGSAAIIGCGPIGLMXXXXXXXXXX
ADH_STAES       AEEVIVDANYAVKVPENLDPAAASSITCAGVTTYKAVKVS-GIEPXXXXXXXXXXXXXXXXXQYAKNVMG
TDH_SHEWM       AEYLVIPAFNAFKIPDDISDDLASIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVCRHVGA
TDH_SHESR       AEYLVIPAFNAFKIPDDISDDLASIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVCRHVGA
TDH_SHESM       AEYLVIPAFNAFKIPDDISDDLASIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVCRHVGA
TDH_SHESA       AEYLVIPAFNAFKIPDDISDDLASIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVCRHVGA
TDH_SHEB9       AEYLVIPAFNAFKIPDDISDDLASIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVCRHVGA
TDH_SHEB8       AEYLVIPAFNAFKIPDDISDDLASIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVCRHVGA
TDH_SHEB5       AEYLVIPAFNAFKIPDDISDDLASIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVCRHVGA
TDH_SHEB2       AEYLVIPAFNAFKIPDDISDDLASIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVCRHVGA
TDH_SHESW       AEYLVIPAFNAFKIPDDISDDLASIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVCRHVGA
ADH_STAEQ       AEEVIVDANYAVKVPENLDPAAASSITCAGVTTYKAVKVS-GIEPXXXXXXXXXXXXXXXXXQYAKNVMG
YPHC_ECOLI      ----------------------------------------------------------------------
TDH_SHESH       AEYLVIPAFNAFKIPDDISDDLASIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVCRHVGA
TDH_SHEPA       AEYLVIPAFNAFKIPDDISDDLASIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVCRHVGA
TDH_SHEHH       AEYLVIPAFNAFKIPDDISDDLASIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVCRHVGA
TDH_SHEAM       AEYLVIPAFNAFKIPDDISDDLAAIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVCRHVGA
TDH_SHELP       AEYLVIPAFNAFKIPDDISDDLASIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVCRHVGA
TDH_MESSB       AEYISLPQHNVVAIPDDVPDEIAAIFDPLGNAVHTALSFDL---VGEDVLVTGAGPIGIMGALVAQCVGA
DHSO_BACHD      AKYVIARQESLHHLPAGVDDRSAAMTEPLACTHHAIAKTS--INKGDLVVVTGPGPIGLLAAQVAKSHGG
TDH_BACLD       AEYVKMPAANIWK---NPAGMPEDLASIQEPLGNAVHTVLTGMTAGVKVAVVGCGPIGLMXXXXXXXXXX
ADH_RALEU       AEYVLVAQANLTPIPDGLTDEQVLMCPDIMSTGFKGAENA-NIRIGHTVAVFAQGPIGLCATAGARLCGA
TDH_CHRVO       AEYLVIPAFNAFPIPDDISDDLASIFDPFGNAVHTALSFNL---VGEDVLITGAGPIGIMAVAIAKHVGA
ADHB_BACSU      ANFTHFKIPESCEEPDE----KLSVIADAMTTGFWSVDNA-GVKKGDTVIVLGCGPVGLFAQKFCWLKGA
ADH3_KLULA      QQYATADAVQAARIPKGTDLAEVAPILCAGVTVYKA-LKSANLKAGDWVXXXXXXXXXXXXXVQYAKAMG
TDH_PYRAB       AEYAVVPAQNVWKNPKSIPPEYATLQEPLGNAVDTVLAGPI---SGKSVLITGAGPLGLLGIAVAKASGA
YAHK_ECOLI      ----------------------------------------------------------------------
XYL2_PICST      ----------------------------------------------------------------------
TDH_SHEFN       AEYLVLPAFNAFKIPADIPDDLAAIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVCKHVGA
TDH_PSEHT       AEYLVIPAFNAFKIPDNISDELASIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVAKHVGA
TDH_PSEA6       AEYLSIPAFNAFKIPDNISDDLAAIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVAQHVGA
ADH2_KLULA      QQYATADAVQAARIPKGTDLAEVAPILCAGVTVYKA-LKSADLKAGDWVAISGACGGLGSLAIQYAKAMG
TDH_PHOLL       AQYLVIPAFNAFKIPDNISDELAAIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVCKHVGA
TDH_PYRHO       AEYAVVPAQNIWKNPKSIPPEYATLQEPLGNAVDTVLAGPI---SGKSVLITGAGPLGLLGIAVAKASGA
TDH_BACSU       AEYVKVPADNIWRNPADMDPSIASIQEPLGNA-VHTVLESQP--AGGTTAVIGCGPIGLMXXXXXXXXXX
TDH_ALTMD       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVAKHVGA
ADH1_KLULA      QQYATADAVQAAKIPVGTDLAEVAPVLCAGVTVYKA-LKSANLKAGDWVXXXXXXXXXXXXXVQYAKAMG
TDH_YERPY       AEYLVIPAFNAFKIPDNISDELAAIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVCKHVGA
TDH_YERPS       AEYLVIPAFNAFKIPDNISDELAAIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVCKHVGA
TDH_YERPP       AEYLVIPAFNAFKIPDNISDELAAIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVCKHVGA
TDH_YERPN       AEYLVIPAFNAFKIPDNISDELAAIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVCKHVGA
TDH_YERPG       AEYLVIPAFNAFKIPDNISDELAAIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVCKHVGA
TDH_YERPE       AEYLVIPAFNAFKIPDNISDELAAIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVCKHVGA
TDH_YERPB       AEYLVIPAFNAFKIPDNISDELAAIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVCKHVGA
TDH_YERPA       AEYLVIPAFNAFKIPDNISDELAAIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVCKHVGA
TDH_YERP3       AEYLVIPAFNAFKIPDNISDELAAIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVCKHVGA
TDH_THETN       AEYIKVP-ESNVWINDKNIPLEILSIQEPLGNAVHTVFS--GDVVGKSVAVIGCGPIGMMAIPLLKRTGA
TDH_BURXL       AEYLVIPAFNAFKIPPEISDDLAAIFDPFGNATHTALSFNL---VGEDVLITGAGPIGIMAVAIAKHVGA
TDH_BURPP       AEYLVIPAFNAFKIPPEISDDLAAIFDPFGNATHTALSFNL---VGEDVLITGAGPIGIMAVAIAKHVGA
TDH_BURP8       AEYLVIPAFNAFKIPPEISDDLAAIFDPFGNATHTALSFNL---VGEDVLITGAGPIGIMAVAIAKHVGA
ADHP_ECOLI      AEECIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSK-IRPGQWIAIYGLGGLGNLALQYAKNVFN
ADH1_CANAL      EQYATADAVQAAKIPAGTDLANVAPILCAGVTVYKA-LKTADLAAGQWVAIXXXXXXXXXXXVQYARAMG
TDH_THET8       ----------------------------------------------------------------------
TDH_SHISS       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_PYRFU       AEYAVVPAQNVWKNPKNIPPEYATLQEPLGNAVDTVLAGPI---AGKSVLITGAGPLGLLGIAVAKASGA
TDH_FRATN       AEYLVMPAVNVFKIPDSISDDIASTFDPMGNAIHTALSFNL---TGEDVLITGAGPIGLMAVKIARFCGA
TDH_CITK8       AEYLVLPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_BURPS       AEYLAIPAFNAFKIPPEISDDLAAIFDPFGNATHTALSFNL---VGEDVLITGAGPIGVMAVAIAKHVGA
TDH_BURP6       AEYLAIPAFNAFKIPPEISDDLAAIFDPFGNATHTALSFNL---VGEDVLITGAGPIGVMAVAIAKHVGA
TDH_BURP1       AEYLAIPAFNAFKIPPEISDDLAAIFDPFGNATHTALSFNL---VGEDVLITGAGPIGVMAVAIAKHVGA
TDH_BURP0       AEYLAIPAFNAFKIPPEISDDLAAIFDPFGNATHTALSFNL---VGEDVLITGAGPIGVMAVAIAKHVGA
TDH_BURMS       AEYLAIPAFNAFKIPPEISDDLAAIFDPFGNATHTALSFNL---VGEDVLITGAGPIGVMAVAIAKHVGA
TDH_BURMA       AEYLAIPAFNAFKIPPEISDDLAAIFDPFGNATHTALSFNL---VGEDVLITGAGPIGVMAVAIAKHVGA
TDH_BURM9       AEYLAIPAFNAFKIPPEISDDLAAIFDPFGNATHTALSFNL---VGEDVLITGAGPIGVMAVAIAKHVGA
TDH_BURM7       AEYLAIPAFNAFKIPPEISDDLAAIFDPFGNATHTALSFNL---VGEDVLITGAGPIGVMAVAIAKHVGA
TDH_AERS4       AEYLVIPAFNAFKLPDNIPDELAAIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVCRHVGA
ADH1_ZYMMO      AEECIVVADYSVKVPDGLDPAVASSITCAGVTTYKAVKVSQ-IQPGQWLAIYGLGGLGNLALQYAKNVFN
TDH_SYMTH       ----------------------------------------------------------------------
TDH_SALAR       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGVMAAAVAKHVGA
TDH_PROMH       AEYLVIPAFNAFKIPDNIPDELAAIFDPFGNAVHTALSFDL---VGEDVLVSXXXXXXXXXXXXCKHVGA
TDH_FRATW       AEYLVMPAVNVFKIPDSISDDIASTFDPMGNAIHTALSFNL---TGEDVLITGAGPIGLMAVKIARFCGA
TDH_FRATT       AEYLVMPAVNVFKIPDSISDDIASTFDPMGNAIHTALSFNL---TGEDVLITGAGPIGLMAVKIARFCGA
TDH_FRATO       AEYLVMPAVNVFKIPDSISDDIASTFDPMGNAIHTALSFNL---TGEDVLITGAGPIGLMAVKIARFCGA
TDH_FRATM       AEYLVMPAVNVFKIPDSISDDIASTFDPMGNAIHTALSFNL---TGEDVLITGAGPIGLMVVKIARFCGA
TDH_FRATH       AEYLVMPAVNVFKIPDSISDDIASTFDPMGNAIHTALSFNL---TGEDVLITGAGPIGLMAVKIARFCGA
TDH_FRATF       AEYLVMPAVNVFKIPDSISDDIASTFDPMGNAIHTALSFNL---TGEDVLITGAGPIGLMAVKIARFCGA
TDH_FRAT1       AEYLVMPAVNVFKIPDSISDDIASTFDPMGNAIHTALSFNL---TGEDVLITGAGPIGLMAVKIARFCGA
TDH_THET2       ----------------------------------------------------------------------
TDH_IDILO       AEYLALPAENAFKLPDDVTDEMAAVFDPFGNAVHTALAFDL---VGEDVLITGAGPIGIMXXXXXXXXXX
TDH_ECOLU       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_YERE8       AEYLVIPAFNAFKIPDNISDELAAIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVCKHVGA
TDH_VIBPA       AEYLVIPAFNAFKIPDEISDDLASIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVAKHVGA
TDH_STRCO       AEYVALPASNVVPVDLDVAAIFDPF--------GNAVHTALSFPVGEDVLITGAGPIGLMXXXXXXXXXX
TDH_SHIFL       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_SHIF8       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_SHIBS       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_SHIB3       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_SALTY       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGVMAAAVAKHVGA
TDH_SALTI       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGVMAAAVAKHVGA
TDH_SALSV       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGVMAAAVAKHVGA
TDH_SALPK       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGVMAAAVAKHVGA
TDH_SALPC       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGVMAAAVAKHVGA
TDH_SALPB       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGVMAAAVAKHVGA
TDH_SALPA       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGVMAAAVAKHVGA
TDH_SALNS       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGVMAAAVAKHVGA
TDH_SALHS       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGVMAAAVAKHVGA
TDH_SALEP       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGVMAAAVAKHVGA
TDH_SALDC       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGVMAAAVAKHVGA
TDH_SALCH       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGVMAAAVAKHVGA
TDH_SALA4       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGVMAAAVAKHVGA
TDH_RHIL3       GEFVCIPESNVVPIPDDISDEIAAIFDPFGNAVHTALSFDL---VGEDVLVTGAGPIGIMGALVAKRSGA
TDH_PYRKO       AHYAIVPAKNAWKNPKDMPPEYAALQEPLGNAVDTVLAGPI---AGRSTLITGAGPLGLLGIAVAKASGA
TDH_ENTS8       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_EDWI9       AEYLVIPAFNAFKIPDNIPDALAAIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVCRHVGA
TDH_ECOUT       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_ECOSM       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_ECOSE       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_ECOLI       AEYLVIPAFNAFKIPDNISDDLAAIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_ECOLC       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_ECOL6       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_ECOL5       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_ECOK1       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_ECOHS       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_ECODH       AEYLVIPAFNAFKIPDNISDDLAAIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_ECOBW       AEYLVIPAFNAFKIPDNISDDLAAIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_ECO8A       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_ECO81       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_ECO7I       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_ECO5E       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_ECO57       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_ECO55       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_ECO45       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_ECO27       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_BURVG       AEYLAIPAFNAFKIPPEISDDLASIFDPFGNATHTALSFNL---VGEDVLITGAGPIGIMAVAIAKHVGA
ADHA_RHIME      AQYGLADPDFVGRLPARLEFGPAAPVLCAGVTVYKG-LKETEVRPGEWVLVSGIGGLGHMAVQYAKAMGM
TDH_BURTA       AEYLAIPAFNAFKIPPEISDDLAAIFDPFGNATHTALSFNL---VGEDVLITGAGPIGVMAVAIAKHVGA
TDH_AERHH       AEYLVIPAFNAFKLPDNVPDELAAIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVCRHVGA
QOR_YEAST       AQYSKISSQGPVKGTSDEELKLYAAGLLQVLTALSFTNEAYHVKKGDYVLLFAAAGGVGLILNQLLKMKG
ADH_SULAC       ----------------------------------------------------------------------
Y053_HAEIN      ----------------------------------------------------------------------
TDH_ECO24       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_BURS3       AEYLAIPAFNAFKIPPEISDDLASIFDPFGNATHTALSFNL---VGEDVLITGAGPIGIMAVAIAKHVGA
TDH_BURCJ       AEYLAIPAFNAFKIPPEISDDLASIFDPFGNATHTALSFNL---VGEDVLITGAGPIGIMAVAIAKHVGA
TDH_BURCH       AEYLAIPAFNAFKIPPEISDDLASIFDPFGNATHTALSFNL---VGEDVLITGAGPIGIMAVAIAKHVGA
TDH_BURCC       AEYLAIPAFNAFKIPPEISDDLASIFDPFGNATHTALSFNL---VGEDVLITGAGPIGIMAVAIAKHVGA
TDH_BURCA       AEYLAIPAFNAFKIPPEISDDLASIFDPFGNATHTALSFNL---VGEDVLITGAGPIGIMAVAIAKHVGA
TDH_BURA4       AEYLAIPAFNAFKIPPEISDDLASIFDPFGNATHTALSFNL---VGEDVLITGAGPIGVMAAAIAKHVGA
YDJL_ECOLI      ----------------------------------------------------------------------
TDH_THEON       ----------------------------------------------------------------------
TDH_RHIEC       GEFVCIPESNVVPIPDDISDEIAAIFDPFGNAVHTALSFDL---VGEDVLVTGAGPIGIMGALVAKRSGA
TDH_RHIE6       GEFVCIPESNVVPIPDDISDEIAAIFDPFGNAVHTALSFDL---VGEDVLVTGAGPIGIMGALVAKRSGA
TDH_FRAP2       AEYLVMPAVNVFKIPDSISDDIASTFDPMGNAIHTALSFNL---TGEDVLITGAGPIGLMAVKIARFCGA
TDH_BURM1       AEYLAIPAFNAFKIPPEISDDLASIFDPFGNATHTALSFNL---VGEDVLITGAGPIGIMAVAIAKHVGA
TDH_BURCM       AEYLAIPAFNAFKIPPEISDDLASIFDPFGNATHTALSFNL---VGEDVLITGAGPIGVMAAAIAKHVGA
DHSO_MOUSE      ----------------------------------------------------------------------
DHSO_BOMMO      ----------------------------------------------------------------------
DHSO2_YEAST     -----------------------------------------GVRFGTKVVVFGAGPVGLLTGAVARAFGA
DHSO1_YEAST     -----------------------------------------GVRFGTKVVVFGAGPVGLLTGAVARAFGA
ADHA_BACSU      ----VVTDRFVVRIPDRLEMDVASPLLCAGIT-TYSPLKHWNVGPGKKVAIVGVGGLGHLAIQFAHAMGA
TDH_SERP5       AEYLVIPAFNAFKIPDNISDELASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVCKHVGA
TDH_RHISN       AEFVCLPEYNVVTIPDDVPDEIAAIFDPFGNAVHTALSFDL---VGEDVLVTGAGPIGIMGALVAKRSGA
TDH_KLEP7       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGVMAAAVAKHVGA
TDH_KLEP3       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGVMAAAVAKHVGA
ADH_SCHPO       QHYCIANATHATIIPESVPLEVAAPIMCAGITCYRALKES-KVGPGEWICIPGAGGGLGHLAVQYAKAMA
TDH_COLP3       AEYLVIPAYNAFKLPDEISDDLASIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVAKHVGA
TDH_VIBCM       SEYLVIPAFNAFKIPDGISDDLASIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVAKHVGA
TDH_VIBCH       SEYLVIPAFNAFKIPDGISDDLASIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVAKHVGA
TDH_VIBC3       SEYLVIPAFNAFKIPDGISDDLASIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVAKHVGA
TDH_ENT38       AEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGIMAAAVAKHVGA
TDH_AGRRK       GEFVCIPESNVVPIPDDIPDEVAAIFDPFGNAVHTALSFDL---VGEDVLVTGAGPIGIMGAMVAKRSGA
TDH_STRMK       AEYMVMPASNLWPIPDQIPSELAAFFDPYGNAAHCALEFNV---IGEDVLITXXXXXXXXXXXXCKHIGA
TDH_SALG2       AEYLVIPALNAFKIPDNISDDLASIFDPFGNAVHTALSFDL---VGEDVLVSGAGPIGVMAAAVAKHVGA
TDH_RHIME       AEFVCLPEYNVVSIPDDVPDEIAAIFDPFGNAVHTALSFDL---VGEDVLVTGAGPIGIMGAMVAKRCGA
TDH_DEIDV       AEYLVLPAFNAFKLPDDIPDDVAAIFDPFGNAVHTALSFDL---VGEDVLVTGAGPIGVMAAAVARHVGA
IDND_VITVI      ----------------------------------------------------------------------
DHSO_RAT        ----------------------------------------------------------------------
TDH_RHILW       GEFVCIPESNVVAIPEDISDEIAAIFDPFGNAVHTALSFDL---VGEDVLVTGAGPIGIMGALVAKRSGA
ADH_SULSR       ----------------------------------------------------------------------
YCJQ_SHIFL      ----------------------------------------------------------------------
YCJQ_ECOLI      ----------------------------------------------------------------------
TDH_PHOPR       AEFLVIPAFNAFKIPAGISDDLASIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGIMAAAVAKHVGA
TDH_RHILO       GEYLAIPQHNVVPIPDDVPDEIAAIFDPLGNAVHTALSFDL---VGEDVLVTGAGPIGIMGALVAQCVGA
TDH_ERWCT       AEYLVIPAYNAFRIPDNISDELAAIFDPFGNAVHTALSFDL---VGEDVLITGAGPIGMMAAAVCRHVGA
MTDH3_STYHU     ----------------------------------------------------------------------
ADH_SULTO       ----------------------------------------------------------------------
TDH_SINMW       AEFVCLPEYNVVSIPDDVPDEIAAIFDPFGNAVHTALSFDL---VGEDVLVTGAGPIGIMGALVAKRCGA
ADHN_AMYME      ----------------------------------------------------------------------
CAD8C_ORYSJ     ----------------------------------------------------------------------
YGD6_SCHPO      ----------------------------------------------------------------------
TDH_PECCP       ----------------------------------------------------------------------
TDH_MARMS       ----------------------------------------------------------------------
TDH_SILPO       AQYLRLPAFNVVPLPEDIPDE------------IGAILDPLGNAVGEDVLITGAGPIGIMXXXXXXXXXX
TDH_PSYIN       ----------------------------------------------------------------------
QORL2_NEMVE     ----------------------------------------------------------------------
TDH_COXBU       AEYLVIPAKNAYKIPAKISDDIAAILDPFGNAAHSALEFDL---VGEDVLITGAGPVGLMSAAIARHVGA
TDH_COXBR       AEYLVIPAKNAYKIPAKISDDIAAILDPFGNAAHSALEFDL---VGEDVLITGAGPVGLMSAAIARHVGA
TDH_COXBN       AEYLVIPAKNAYKIPAKISDDIAAILDPFGNAAHSALEFDL---VGEDVLITGAGPVGLMSAAIARHVGA
TDH_COXB2       AEYLVIPAKNAYKIPAKISDDIAAILDPFGNAAHSALEFDL---VGEDVLITGAGPVGLMSAAIARHVGA
ADHC_MYCTU      ----------------------------------------------------------------------
ADHC_MYCBO      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXVDIHNSRLEMAKELGATHTINSKDEDPAEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTV
XYLB_PSEPU      TTIIAVDVKENRLELASELGATHIINPAANDPIEAIKEIFADGVPYVLETSGLPAVLTQAILSSAIGGEI
FADH_AMYME      NKIIAVDRDAKKLEWATELGATHTVNATETDVVEAVQALTGGGADVVIDAVGRPETWKQAFYARDLAGTV
ADH4_STRCA      SKIFGIDINKDKFPLAKKLGATDCLNPQDKPVQEIIAEMTNGGVDFAIECIGNPDVMKAAFESTTVGGTC
ADH1B_UROHA     SRIIGIDINKEKFPKAKELGATECVNPLDKKPINEVDMTDGEGVEYSFEVIGRTDTMTAALASCHNNGTS
ADH1B_PANTR     ARIIAVDINKDKFAKAKELGATECINPQDKPIQEVLKEMTDGGVDFSFEVIG--RLDTMMASLLCCHGTS
ADH1B_HUMAN     ARIIAVDINKDKFAKAKELGATECINPQDKPIQEVLKEMTDGGVDFSFEVIG--RLDTMMASLLCCHGTS
ADH1_ALLMI      SRIIGIDINKDKFAKAKELGATECINPLDKPIQEVLSEMTGGGVDYSFEVIGRIDTMTAALACCQDNGTS
ADH1A_HUMAN     ARIIAVDINKDKFAKAKELGATECINPQDKPIQEVLKEMTDGGVDFSFEVIG--RLDTMMASLLCCHGTS
ADH1B_PAPHA     ARIIAVDINKDKFAKAKELGATECINPQDKPIQEVLKEMTDGGVDFSFEVIG--RLDTMMASLLCCHGTS
ADHL_GADMO      SRIIAIDVNPDKFRIAKEFGATDLVNPKDHSPVEQVVEMTDGGVDYSFECVGNIAVMRAALEACHKGGTS
ADH1G_PAPHA     ARIIAVDINKDKFAKAKELGATECINPQDKPIQEVLKEMTDGGVDFSFEVIGLDTIMASLLCCHEACGTS
ADH1A_UROHA     SRIIGVDINKDKFPKAKEMGATECVNPLDKPINEVLFDLTGEGVDYSFEVIGRTDTMTAALASCHMDGTS
ADH4_HUMAN      SRIIGIDINSEKFVKAKALGATDCLNPRDKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGGSC
ADH1A_PONAB     ARIIAVDINKDKFAKAKELGATECINPQDYNKQEVLKEMTDGGVDFSFEVIG--RLDTMMASLLCCHGTS
ADHX_SPAAU      TRIIGIDLNPAKFETAKEFGATEFVNPKDHSKQEVLVEMTDGGVDYSFECIGNVQIMRAALEACHKGGES
ADH1_STRCA      SRIIGVDINKDKFAKAKELGATDCVNPKDKPIHEVLMEMTGLGVDYSFEVIGHTETMAAALASCHFNYGV
FRMA_HAEIN      GRIIAIDTNPAKFELAKQFGATDCLNPNDYDKPIKLLDINKWGIDHTFECIGNVNVMRQALESAHRGGQS
ADHP_RABIT      SRIIAIDINSDKFAKAKALGATDCLNPREKPVQDVIVEMTNGGVDFAIDCAGGSEVMKATVDCATVGGSC
ADH1_MOUSE      ARIIAVDINKDKFAKAKELGATECINPQDKPIQEVLQEMTDGGVDFSFEVIGLDTMTSALLSCHAACGVS
ADH1_PERMA      ARIIAVDINKDKFAKAKELGATECINPLDYSKPEVLQEMTDGGVDFSFEVIGRLTMTSSLLSCHASCGVS
ADH4_MOUSE      SRIIAIDINGEKFPKAKALGATDCLNPRDKPVQDVITELTAGGVDYSLDCAGTAQTLKAAVDCTVLGGSC
ADH1G_HUMAN     ARIIAVDINKDKFAKAKELGATECINPQDKPIQEVLKEMTDGGVDFSFEVIG--RLDTMMASLLCCHGTS
FRMA_SYNY3      GRIIAIDTNPAKFELAKQMGATDCINPKDHDQQQVIVEMTGWGVDHSFECIGNVEVMRSALECAHRGGQS
FADH_PARDE      DMIIGVDLNDDKKPMAEHFGMTHFINPKNENVVQEIVNLTKGGADYSFDCTGNVKVMRDALECTHRGGQS
ADH1A_MACMU     ARIIAVDINKDKFAKAKELGATECINPQDKPIQEVLKEMTDGGVDFSFEVIG--RLDTMMASLLCCHGTS
ADH1_APTAU      SRIIAIDINKDKFAKAKELGATDCVNPKDKPIHEVLMEMTGLGVDYSFEVIGHTETMAAALASCHFNYGV
ADH1E_HORSE     ARIIGVDINKDKFAKAKEVGATECVNPQDKPIQEVLTEMSNGGVDFSFEVIGRLMVTALSCCQEAYGVSV
ADH4_RAT        SRIIAIDINSEKFPKAKALGATDCLNPRDLDKQDVITELTGGGVDFSLDCAGTAQTLKAAVDCTVVGGSC
FRMA_ECOL6      GRIIAIDTNPKKFELARRFGATDCINPNDYDKPIKLLDINKWGIDHTFECIGNVNVMRAALESAHRGGQS
TERPD_PSESP     SRIIVSEPSAAKREQALALGATEVIDPLNENLVERVQQITGQGCDYALECTGLVSVMEQAIDSMAMRGQL
FRMA_ECOUT      GRIIAIDTNPKKFELARRFGATDCINPNDYDKPIKLLDINKWGIDHTFECIGNVNVMRAALESAHRGGQS
FRMA_ECOL5      GRIIAIDTNPKKFELARRFGATDCINPNDYDKPIKLLDINKWGIDHTFECIGNVNVMRAALESAHRGGQS
FRMA_ECOK1      GRIIAIDTNPKKFELARRFGATDCINPNDYDKPIKLLDINKWGIDHTFECIGNVNVMRAALESAHRGGQS
ADHQ_RABIT      SRIIAVDINSDKFAKAKALGATDCLNPREKPVQDVIVEMTNGGVDFAIDCAGGSEVMKATVDCTTVGGSC
ADH7_MOUSE      SRIIGIDINKDKFQKALAVGATECISPKDSTKSEVLSDMTGNTVQYTFEVIGRLETMVDALSSCHMNGTS
ADH1_CHICK      SRIIAVDINKDKFAKAKELGATECINPKDKPIHEVLTEMTGQGVDYSFEVIGRIETMTAALASCHNNGVS
ADH7_RAT        SRIIGIDINKDKFQKALDVGATECINPRDKPISEVLSDMTGNTVQYTFEVIGRLETMVDALSSCHMNGTS
FRMA_SHISS      GRIIAIDTNPKKFDLARRFGATDCINPNDYDKPIKLLDINKWGIDHTFECIGNVNVMRAALESAHRGGQS
FRMA_ECOLI      GRIIAIDTNPKKFDLARRFGATDCINPNDYDKPIKLLDINKWGIDHTFECIGNVNVMRAALESAHRGGQS
FRMA_ECOLC      GRIIAIDTNPKKFDLARRFGATDCINPNDYDKPIKLLDINKWGIDHTFECIGNVNVMRAALESAHRGGQS
FRMA_ECOHS      GRIIAIDTNPKKFDLARRFGATDCINPNDYDKPIKLLDINKWGIDHTFECIGNVNVMRAALESAHRGGQS
FRMA_ECO57      GRIIAIDTNPKKFDLARRFGATDCINPNDYDKPIKLLDINKWGIDHTFECIGNVNVMRAALESAHRGGQS
FRMA_ECO24      GRIIAIDTNPKKFDLARRFGATDCINPNDYDKPIKLLDINKWGIDHTFECIGNVNVMRAALESAHRGGQS
ADH1_COTJA      SRIIAIDINKDKFAKAKELGATECVNPKDKPIHEVLTEMTGKGVDYSFEVIGRIETMTEALASCHYNGVS
ADHI_RHOS4      DMIIGVDLNNAKKEWGERFGMTHFVNPSDGDVVAHLVNMTKGGADYTFDCTGNVKVMRQALEACHRGWGQ
ADH1S_HORSE     ARIIGVDINKDKFAKAKEVGATECVNPQDKPIQEVLTEMSNGGVDFSFEVIGMVAALSCCQEAYGVSVIV
ADH1_NAJNA      SRIIGVDINKDKFAKAKEMGATECINPLDKPINEVLFDLTGEGVDYSFEVIGRTETMISAFTSCHQNGTS
FRMA_ECOSM      GRIIAIDTNPKKFDLARRFGATDCINPNDYDKPIKLLDINKWGIDHTFECIGNVNVMRAALESAHRGGQS
ADH1_RABIT      SRIIAVDINKDKFPKAKEVGATECINPQDKPIQEVIQEISDGGVDFSFEVIG--RLDTVVAALLSCHGAC
ADH1_RANPE      SRIIGVDLNSDKFTTAKECGATECINPKDYNIPEVLAKMTDDGVDYAFEVIGNTTVMTSALSSSHFGGKT
FRMA_PASPI      GRIFAIDTNPSKFELAKQFGATDCINPNDYDPVQQVVEMTKWGVDHTFECIGNVNVMRSALESAHRGGQS
ADH1_GEOAT      ARIIAVDINKDKFAKAKELGATECVNPQDYDKPEVLQEMTDGGVDFSFEVIGRLDTKVSALMCCQESHGV
ADHX_CAEEL      XXXXXXDLIESKFESAKFFGATECINPKSVELPELVEQFDG-GFDYTFECIGNVHTMRQALEAAGVSCII
ADH7_HUMAN      SRIIGIDLNKDKFEKAMAVGATECISPKDSTKSEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNGTS
ADH1_GEOBU      ARIIAVDINKDKFAKAKELGATECVNPQDYDKPQVLQEMTDGGVDFSFEVIGMVSALMCCQES---HGVS
ADHX_OCTVU      XXXXXXXXNESKFEIGKKFGITEFVNPKKKSVQKVLGEMTDVGVDFTFECIGNVGVMRAALESCHKGGTS
ADHX_MYXGL      SRIIAIDRNPDKFEKARIFGATDCVDASDKPISQVLGEMTDGGLDYTFECVGNVGIMRAALESCHKGWGV
ADHX_UROHA      SRIIGIDLNKDKFAKAKEFGATECISPADKKPIQEVLEMTDGGVDYSFECIGNVGVMRAALEACHKXXXX
ADH1_GEOKN      ARIIAVDINKDKFAKAKELGATECVNPQDYDKPQVLQEMTDGGVDFSFEVIGMVSALMCCQES---HGVS
ADH1_GADCA      KRIIAVDLNPDKFEKAKVFGATDFVNPNDEPISQVLSKMTNGGVDFSLECVGNVGVMRNALESLKGWGVS
ADHX_DROME      GKIYGIDINPDKFELAKKFGFTDFVNPKDVADKGSIQDLTDGGFDYTFECIGNVNTMRSALEATHKGGTS
ADHL3_ARATH     SRIIGVDANASKFEKGKLMGVTDFINPKDKPVHQMIREITGGGVDYSFECTGNVDVLREAFLSTHVGGST
ADHH_GADMO      TRIIGVDINPEKFGKAAEFGATECLNPKDRPVQEVLVEMTDGGVDYSFECIGNVEIMRSALEACGESVII
ADHX_HORSE      SRIIGVDINKDKFAKAKEFGASECINPQDKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWXX
FADH_CANMA      AQIILVDISDKKEEWGQKLGATAFVNPEGTTIVDKLIEMTDGGCDFTFDCTGNVGVMRNALEACHKGGTS
FADH_YEAST      SXXXXXXXXXXXXQYCSQFGATDFVNAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQ
ADH1_RAT        AKIIAVDINKDKFAKAKELGATDCINPQDKPIQEVLQEMTDGGVDFSFEVIGRLDTMTSALLSCSACGVS
ADHX_RABIT      SRIIAVDINKDKFARAKEFGATECINPQDKPIQEVLVEKTDGGVDYSFECIGNVKVMRAALEACHKXXXX
ADHX_DICDI      KRIIGIDNNETKFGPGKDFGCTEFINSKDLPEGKTIQQITDGGVDYSFECIGNVNVMRAALECCHKGGVS
ADHX_RAT        SRIIGIDINKDKFAKAKEFGATECINPQDKSIQEVLIEMTDGGVDFSFECIGNVKVMRSALEAAHKGWXX
ADH6_PONAB      TRIIGVDVNKEKFKKARELGATECLNPQDKKPIQEVLDMTDAGIDFCFEAIGNLDVLAAALASCNESYGV
ADH1_PEA        SRIIGVDLVSSRFELAKKFGVNEFVNPKEHDPVQQIAEMTNGGVDRAVECTGSIQAMISAFECVHDGGVA
FADH_PICPA      SEIIVIDINDSKKAWADQFGATKFVNPEGTNIVDYLIDITDGGFDYTFDCTGNVQVMRNALESCHKGGES
ADH8_RANPE      SRIIGVGTHKDKFPKAIELGATECLNPKDYDKPEVICEKTNGGVDYAVECAGRIETMMNALQSTYCGSGV
ADHX_PEA        SRIIGIDIDSNKYDTAKNFGVTEFINPKDEKPIQQIIDLTDGGVDYSFECLGNVSVMRSALECCHKGGTS
ADHX_ORYSJ      SRIIGIDIDSKKFDVAKNFGVTEFVNPKDHDKQQVIVDLTDGGVDYSFECIGNVSVMRSALECCHKGGTS
ADHX_ORYSI      SRIIGIDIDSKKFDVAKNFGVTEFVNPKDHDKQQVIVDLTDGGVDYSFECIGNVSVMRSALECCHKGGTS
ADHX_MOUSE      SRIIGIDINKDKFAKAKEFGASECISPQDKSIQEVLVEMTDGGVDYSFECIGNVKVMRSALEAAHKGWXX
ADHX_BOVIN      ARIIGVDINKDKFARAKEFGASECINPQDKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWXX
ADH1_TRIRP      SRIIGVDLVSSRFELAKKFGVNEFVNPKDHDPVQQIAEMTDGGVDRAVECTGSIQAMISAFECVHDGGVA
ADH6_HUMAN      ARIIGVDVNKEKFKKAQELGATECLNPQDKKPIQEVLDMTDAGIDFCFEAIGNLDVLAAALASCNESYGV
FADH1_SCHPO     SRIIAIDINADKEVYAKKFGATDFISSKVKDLVQYVIDVTDGGVDYAFDCTGNVTVMQQELQFCHKGGKL
ADHX_MAIZE      SRVIGIDIDNKKFDVAKNFGVTEFVNPKEHDPIQQVVDLTDGGVDYSFECIGNVSIMRAALECSDKGGTS
ADHL6_ARATH     AQILGVDINPAKAEQAKTFGVTDFINSNDEPIPQVIKRMTGGGADFSFECVGDTGIATTALQSCSDGGMT
ADH1_ARATH      SRIIGVDFNSKRFDQAKEFGVTECVNPKDHDKQQVIAEMTDGGVDRSVECTGSVQAMIQAFECVHDGGVA
ADHL7_ARATH     SRIIGVDINPTKFQVGQKFGVTEFVNSEKNRVSEVINEMTDGGADYCFECVGSSSLVQEAYACCRQGGKT
ADHX_HUMAN      SRIIGVDINKDKFARAKEFGATECINPQDKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWXX
ADHX_ARATH      SRIIGIDIDSKKYETAKKFGVNEFVNPKDHDKQEVIVDLTDGGVDYSFECIGNVSVMRAALECCHKGGTS
FADH2_SCHPO     GRIFGIDVNPEKKNWAMSFGATDFINPNDQSPIQDVLHETDGGLDWTFDCTGNVHVMRSALEACHKGGQS
ADH6_PERMA      ARIIAVDTNKDKFAKAKTVGATECIDPQDEKPIQQVLDMMNDGADFTFEVTGNPETVETAASCHKDHGVC
ADH3_HORVU      SRIIGVDLNPAKYEQAKKFGCTDFVNPKDKPVQEVLVEMTNGGVDRAVECTGMIATFECVHDGWGVAVLV
ADHB_MYCTU      RYVFAVEPVEWKRDQALKFGATHVINAALMGIAEVTYGLMAQKVIITVDVDSYLTIT-------AKGGTC
ADHB_MYCBO      RYVFAVEPVEWKRDQALKFGATHVINAALMGIAEVTYGLMAQKVIITVDVDSYLTIT-------AKGGTC
ADH1_PETHY      XXXXXXDLNPSRFNDAKKFGVTEFVNPKDDKPVQQIAEMTDGGVDRSVECTGNVNAMISAFECVHDGGVA
ADH1_PENAM      XXXXXXDLNPSRFEEAKKFGCTEFVNPKDHNKQEVLADMTNGGVDRSVECTGNINAMIQAFECVHDGGVA
ADHL2_ARATH     AKIIGVDLNPAKFEIGKRFGITDFVNPAEKTISEVIREMTDVGADYSFECIGLASLMEEAFKSTRPGSGK
ADH1_MAIZE      XXXXXXDLNPSRFEEARKFGCTEFVNPKDHNKQEVLAEMTNGGVDRSVECTGNINAMIQAFECVHDGGVA
ADH2_HORVU      SRIIGVDLNPAKHEQAKKFGCTDFVNPKDKPVQEVIVEMTDGGVNRAVECTGNADAMISAFECVHDGWGV
ADH6_RAT        ARIIAVDINKDRFAKAKTVGATDCVDPRDEKPIEEVSDMIDGGVDFCFEVTGNTEAVGAALGSCKDHGVC
ADH2_MAIZE      SRIIGVDINPAKYEQAKKFGCTEFVNPKDHDKQEVLIELTNGGVDRSVECTGNVNAMISAFECVHDGGVA
ADH1_ORYSJ      XXXXXXDLNANRFEEARKFGCTEFVNPKDHDPVQQVAEMTNGGVDRSVECTGNINAMIQAFECVHDGGVA
ADH1_ORYSI      XXXXXXDLNANRFEEARKFGCTEFVNPKDHDPVQQVAEMTNGGVDRSVECTGNINAMIQAFECVHDGGVA
ADHL4_ARATH     SKIIGIDINPDKFQLGREAGISEFINPKESDKAERVMEITEGGVEYSFECAGSIEALREA--FLSTNSGV
ADH1_SOLTU      XXXXXXDLNASRFEQAKKFGVTEFVNPKDKPVQEVIAEMTDGGVDRSVECTGHIDAMISAFECVHDGGVA
ADH1_HORVU      XXXXXXDLNAVRFEEARKFGCTEFVNPKDHKPVQQVADMTNGGVDRSVECTGNVNAMIQAFECVHDGGVA
ADH3_SOLTU      XXXXXXDLNASRFEQAKKFGVTEFVNPKDKPVQEVIAEMTDGGVDRSVECTGHIDAMISAFECVHDGGVA
ADH2_SOLTU      XXXXXXDLNASRFEQAKKFGVTEFVNPKDKPVQEVIAEMTDGGVDRSVECTGHIDAMISAFECVHDGGVA
ADHL1_ARATH     AKIIGIDTNSDKFELGKKFGFTDFINPTEKKISEVIKEMTEGGVDYSFECVGLASLLNEAFISTR-TGTL
ADH2_SOLLC      XXXXXXDLNASRFEQAKKFGVTEFVNPKDKPVQEVIAEMTDGGVDRSVECTGHIDAMISAFECVHDGGVA
ADHL5_ARATH     GKIIGVDLNPEKFELGKKFGFTDFINSTENKISEVIKEMTGGGVDYSFECVGLPSLLTEAFSSTRTGSVL
ADH_MALDO       SRIIGVDLHSDRFEEAKKFGVTEFVNPKEKPVQEVIAELTNRGVDRSIECTGSTEAMISAFECVHDGGVA
ADH_FRAAN       SRIIGVDLNSNRFEEAKKFGITEFVNPKDKPVQEVIAELTNGGVDRSIECTGNIQAMIPAFECVHDGGVA
ADH2_ORYSJ      SRIIGVDLNPAKFEQAKKFGCTDFVNPKDHSKPEVLIEMTNGGLDRAVECTGNINAMISCFECVHDGGVA
ADH2_ORYSI      SRIIGVDLNPAKFEQAKKFGCTDFVNPKDHSKPEVLIEMTNGGLDRAVECTGNINAMISCFECVHDGGVA
ADH1_BACST      LNVVAVDLGDEKLELAKQLGADLVVNPKHDDAAQWIKEKXXXXXXXXXXXXSKAAF-ESAYKSIRRGGAC
ADH3_BACST      LNVVAVDIGDEKLELAKELGADLVVNPLKEDAAKFMKEKXXXXXXXXXXXXSKPAF-QSAYNSIRRGGAC
ADH2_BACST      LNVVAVDISDEKSKLAKDLGADIAINGLKEDPVKAIHDQVG-GVHAAISVAVNKKAFEQAYQSVKRGGTL
ADH1_ZEALU      XXXXXXDLNPSRFEEARKFGCTEFVNPKDHNKQEVLAEMTNGGVDRSVECTGNINAMIQAFECVHDGGVA
ADH1_ANAPL      SRIIAVDINSDKFAKAKELGATDCINPKDKEPIHKVLGMTGYGVDYSFEVIGRIETMVAALASCHYNGVS
DHSO_BACSU      GTIIVTDLEPLRLEAAKKMGATHIINIREQDALEEIKTITNDGVDVAWETAGNPAALQSALASVRRGGKL
BDHA_BACSU      TDIYAVELSPERQQKAEELGAIIVDPSKTDDVVAEIAERTGGGVDVAFEVTGVPVVLRQAIQSTTIAGET
YJMD_BACSU      AVMM-TDLNNERLAFAKENGADAVVNVQAEHVAERVLEWTGEGANVVIDAVCLPETFALSIEAVSPAGHV
ADH_STAAW       AKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEVMKLTDNK---GLDATVVTSVAK------------
ADH_STAAS       AKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEVMKLTDNK---GLDATVVTSVAK------------
ADH_STAAR       AKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEVMKLTDNK---GLDATVVTSVAK------------
ADH_STAAN       AKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEVMKLTDNK---GLDATVVTSVAK------------
ADH_STAAM       AKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEVMKLTDNK---GLDATVVTSVAK------------
ADH_STAAC       AKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEVMKLTDNK---GLDATVVTSVAK------------
ADH_STAAB       AKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEVMKLTDNK---GLDATVVTSVAK------------
ADH_STAA8       AKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEVMKLTDNK---GLDATVVTSVAK------------
ADH_STAA3       AKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEVMKLTDNK---GLDATVVTSVAK------------
XYLD_MORMO      ------DVFDEKLKVAEKYQGLHAVNSKDQQAADKVRELTGEGVNVLFECSGAKPVIASISDHIAPGGTA
TDH_SHEON       RHVVITDVNEYRLELARKMGATRAVNVAQENLKDVMKELMTEGFDVGLEMSGVPSAFRAMLDTMNHGGKI
YDJJ_ECOLI      TEIAVVDVLEKRLAMAEQLGATVVINGAKEDTIARCQQFTEDGADIVFETAGSAVTVKQAPYLVMRGGKI
TDH_SHEPC       RHVVITDVNEYRLELARKMGATRAVNVSKENLKDVMKELMTEGFDVGLEMSGVPSAFHAMLDTMNHGGKV
TDH_BACA2       XXXXXIDKNDYRLALAKKLGATITISADKEDPLEVIDTLTGEGIDLVCEMSGHPAAIAQGLKMAANGGRF
ADH_STAES       AKVVAFDINDDKLNFAKELGADAIINSTNVDPIEEVNRLTNNK---GLDATVITAVAK------------
TDH_SHEWM       RHVVITDVNEYRLELAQKMGATRAVNVAKEDLKDVMSELMTEGFDVGLEMSGVPSAFHSMLDTMNHGGKV
TDH_SHESR       RHVVITDVNEYRLELARKMGATRAVNVAQENLKDVMKELMTEGFDVGLEMSGVPSAFHAMLDTMNHGGKI
TDH_SHESM       RHVVITDVNEYRLELARKMGATRAVNVAQESLKDVMKELMTEGFDVGLEMSGVPSAFHAMLDTMNHGGKI
TDH_SHESA       RHVVITDVNEYRLELARKMGATRAVNVAQESLKDVMKELMTEGFDVGLEMSGVPSAFHAMLDTMNHGGKI
TDH_SHEB9       RHVVITDVNEYRLELARKMGATRAVNVSKESLKDVMKELMTEGFDVGLEMSGVPSAFHAMLDTMNHGGKV
TDH_SHEB8       RHVVITDVNEYRLELARKMGATRAVNVSKENLKDVMKELMTEGFDVGLEMSGVPSAFHAMLDTMNHGGKV
TDH_SHEB5       RHVVITDVNEYRLELARKMGATRAVNVSKESLKDVMKELMTEGFDVGLEMSGVPSAFHAMLDTMNHGGKV
TDH_SHEB2       RHVVITDVNEYRLELARKMGATRAVNVSKESLKDVMKELMTEGFDVGLEMSGVPSAFHAMLDTMNHGGKV
TDH_SHESW       RHVVITDVNEYRLELARKMGATRAVNVSKESLKDVMKELMTEGFDVGLEMSGVPSAFHAMLDTMNHGGKI
ADH_STAEQ       AKVVAFDINDDKLNFAKELGADAIINSTNVDPIEEVNRLTNNK---GLDATVITAVAK------------
YPHC_ECOLI      -----VDMLPERLAMAKQLGVMHGYLATTEGLPQIIAELTHGGADVALDCSGNAAGRLLALQSTADWGRV
TDH_SHESH       RHVVITDVNEYRLELANKMGATRAVNVAKESLEGVMEELMTEGFDVGLEMSGVPSAFHSMLDTMNHGGKI
TDH_SHEPA       RHVVITDVNEYRLELAEKMGATRAVNVAKENLEDVMQELMTEGFDVGLEMSGVPSAFHSMLDTMNHGGKI
TDH_SHEHH       RHVVITDVNEYRLELAQKMGATRAVNVAKEKLEDVMQELMTEGFDVGLEMSGVPSAFHSMLDTMNHGGKI
TDH_SHEAM       RHVVITDVNEYRLELARKMGATRAVNVAKENLKDVMKDLMTEGFDVGLEMSGVPAAFHAMLDTMNHGGKI
TDH_SHELP       RHVVITDVNEYRLELAKKMGATRAVNVAKEKLEDVMQDLMTEGFDVGLEMSGVPAAFHSMLDTMNHGGKI
TDH_MESSB       RKVVITDINPGRLALAKKLGVRHVVNAREEKLTDVMRKLMTEGFDVGLEMSGSASAFRDMIDVMNNGGKI
DHSO_BACHD      TVIITLSNDQVRLKKAKEVGIDYAIDTQEVDIKELVSELTGYGADVVLECSGAVPAAKQGIDLLRKKGQY
TDH_BACLD       XXXXXIDKNEYRLDLALQMGATDIISVEKEDPLKNVSALTGEGADLVCEMSGHPTAIRQSLKMAANGGRV
ADH_RALEU       TTIIAIDGNDHRLEIARKMGADVVLNFRNCDVVDEVMKLTGGGVDASIEALGTQATFEQSLRVLKPGGTL
TDH_CHRVO       RHVVITDVNDYRLELAKKMGATRAVNVAREDLKAVMQELMSEGFDVGLEMSGNPQAFRQMLETMNHGGKV
ADHB_BACSU      KRVIAVDYVNYRLQHAKRTNKVEIVNFEDENTGNYLKEITKGGADVVIDAVGM-----------------
ADH3_KLULA      YRVVGIDGGEEKGKLVKQLGGEAFVDTKTKDMVAEIQEITNGGPHGVINVSVSEAAMNASTQFVRPTGTV
TDH_PYRAB       YPVIVSEPSDFRRELAKKVGADYVINPFEEDVVKEVMDITGNGVDVFLEFSGAPKALEQGLQAVTPAGRV
YAHK_ECOLI      ----------------------------------------------------------------------
XYL2_PICST      -----VDIFDNKLKMAKDIGATHTFNSKTGGSEELIKAFGGNVPNVVLECTGAEPCIKLGVDAIAPGGRF
TDH_SHEFN       RHVVITDVNEYRLDLARKMGATRAVNVATENLKDVMKELMTEGFDVGLEMSGVPSAFHAMLDTMNHGGKI
TDH_PSEHT       RHVVISDVNEYRLELARKMGATRAVNVANEKLEDVIKELMTEGFDIGLEMSGVPSAFNSMLNNMNHGGKV
TDH_PSEA6       RHVVITDVNEYRLDLARKMGASRAVNVAKESLKDVMNDLMSEGFDVGLEMSGVPAAFRDMLDKMNHGGKV
ADH2_KLULA      YRVLGIDTGAEKAKLFKELGGEYFVDAVSKDLIKEIVDATNGGAHGVINVSVSEFAIEQSTNYVRSNGTV
TDH_PHOLL       RHVVITDVNEYRLELARKMGVTRAVNVSQENLTDVMAELMTEGFDVGLEMSGAPAAFRTLLNTMNHGGRV
TDH_PYRHO       YPVIVSEPSDFRRELAKKVGADYVINPFEEDVVKEVMDITGNGVDVFLEFSGAPKALEQGLQAVTPAGRV
TDH_BACSU       XXXXXIDKNEYRLRLAKQMGATCTVSIEKEDPLKIVSALTGEGADLVCEMSGHPSAIAQGLAMAANGGRF
TDH_ALTMD       RHVVVTDINPYRLELAKKMGATRTVDVSKENLQDVMDELMSEGFDVGLEMSGVPVAFRDMLNKMNHGGKI
ADH1_KLULA      YRVLGIDAGEEKAKLFKDLGGEYFIDTKSKNIPEEVIEATKGGAHGVINVSVSEFAIEQSTNYVRSNGTV
TDH_YERPY       RHVVITDVNEYRLDLARKMGVTRAVNVSKENLNDVMTELMTEGFDVGLEMSGAPPAFRSLLNSMNHGGRI
TDH_YERPS       RHVVITDVNEYRLDLARKMGVTRAVNVSKENLNDVMTELMTEGFDVGLEMSGAPPAFRSLLNSMNHGGRI
TDH_YERPP       RHVVIADVNEYRLDLARKMGVTRAVNVSKENLNDVMTELMTEGFDVGLEMSGAPPAFRSLLNSMNHGGRI
TDH_YERPN       RHVVIADVNEYRLDLARKMGVTRAVNVSKENLNDVMTELMTEGFDVGLEMSGAPPAFRSLLNSMNHGGRI
TDH_YERPG       RHVVIADVNEYRLDLARKMGVTRAVNVSKENLNDVMTELMTEGFDVGLEMSGAPPAFRSLLNSMNHGGRI
TDH_YERPE       RHVVIADVNEYRLDLARKMGVTRAVNVSKENLNDVMTELMTEGFDVGLEMSGAPPAFRSLLNSMNHGGRI
TDH_YERPB       RHVVITDVNEYRLDLARKMGVTRAVNVSKENLNDVMTELMTEGFDVGLEMSGAPPAFRSLLNSMNHGGRI
TDH_YERPA       RHVVIADVNEYRLDLARKMGVTRAVNVSKENLNDVMTELMTEGFDVGLEMSGAPPAFRSLLNSMNHGGRI
TDH_YERP3       RHVVITDVNEYRLDLARKMGVTRAVNVSKENLNDVMTELMTEGFDVGLEMSGAPPAFRSLLNSMNHGGRI
TDH_THETN       AAIFAIEPADYRRELAHKLGATRVINPLREDVVSIIKSETGYGADVVLDFSGNPTAIRQGLEYIAKGGRM
TDH_BURXL       RNVVITDVNDYRLELARKMGATRAVNVSRESLRDVMADLMAEGFDVGLEMSGVPSAFTGMLEAMNHGGKI
TDH_BURPP       RNVVITDVNDYRLELARKMGATRAVNVSRESLRDVMADLMTEGFDVGLEMSGVPSAFTSMLEAMNHGGKI
TDH_BURP8       RNVVITDVNDYRLELARKMGATRAVNVSRETLRDVMRDLMTEGFDVGLEMSGVPSAFTSMLEAMNHGGKI
ADHP_ECOLI      AKVIAIDVNDEQLKLATEMGADLAINSHTEDAAKIVQE--------------------------------
ADH1_CANAL      LRVVAIDGGDEKGEFVKSLGAEAYVDTKDKDIVEAVKKATDGGPHGAINVSVSEKAIDQSVEYVRPLGKV
TDH_THET8       --------------------ADRLVNPLEEDLLEVVRRVTGSGVEVLLEFSGNEAAIHQGLMALIPGGEA
TDH_SHISS       RNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELMAEGFDIGLEMSGAPPAFRTMLDTMNHGGRI
TDH_PYRFU       YPVIVSEPSEFRRNLAKKVGADYVINPFEEDVVKEVMDITGNGVDVFLEFSGAPKALEQGLQAVTPAGRV
TDH_FRATN       RRIVITDINEYRLQMARDFGATVALNFKNQD--ELVKQMMTEGFDIGLEMSGINSAISMMLDVMNHGGKL
TDH_CITK8       RHVVITDVNEYRLELARKMGIIHTVNVAKENLTDVMANLMTEGFDVGLEMSGAPPAFRAMLDTMNHGGRI
TDH_BURPS       RNVVITDINDYRLELARKMGATRAVNVSRESLRDVMADLMTEGFDVGLEMSGVPSAFTSLLESMNHGGKV
TDH_BURP6       RNVVITDINDYRLELARKMGATRAVNVSRESLRDVMADLMTEGFDVGLEMSGVPSAFTSLLESMNHGGKV
TDH_BURP1       RNVVITDINDYRLELARKMGATRAVNVSRESLRDVMADLMTEGFDVGLEMSGVPSAFTSLLESMNHGGKV
TDH_BURP0       RNVVITDINDYRLELARKMGATRAVNVSRESLRDVMADLMTEGFDVGLEMSGVPSAFTSLLESMNHGGKV
TDH_BURMS       RNVVITDINDYRLELARKMGATRAVNVSRESLRDVMADLMTEGFDVGLEMSGVPSAFTSLLESMNHGGKV
TDH_BURMA       RNVVITDINDYRLELARKMGATRAVNVSRESLRDVMADLMTEGFDVGLEMSGVPSAFTSLLESMNHGGKV
TDH_BURM9       RNVVITDINDYRLELARKMGATRAVNVSRESLRDVMADLMTEGFDVGLEMSGVPSAFTSLLESMNHGGKV
TDH_BURM7       RNVVITDINDYRLELARKMGATRAVNVSRESLRDVMADLMTEGFDVGLEMSGVPSAFTSLLESMNHGGKV
TDH_AERS4       RHVVITDVNEYRLELARKMGATRAVNVSKEKLADVMSALMTEGFDVGLEMSGVPSAFQDMIDKMNHGGKI
ADH1_ZYMMO      AKVIAIDVNDEQLAFAKELGADMVINPKNED-AAKIIQEKXXXXXXXXXXXXXKSAFNSAVEAIRAGGRV
TDH_SYMTH       -----MDINEYRLQLAGQLGADVLINPTKQDPVEVVRSYTGYGADVVLEMSGNPTAIRQGLKAARNGARI
TDH_SALAR       RHVVITDVNEYRLELARKMGVTRAVNVAKESLTDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_PROMH       RHVVITDVNEYRLDLAKKMGVTRAVNVSKENLTDVMKELMTEGFDVGLEMSGAPPAFRTMLSTMNHGGRI
TDH_FRATW       RRIVITDINEYRLQMARDFGATVALNFKNQD--ELVKQMMTEGFDVGLEMSGINSAISMMLDVMNHGGKL
TDH_FRATT       RRIVITDINEYRLQMARDFGATVALNFKNQD--ELVKQMMTEGFDVGLEMSGINSAISMMLDVMNHGGKL
TDH_FRATO       RRIVITDINEYRLQMARDFGATVALNFKNQD--ELVKQMMTEGFDVGLEMSGINSAISMMLDVMNHGGKL
TDH_FRATM       RRIVITDINEYRLQMARDFGATVALNFKNQD--ELVKQMMTEGFDVGLEMSGINSAISMMLDVMNHGGKL
TDH_FRATH       RRIVITDINEYRLQMARDFGATVALNFKNQD--ELVKQMMTEGFDVGLEMSGINSAISMMLDVMNHGGKL
TDH_FRATF       RRIVITDINEYRLQMARDFGATVALNFKNQD--ELVKQMMTEGFDVGLEMSGINSAISMMLDVMNHGGKL
TDH_FRAT1       RRIVITDINEYRLQMARDFGATVALNFKNQD--ELVKQMMTEGFDVGLEMSGINSAISMMLDVMNHGGKL
TDH_THET2       --------------------ADRLVNPLEEDLLEVVRRVTGSGVEVLLEFSGNEAAIHQGLMALIPGGEA
TDH_IDILO       XXXXITDVNEYRLDLARKMGVTRAVDVSKEKLSDVMTELMKEGFDVGLEMSGVPSAFSQMLETMNHGGKI
TDH_ECOLU       RNVVITDVNEYRLELARKMGVTRAVNVAKENLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_YERE8       RHVVITDVNEYRLDLARKMGVTRAVNVNKENLNDVMAELMTEGFDVGLEMSGAPPAFRALLNSMNHGGRI
TDH_VIBPA       RHVVITDVNEYRLELARKMGVTRAVNVAEEKLEDVMAELMTEGFDVGLEMSGNPAAFNSMLTTMNHGGRI
TDH_STRCO       XXXXITDVSEERLELARKVGATLALNVSDATIADGQRELLREGFDIGLEMSGRPEAMRDMIANMTHGGRI
TDH_SHIFL       RNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_SHIF8       RNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_SHIBS       RNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_SHIB3       RNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_SALTY       RHVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_SALTI       RHVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_SALSV       RHVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_SALPK       RHVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_SALPC       RHVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_SALPB       RHVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_SALPA       RHVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_SALNS       RHVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_SALHS       RHVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_SALEP       RHVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_SALDC       RHVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_SALCH       RHVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_SALA4       RHVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_RHIL3       RKVVITDINPHRLELARKLGIDHVVDASKENLADVMKAIMTEGFDVGLEMSGAAPAFRDMIDKMNNGGKI
TDH_PYRKO       YPVIVSEPSEFRRKLAKKVGADYVVNPFEEDPVKFVMDITGAGVEVFLEFSGAPKALEQGLKAVTPGGRV
TDH_ENTS8       RNVVITDVNEYRLSLARKMGVTRAVNVANESLQDVMNELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_EDWI9       RHVVITDVNDYRLDLARKMGVTRAVNVSRESLPEVMQALMSEGFDVGLEMSGAPPAFHTMLDTMNHGGKI
TDH_ECOUT       RNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMTELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_ECOSM       RNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMTELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_ECOSE       RNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_ECOLI       RNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_ECOLC       RNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_ECOL6       RNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMTELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_ECOL5       RNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_ECOK1       RNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMTELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_ECOHS       RNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_ECODH       RNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_ECOBW       RNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_ECO8A       RNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_ECO81       RNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMTELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_ECO7I       RNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMTELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_ECO5E       RNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_ECO57       RNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_ECO55       RNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_ECO45       RNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMTELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_ECO27       RNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMTELMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRI
TDH_BURVG       RNVVITDINDYRLELARKMGATRAVNVARESLRDVMAELMTEGFDVGLEMSGVPSAFTSLLEAMNHGGKV
ADHA_RHIME      HVAA-ADIFPDKLALAEKLGADLVVDARAPDAVEEVQRRTG-GLHGALVTAVSPKAMEQAYSMLRSKGTM
TDH_BURTA       RNVVITDINDYRLDLARRMGATRAVNVSRESLRDVMADLMTEGFDVGLEMSGVPSAFTSLLESMNHGGKV
TDH_AERHH       RHVVITDVNEYRLELARKMGATRAVNVTKEQLSGVMSELMTEGFDVGLEMSGVPSAFQDMIDKMNHGGKI
QOR_YEAST       AHTIAVASTDEKLKIAKEYGAEYLINASKEDILRQVLKFTGKGVDASFDSVGSLAALKRKGVFVSFGNAS
ADH_SULAC       -----VDVSEEGLKLATNLGADYVTSKVDEEEVRKI--TTGRGVDAIIDFVGSEFTTSNYYTLLAKLGRY
Y053_HAEIN      -----VDILEQRLEYAKSLGIEHIVNPHKEDDIKRIKEITGRMAEVVMEASGANISIKNTLHYASFAGRI
TDH_ECO24       RNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELMTEGFDVGLEMPGAPPAFRTMLDTMNHGGRI
TDH_BURS3       RNVVITDINDYRLELARKMGATRAVNVARESLRDVMSDLMTEGFDVGLEMSGVPSAFTSMLEAMNHGGKV
TDH_BURCJ       RNVVITDINDYRLELARKMGATRAVNVARESLRDVMADLMTEGFDVGLEMSGVPSAFTSLLEAMNHGGKV
TDH_BURCH       RNVVITDINDYRLELARKMGATRAVNVARESLRDVMADLMTEGFDVGLEMSGVPSAFTSLLEAMNHGGKV
TDH_BURCC       RNVVITDINDYRLELARKMGATRAVNVARESLRDVMADLMTEGFDVGLEMSGVPSAFTSLLEAMNHGGKV
TDH_BURCA       RNVVITDINDYRLELARKMGATRAVNVARESLRDVMADLMTEGFDVGLEMSGVPSAFTSLLEAMNHGGKV
TDH_BURA4       RNVVITDINDYRLELARKMGATRAVNVSRESLRDVMADLMTEGFDVGLEMSGVPSAFTSMLEAMNHGGKV
YDJL_ECOLI      -----------RFPVAKELGATAVVNGSTEDVVARCQQICGDNLGLVIECSGANIALKQAIEMLRPNGEV
TDH_THEON       -----------RRELAKKVGADYVVNPFEEDPVKFVMDITGAGVEVFLEFSGAPKAFEQGLQAVTPGGRV
TDH_RHIEC       RKVVITDINPHRLDLARKLGIDHVVDASKENLADVMKAIMTEGFDVGLEMSGAAPAFRDMIDKMNNGGKI
TDH_RHIE6       RKVVITDINPHRLDLARKLGIDHVVDASKENLADVMKAIMTEGFDVGLEMSGAAPAFRDMIDKMNNGGKI
TDH_FRAP2       RRIVITDINKYRLQMARDFGATVAVNVSE---FQNQQQLTAEGFDVGLEMSGINSAISMMLDVMNHGGKL
TDH_BURM1       RNVVITDINDYRLELARKMGATRAVNVARESLRDVMADLMTEGFDVGLEMSGVPSAFTSLLEAMNHGGKV
TDH_BURCM       RNVVITDINDYRLELARKMGATRAVNVSRESLRDVMADLMTEGFDVGLEMSGVPSAFTSMLEAMNHGGKI
DHSO_MOUSE      ------DLSASRLTKAKEVGADFTIQVGKETPASKVESLLGSKPEVTIECTGAESSVQTGIYATHSGGTL
DHSO_BOMMO      ------DVVQSRLDAALELGADNVLLVRDEEVVEKIVKLLGDRPDVSIDACGYGSAQRVA---LLVTKTA
DHSO2_YEAST     TDVIFVDVFDNKLQRAKDFGATNTFNSKAQDLADGVKLLGGNHADVVFECSGADVCIDAAVKTTKVGGTM
DHSO1_YEAST     TDVIFVDVFDNKLQRAKDFGATNTFNSKAQDLADGVKLLGGNHADVVFECSGADVCIDAAVKTTKVGGTM
ADHA_BACSU      EVTVLSRSMNKK-EEALELGANHYFAT--SDPA-TFTALAG-RFDVILNTVSANLDVDAYLSMLRIDGTL
TDH_SERP5       RHVVITDVNEYRLDLARKMGVTRAVNVSKENLNDVMAELMTEGFDVGLEMSGAPPAFRTLLNAMNHGGRI
TDH_RHISN       RKVVITDINPVRLDLARKLGIDHVVDASKENLADVMRSIMTEGFDVGLEMSGAAPAFRDMIDKMNNGGKI
TDH_KLEP7       RNVVITDVNEYRLELARKMGVTRAVNVAKENLNDVMAELMTEGFDVGLEMSGAPPAFRSMLDTMNHGGRI
TDH_KLEP3       RNVVITDVNEYRLELARKMGVTRAVNVAKENLNDVMAELMTEGFDVGLEMSGAPPAFRSMLDTMNHGGRI
ADH_SCHPO       MRVVAIDTGDDKAELVKSFGAEVFLDFKKEDMIEAVKAATNGGAHGTLVLSTSPKSYEQAAGFARPGSTM
TDH_COLP3       RHVVITDINEYRLDLARKMGATRAVDVSKESLKDVMTDLMTEGFDVGMEMSGVPMAFTSMLESMNNGGKI
TDH_VIBCM       RHVVITDVNEYRLDLARKMGVTRAVNVAEQNLEDVMKELMTEGFDVGLEMSGVPSAFSAMLKTMNHGGRI
TDH_VIBCH       RHVVITDVNEYRLDLARKMGVTRAVNVAEQNLEDVMKELMTEGFDVGLEMSGVPSAFSAMLKTMNHGGRI
TDH_VIBC3       RHVVITDVNEYRLDLARKMGVTRAVNVAEQNLEDVMKELMTEGFDVGLEMSGVPSAFSAMLKTMNHGGRI
TDH_ENT38       RNVVITDVNEYRLSLARKMGVTRAVDVSKENLNDVMAELMTEGFDVGLEMSGAPPAFRSMLDTMNHGGRI
TDH_AGRRK       RKVVITDINPNRLALAHKLGIDHVVDASKENLADVMKSIMTEGFDVGLEMSGAAPAFRDMIDKMNNGGKI
TDH_STRMK       RNVVVTDVNDFRLKLAADMGATRVVNVANQSLKDVMKELHMEGFDVGLEMSGNPRAFNDMLDCMYHGGKI
TDH_SALG2       RHVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMAELMTEGFDVGLEMSGAPPAFCTMLDTMNHGGRI
TDH_RHIME       RKVVITDINPVRLDLARKLGIDHVVDASKEKLADVMRVIMTEGFDVGLEMSGAAPAFRDMIDKMNNGGKI
TDH_DEIDV       RNVVITDINDYRLDLARKMGVTRAVNVTKEDLWSVARNELGEGFDVGLEMSGSGPAFAQMVDVMNNGGKI
IDND_VITVI      -----VDVDDQRLAIAKDLGADDIINIQDDEEVAKIQSTMVTGVDVSFDCVGFNKTMSTALNATRAGGKV
DHSO_RAT        -----IDLSASRLAKAKEVGADFTIQVAKETPAKKVESVLGSKPEVTIECTGAESSVQTGIYATHSGGTL
TDH_RHILW       RKVVITDINPHRLALARKLGIDHVVDASSENLADVMKSIMTEGFDVGLEMSGAAPAFRDMIDKMNNGGKI
ADH_SULSR       -----VDVREEAVETAKRAGADYVINASVQDPLAEIRRITGKGVDAVIDLNNSEKTLSVYPKALAKQGKY
YCJQ_SHIFL      -----VDPIAHRCDIARRHGADFCLNPIGTDVGKEIKTLTGQGADVIIETSGYADALQSALRGLAYGGTI
YCJQ_ECOLI      -----VDPIAHRCDIARRHGADFCLNPIGTDVGKEIKTLTGQGADVIIETSGYADALQSALRGLAYGGTI
TDH_PHOPR       RHVVITDVNEYRLDLARKMGVTRAVNVANEKLEDVMSELMTEGFDVGLEMSGVPSAFNGMLASMNHGGKV
TDH_RHILO       RKVVITDINPVRLALAKKLGVQHVVDASKEKLRDVMPVLMTEGFDVGLEMSGAAPAFRDMIDTMNNGGKI
TDH_ERWCT       RNVVITDVNAYRLELASKMGATRAVNVAEEKLTDVMIELMTEGFDIGLEMSGAPSAFRAMLKAMNHGGRI
MTDH3_STYHU     ----------------------------------------------------------------------
ADH_SULTO       -----VDVREEALEAAKRAGADYVINASSQDPVSEIRRITGKGADAVID---------------------
TDH_SINMW       RKVVITDINPVRLDLARKVGIDYVVDASKENLADVMRVIMTEGFDVGLEMSGAAPAFRDMIDKMNNGGKI
ADHN_AMYME      ----------------------------------------------------------------------
CAD8C_ORYSJ     ----------------------------------------------------------------------
YGD6_SCHPO      ---------DEKLEFAKKLGATHTINYKPQWASPALKMTNGVGYHHVIEVGGEKTLPQSIA-CLAKDGMI
TDH_PECCP       ------DVNAYRLDLARKMGATRAVNVAEERLADVMIELMTEGFDIGLEMSGAPSAFRAMLKAMNHGGRI
TDH_MARMS       ------DVNDFRLDLAKKMGATRTVNVSRESLKDVMTEIMHEGFDVGLEMSGNDMAFRSMLECMNHGGKI
TDH_SILPO       XXXXITDINADRLKLAQHVPRARTVDVTREDLGDVVHELLKQGFDVGLEMSGSQAALDQMVEALVMGGKI
TDH_PSYIN       ------DINEYRLDLARKMGVTRAVNVAQQKLEDVIAQLMTEGFDVGLEMSGAPVAFNSMLKNMSHGGKI
QORL2_NEMVE     -----------KLVIVQEIGATATIDYTRENIKDKVKELTGHGANVIMEAVG-GDVFKQCLKCIAWNGYI
TDH_COXBU       RHVVITDVNDYRLALAEKVGVTAAVNSTKTPLTETMKNLMTEGFDVGLEMSGNAEAFRSMLTVMNNGGKI
TDH_COXBR       RHVVITDVNDYRLALAEKVGVTAAVNSTKTPLTETMKNLMTEGFDVGLEMSGNAEAFRSMLTVMNNGGKI
TDH_COXBN       RHVVITDVNDYRLALAEKVGVTAAVNSTKTPLTETMKNLMTEGFDVGLEMSGNAEAFRSMLTVMNNGGKI
TDH_COXB2       RHVVITDVNDYRLALAEKVGVTAAVNSTKTPLTETMKNLMTEGFDVGLEMSGNAEAFRSMLTVMNNGGKI
ADHC_MYCTU      ----------------------------------------------------------------------
ADHC_MYCBO      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GLVGAPAPGAEATFEVGASLVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLVRTYPLEHINDAF
XYLB_PSEPU      GIVGAPPMGATVPVDIN-FLLFNRKLRGIVEGQSISDIFIPRLVELYRQGKFPFDKLIKFYPFDEINRAA
FADH_AMYME      VLVGVPTPDMRLEMPLLDFFSRGGALKSSWYGDCLPERDFPVLIDLHLQGRLPLDKFVERISLDDVEKAF
ADH4_STRCA      VIVGV-AVGEQSIPFSPMQLIMGRKIKATFFGGWKSVKSVPKLVSDYMAKKFDLDALVHTLPLDKINDAF
ADH1B_UROHA     VIVGVPPSASQIAFD-PLLLFTGRTWKGSVFGGWKSKDAVPRLVSDFMGKKFILDPLIHTMPFEKINEGF
ADH1B_PANTR     VIVGVP-PASQNLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALIHVLPFEKINEGF
ADH1B_HUMAN     VIVGVP-PASQNLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALIHVLPFEKINEGF
ADH1_ALLMI      VIVGVPPASEKITFN-PMMLFTGRTWKGSVFGGWKSKESVPKLVADYMEKKINLDGLIHTLPFDKINEGF
ADH1A_HUMAN     VIVGVP-PDSQNLSMNPMLLLTGRTWKGAILGGFKSKECVPKLVADFMAKKFSLDALIHVLPFEKINEGF
ADH1B_PAPHA     VIVGVP-PDSQNLSINPMLLLTGRTWKGAVYGGFKSREGIPKLVADFMAKKFSLDALIHVLPFEKINEGF
ADHL_GADMO      VIIGVAAAGQEISTR-PFQLVTGRTWKGTAFGGYKSVESVPKLVEEYMNKKVKVDEFVHTLPFEKIHEGF
ADH1G_PAPHA     VIVGVP-PDSQNLSINPVLLLTGRTWKGAIFGGFKSKESVPKLVSDFMAKKFSLDALINVLPFEKINEGF
ADH1A_UROHA     IIVGLPPSASEITFSPGLIFTRTWKGS--VFGGWKSKDSVPRLVSDFMQKKFSLDPLIHTMPFDKINEGF
ADH4_HUMAN      TFIGV-AAGSKGLTVFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALVHTLPFDKISEAF
ADH1A_PONAB     VIVGVP-PDSQNLSMNPMLLLTGRTWKGAVLGGFKSKECVPKLVADFMAKKFSLDALIHVLPFEKINDGF
ADHX_SPAAU      VIIGVAGAGQEISTR-PFQLVTGRVWKGTAFGGWKSVESVPKLVEDYMSKKLKVDEFVHTLPFEKINEGF
ADH1_STRCA      SVIVGVPPAAEKLSFDPMLLFSGRTWKGSVFGGWKSKDSVPKLVADYMEKKFVLDPLIHTLPFHKINEGF
FRMA_HAEIN      IIIGVAGAGQEISTR-PFQLVTGRVWKGSAFGGVKGRSELPQMVEDSMKGDIQLEPFVHTMPLDKINEAF
ADHP_RABIT      TFVGVNLADKGLTISIELILGRTLKGTNFGGWDA---ETVPKLVSDYKNGKFDLDALVHTLPFDKINEAL
ADH1_MOUSE      VVVGVP-PNAQNLSMNPMLLLLGRTWKGAIFGGFKSKDSVPKLVADFMAKKFPLDPLIHVLPFEKINEAF
ADH1_PERMA      VIVGVP-PNAQSLSVNPMSLLMGRSWKGAIFGGFKSKDSVPKLVTDFMAKKFPLEPLIHVLPFEKINEAF
ADH4_MOUSE      TVVGAKVD--EMTIPT-VDVILGRSINGTFFGGWKSVDSVPNLVSDYKNKKFDLDLLVHALPFESINDAI
ADH1G_HUMAN     VIVGVP-PDSQNLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALINILPFEKINEGF
FRMA_SYNY3      VIIGVAGAGQEISTR-PFQLVTGRKWMGTAFGGVKGRSQLPGMVEQSMRGEIQLAPFVHTMELKDINQAF
FADH_PARDE      IIIGVAPAGAEISTR-PFQLVTGRVWKGTAFGGARGRTDVPQIVDWYMDGKIEIDPMIHTLSLDDINKGF
ADH1A_MACMU     VIVGVP-PDSQNLSINPMLLLTGRTWKGAVYGGFKSKEDIPKLVADFMAKKFSLDALIHVLPFEKINEGF
ADH1_APTAU      SVILGVPPAAEKISFDPMLLFSGRTWKGSVFGGWKSKDAVPKLVADYMEKKFVLEPLIHTLPFIKINEGF
ADH1E_HORSE     -IVGVP-PDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLIHVLPFEKINEGF
ADH4_RAT        TVVGAKVDEMNIS---TVDMILGRSVKGTFFGGWKSVDSVPNLVTDYKNKKFDLDLLVHALPFDKINDAI
FRMA_ECOL6      VIIGVAGSGQEISTR-PFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPFVHTMSLDEINDAF
TERPD_PSESP     AVVGVP-PKLDATAAVSALIQKGLKLMGVIEGDS------------------------------------
FRMA_ECOUT      VIIGVAGSGQEISTR-PFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPFVHTMSLDEINDAF
FRMA_ECOL5      VIIGVAGSGQEISTR-PFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPFVHTMSLDEINDAF
FRMA_ECOK1      VIIGVAGSGQEISTR-PFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPFVHTMSLDEINDAF
ADHQ_RABIT      TFVGVNVNDKGLTISILGRTLRGSSF------GGWDVDTVPKLVSDYKNGKFNLEALVHTLPFEKINEAL
ADH7_MOUSE      VVVGAPPSAKMLTYD-PMLLFTGRTWKGCVFGGWKSRDDVPKLVTEFLEKKFDLDQLIHTLPFNNINEGF
ADH1_CHICK      VIVGVPPAAQKISFD-PMLIFSGRTWKGSVFGGWKSKDAVPKLVADYMKKKFVLDPLIHTLPFTKINEGF
ADH7_RAT        VVVGAP-PSAKMLSYDPMLLFTGRTWKGCVFGGWKSRDDVPKLVTEFLEKKFDLGQLIHTLPFHNISEGF
FRMA_SHISS      VIIGVAGSGQEISTR-PFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPFVHTMSLDEINDAF
FRMA_ECOLI      VIIGVAVAGQEISTR-PFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPFVHTMSLDEINDAF
FRMA_ECOLC      VIIGVAGSGQEISTR-PFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPFVHTMSLDEINDAF
FRMA_ECOHS      VIIGVAGSGQEISTR-PFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPFVHTMSLDEINDAF
FRMA_ECO57      VIIGVAGSGQEISTR-PFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPFVHTMSLDEINDAF
FRMA_ECO24      VIIGVAGSGQEISTR-PFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPFVHTMSLDEINDAF
ADH1_COTJA      VIVGVPPAAQKISFD-PMLIFSGRTWKGSVFGGWKSKDAVPKLVADYMKKKFVLDPLIHTLPFTKINEGF
ADHI_RHOS4      SIVIGVAPAGAEIQTRPFQLVTGRVWKGSAFGGARGRTDVPKIVDWYMEGKIQIDPMIHILSLEEINKGF
ADH1S_HORSE     GV----PPDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLIHVLPFEKINEGF
ADH1_NAJNA      VVVGVPPNASMITYN-PLMLFTGRTWKGCVFGGWKSKDSVPKLVSDFMQKKFVLDPLIHTLPFEKINEGF
FRMA_ECOSM      VIIGVAGSGQEISTR-PFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPFVHTMSLDEINDAF
ADH1_RABIT      GIVGVP-PDSQSLTVNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFSLDPLINVLPFEKINEGF
ADH1_RANPE      VIVGLAPSSAVMSFD-PLLILTGRILTGAVFGGWKSKDDVPKLVRDYLNKKFDFDPLITHYPFEKINEGF
FRMA_PASPI      VIIGVAGAGKEISTR-PFQLVTGRVWKGTAFGGVKGRTQLPGMVEDAMSGKIELAPFVHTMELDKINEAF
ADH1_GEOAT      SVIVGVPPNAQSLTIDPKVLLSGRSWKGAVFGGYKGKDDVPKLVADFMAKKFPLEPLINVFPLAKINEGF
ADHX_CAEEL      GVAGAGQEIATRPFQ----LVTGRTWKGTAFGGWKSVESVPRLVDDYMNKKLLIDEFIHRWNIDDINTAF
ADH7_HUMAN      VVVGVPPSAKMLTYD-PMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQLIHVLPFKKISEGF
ADH1_GEOBU      VIVGVP-PNAQSLTMDPMVLLSGRSWKGAVFGGYKGKDDVPKLVADFMAKKFPLEPLINVFPFAKINEGF
ADHX_OCTVU      VIVGVAAHGEEISTR-PFQLVTGRVWKGTAFGGFKSRDSVPKLVDDYMNKKLLLDEFVHKLSFKKINEAF
ADHX_MYXGL      SVILGVAGGGQEISTRPFQLVTGRTWKGAAFGGWKSVESVPKLVDDYMAGKIMVDEFVHSLPFDSINEAF
ADHX_UROHA      XXXXXXXXXXQEIATRPFQLVTGRTWKGTAFGGWKSVESVPKLVDEYMSKKMKVDEFVHTLPFEQINEAF
ADH1_GEOKN      VIVGVP-PNAQSLTMDPMVLLSGRSWKGAVFGGYKGKDDVPKLVADFMAKKFPLEPLINVFPFAKINEGF
ADH1_GADCA      VLVGWTDLHDVATRPIQLIAGRTWKGSMF--GGFKGKDGVPKMVKAYLDKKVKLDEFIHRMPLESVNDAI
ADHX_DROME      VVIGVAGAGQEISTRPFQLVVRVWKGSAFGGWRSVSD--VPKLVEDYLKKDLLVDEFIHELPLSQINEAF
ADHL3_ARATH     VLVGIPTPRTLPLHPM--ELFDGRRITGSVFGGFKPKSQLPNFAQQCMKGVVKLEPFINELPFEKINDAF
ADHH_GADMO      GVAGAGQEIATRPFQ----LVTGRVWKATAFGGWKSVESVPKLVEDYMNKKLKVDEFVHTLPFDSINEGF
ADHX_HORSE      XXXXXXXXXXEEIATRPFQLVTGRTWKGTAFGGWKSVESIPKLVSEYMSKKIKVDEFVHSLSFDQINEAF
FADH_CANMA      VIIGVAAAGKEISTR-PFQLVTGRTWKGAAFGGVKGRSQLPGIVNNYLDGKLKVEEFIHREPLAAINKAF
FADH_YEAST      SXXXXXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFIHRRPFKEINQAF
ADH1_RAT        VIVGVP-PSAQSLSVNPMSLLLGRTWKGAIFGGFKSKDAVPKLVADFMAKKFPLEPLIHVLPFEKINEAF
ADHX_RABIT      XXXXXXXXXXEEISTRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKINVDEFVNTLSFDQINEAF
ADHX_DICDI      TIVGVAPAGAEISTR-PFQLVTGRVWKGSAFGGVKSRSQLPSIIDKYMDKKLKVDEYVTTYPLNEINTAF
ADHX_RAT        XXXXXXXXXXEEISTRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTNLSFDQINKAF
ADH6_PONAB      CVVVGLLPASVQLKISGQLFFSGRSLKGSVFGGWKSRQHIPKLVADYMAKKLNLDPLIHTLNLDKINEAV
ADH1_PEA        VLVGVPSKD-DAFKTHPMNFLNERTLKGTFYGNYKPRTDLPNVVEKYMKGELELEKFIHTVPFSEINKAF
FADH_PICPA      IIIGVAAAGKEISTR-PFQLVTGRVWRGCAFGGIKGRTQMPSLVQDYLDGKIKVDEFIHRHDLDNINKAF
ADH8_RANPE      TVVLGLASPNERXXXXXXXXXTGRSLKGSVFGGFKGEE-VSRLVDDYMKKKINVNFLVSTLTLDQINKAF
ADHX_PEA        VIVGVAASGQEISTR-PFQLVTGRVWKGTAFGGFKSRSQVPWLVEKYLKKEIKVEYITHNLTLLEINKAF
ADHX_ORYSJ      VIVGVAASGQEISTR-PFQLVTGRVWKGTAFGGFKSRSQVPWLVEKYLNKEIKVDEYVHSMNLTDINKAF
ADHX_ORYSI      VIVGVAASGQEISTR-PFQLVTGRVWKGTAFGGFKSRSQVPWLVEKYLNKEIKVDEYVHSMNLTDINKAF
ADHX_MOUSE      XXXXXXXXXXEEISTRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTNLSFDQINQAF
ADHX_BOVIN      XXXXXXXXXXXXXXTRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVHSLPFDQINEAF
ADH1_TRIRP      VLVGVPKKD-DAFKTHPMNFLNERTLKGTFYGNYKPRTDLPNVVEQYMKGELELEKFIHSIPFSEINKAF
ADH6_HUMAN      CVVVGVLPASVQLKISGQLFFSGRSLKGSVFGGWKSRQHIPKLVADYMAEKLNLDPLIHTLNLDKINEA-
FADH1_SCHPO     CVIGVAAAGKTLDFR-PFLVVTGRQVLGSAFGGVKGRSELPNFVDEYMQGHFKVEYITNEEPLKNINKAF
ADHX_MAIZE      VIVGVAASGQEISTR-PFQLVTGRVWKGTAFGGFKSRTQVPWLVDKYMKKEIKVEYITHNMNLADINDAF
ADHL6_ARATH     VTLGVPKAKPEVSAHYGLFL-SGKSLKGTLFGGWKPKSDLPSLIDKYMNKEIMIDEFIHNLSFDEINKAF
ADH1_ARATH      VLVGVPSKD-DAFKTHPMNFLNERTLKGTFFGNYKPKTDIPGVVEKYMNKELELEKFIHTVPFSEINKAF
ADHL7_ARATH     ITLGVDKPGSQICLDSFDVLHHGKILMGSLFGGLKAKTHIPILLKRYLSNELELDKFVHEMKFEEINDAF
ADHX_HUMAN      XXXXXXXXXXEEIATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVHNLSFDEINKAF
ADHX_ARATH      VIVGVAASGQEISTR-PFQLVTGRVWKGTAFGGFKSRTQVPWLVEKYMNKEIKVEYITHNLTLGEINKAF
FADH2_SCHPO     IVIGVAAAGQEISTR-PFQLVTGRVWRGCAFGGVKGRSQLPDLVKEYLDHKLEIDKITHRRPLKEINEAF
ADH6_PERMA      VIVGSLASWIQLNINLKGSVLGGWK----------TKEEIPKLVSDYTAKKFNLDPLIHTLTLDKVNEAI
ADH3_HORVU      GV-----PHKEAVFKTPMNFLNEKTLKGTFFGNYKPRTDLPEVVEMYMRKELDLEKFIHSVPFSQINTAF
ADHB_MYCTU      VLTAGSLVDTQVTLNLAMLTLLQKNIQGTIFGGGNPHYDIPKLLSMYKAGKLNLDDMVTTYKLEQINDGY
ADHB_MYCBO      VLTAGSLVDTQVTLNLAMLTLLQKNIQGTIFGGGNPHYDIPKLLSMYKAGKLNLDDMVTTYKLEQINDGY
ADH1_PETHY      VLVGVPNKD-DAFKTHPMNLLNERTLKGTFFGNYKPKSDIPSVVDKYMKKELELEKFIHQVPFSEINKAF
ADH1_PENAM      VLVGVPHKDAEFKTHLNERTLKGTFF-----GNFKPRTDLPNVVELYMKKELEVEKFIHSVPFSEINKAF
ADHL2_ARATH     TIVLGMEQKALPISLGSYDLLRGRTVCGTLFGGLKPKLDIPILVDRYLKKELNLEDLIHELSFEEINKAF
ADH1_MAIZE      VLVGVPHKDAEFKTHLNERTLKGTFF-----GNYKPRTDLPNVVELYMKKELEVEKFIHSVPFAEINKAF
ADH2_HORVU      AHKEAVFKTHPMNF-LNERTLRGTFF-----GNYKPRTGLPGVVDMYMRKELELDKFIHSLPFSQINTAF
ADH6_RAT        VTVGALA-SFTSTLSIRSHLFSGRILKGSILGGWKTKEEIPKLVSDYMAKKFNIDPLIHTLTLSEANEAV
ADH2_MAIZE      VLVGVPHKDDQFKTHLSEKTLKGTFF-----GNYKPRTDLPNVVEMYMXXXXXXXXFIHSVPFSEINTAF
ADH1_ORYSJ      VLVGVPHKDAEFKTHLNERTLKGTFF-----GNYKPRTDLPNVVELYMKKELEVEKFIHSVPFSEINTAF
ADH1_ORYSI      VLVGVPHKDAEFKTHLNERTLKGTFF-----GNYKPRTDLPNVVELYMKKELEVEKFIHSVPFSEINTAF
ADHL4_ARATH     GV--TVMLGVHASPQLPMELFQGRSITASVFGGFKPKTQLPFFITQCLQGLLNLDLFIHQLPFHDINEAM
ADH1_SOLTU      VLVG--VPHKEAVFKTPMNLLNERTLKGTFFGNYKPRSDIPSVVEKYMNKELELEKFIHTLPFAEINKAF
ADH1_HORVU      VLVGVPHKDAEFKTHLNERTLKGTFF-----GNFKPRTDLPNVVEMYMKKELEVEKFIHSVPFSEINTAF
ADH3_SOLTU      VLVG--VPHKEAVFKTPMNFLNERTLKGTFFGNYKPRSDIPSVVEKYMNKELELEKFIHTLPFAEINKAF
ADH2_SOLTU      VLVG--VPHKEAVFKTPMNFLNERTLKGTFFGNYKPRSDIPSVVEKYMNKELELEKFIHTLPFAEINKAF
ADHL1_ARATH     GMEKHAAPISLGSFD----LLRGRVICGSLFGGLKSKLDIPILVDHYLKKELNLDSFI-THELKEINKAF
ADH2_SOLLC      VLVG--VPHKEAVFKTPLNFLNERTLKGTFFGNYKPRSDIPCVVEKYMNKELELEKFIHTLPFAEINKAF
ADHL5_ARATH     GIDKHLTPVSLGSFD----LLRGRHVCGSLFGGLKPKLDIPILVDHYLKKELNLDSFIHELKFEEINKAF
ADH_MALDO       VLVG--VPHKDAVFKTPVNFLNERTLKGTFFGNYKTRTDIPSVVEKYMNKELELEKFIHKVPFSEINKAF
ADH_FRAAN       VLVGVPHKDAVFTTHLNERTLKGTFF-----GNYKPRTDIPSVVEKYMNKELEVDKFIHQLPFSQINKAF
ADH2_ORYSJ      VLVGVPT--KDDVFKTPMNFLNEKTLKGTFFGNYKPRTDLPNVVXXXXXXXXXXXXFIHSVPFSEINTAF
ADH2_ORYSI      VLVGVPT--KDDVFKTPMNFLNEKTLKGTFFGNYKPRTDLPNVVXXXXXXXXXXXXFIHSVPFSEINTAF
ADH1_BACST      VLVGLPP--EEIPIPIFDTVLNGVKIIGSIVG---TRKDLQEALQFAAEGK--VKTIVEVQPLENINDVF
ADH3_BACST      VLVGLPP--EEMPIPIFDTVLNGIKIIGSIVG---TRKDLQEALQFAAEGK--VKTIIEVQPLEKINEVF
ADH2_BACST      VVVG--LPNADLPIPIFDTVLNGVSVKGSIVG---TRKDMQEALDFAARGK--VRPIVETAELEEINEVF
ADH1_ZEALU      VLVGVPHKDAEFKTHLNERTLKGTFF-----GNYKPRTDLPNVVELYMKKELEVEKFIHSVPFAEINKAF
ADH1_ANAPL      VIVGVPPAAQNITFD-PMLLFSGRTWKGSVFGGWKSKDSVPKLVADYMKKKFVLDPLIHTLPFSKINEGF
DHSO_BACSU      AIVGLPS---------------------------------------------------------------
BDHA_BACSU      VIVSIWEKGAE--IHPNDIVIK----ERTVKGIIGYRDIFPAVLSLMKEGYFSADKLV------------
YJMD_BACSU      VVLGFDERAAQ------ISQLPITKKEVTITGSRLQTNQFPKVVELLNGGRLMHNGLVHTFSVDDVHHAF
ADH_STAAW       ----------------------------------------------------------------------
ADH_STAAS       ----------------------------------------------------------------------
ADH_STAAR       ----------------------------------------------------------------------
ADH_STAAN       ----------------------------------------------------------------------
ADH_STAAM       ----------------------------------------------------------------------
ADH_STAAC       ----------------------------------------------------------------------
ADH_STAAB       ----------------------------------------------------------------------
ADH_STAA8       ----------------------------------------------------------------------
ADH_STAA3       ----------------------------------------------------------------------
XYLD_MORMO      VLVGMPID--PAPLDIVAAQAKEVTFKTILR----YANMYPRTIRLLSSGKLNVAPLLATYKFKDSVEAY
TDH_SHEON       AMLG--IPGGEMAIDWSKVIFKGLVIKGIYGREMFETWY--KMASLIQSGLDISPIITHHYKIDDFQKGF
YDJJ_ECOLI      MIVGTVPGDSAINF---LKINREVTIQTVFR----YANRYPVTIEAISSGRFDVKSMVHIYDYRDVQQAF
TDH_SHEPC       AMLG--IPGGEMAIDWSKVIFKGLVIKGIYGREMFETWY--KMASLIQSGLDISPIITHHYKIDDFQKGF
TDH_BACA2       HMLSLP----------------------------------------------------------------
ADH_STAES       ----------------------------------------------------------------------
TDH_SHEWM       AMLGIP----------------------------------------------------------------
TDH_SHESR       AMLG--IPGGEMAIDWSKVIFKGLVIKGIYGREMFETWY--KMASLIQSGLDISPIITHHYKIDDFQKGF
TDH_SHESM       AMLG--IPGGEMAIDWSKVIFKGLVIKGIYGREMFETWY--KMASLIQSGLDISPIITHHYKIDDFQKGF
TDH_SHESA       AMLG--IPGGEMAIDWSKVIFKGLVIKGIYGREMFETWY--KMASLIQSGLDISPIITHHYKIDDFQKGF
TDH_SHEB9       AMLG--IPGGEMAIDWSKVIFKG-----------------------------------------------
TDH_SHEB8       AMLGIPS---------------------------------------------------------------
TDH_SHEB5       AMLG--IPGGEMAIDWSKVIFKG-----------------------------------------------
TDH_SHEB2       AMLG--IPGGEMAIDWSKVIFKG-----------------------------------------------
TDH_SHESW       AMLG--IPGGEMAIDWSKVIFKG-----------------------------------------------
ADH_STAEQ       ----------------------------------------------------------------------
YPHC_ECOLI      VYIGETG---KVEFEVSADLMH---HQRRIIGSWVTSLFMEKCAHDLTDWKWPRNAITHRFSLEQAGDAY
TDH_SHESH       AMLG--IPGGEMAIDWSKVIFKG-----------------------------------------------
TDH_SHEPA       AMLGIP----------------------------------------------------------------
TDH_SHEHH       AMLG--IPGGEMAIDWSKVIFKG-----------------------------------------------
TDH_SHEAM       AMLG--IPGGEMAIDWSKVIFKG-----------------------------------------------
TDH_SHELP       AMLGIP----------------------------------------------------------------
TDH_MESSB       AILGIAPTGFE-----------------------------------------------------------
DHSO_BACHD      AQVGLFAPEIQFNFE----KIIQKEISVVGSRSQKPADWEPAL-SLLNEKKVNAKTLVHEYTISEWDKAY
TDH_BACLD       HVLSLP----------------------------------------------------------------
ADH_RALEU       SSLGVYSSDLTIPLSAFAAGLGDHKINTALCPGG--KERMRRLINVIESGRVDLGALVHQYRLDDIYDLF
TDH_CHRVO       ALLGIP----------------------------------------------------------------
ADHB_BACSU      ----------------------------------------------------------------------
ADH3_KLULA      VLVGLPA-GAVIKSEVFSHVVK------------------------------------------------
TDH_PYRAB       SLLG------------------------------------------------------------------
YAHK_ECOLI      ----------------------------------------------------------------------
XYL2_PICST      VQVGNAA---------------------------------------------------------------
TDH_SHEFN       AMLGIP----------------------------------------------------------------
TDH_PSEHT       AMLGIP----------------------------------------------------------------
TDH_PSEA6       AMLGIPS---------------------------------------------------------------
ADH2_KLULA      VLVGLP----------------------------------------------------------------
TDH_PHOLL       ALLGIP----------------------------------------------------------------
TDH_PYRHO       SLLG------------------------------------------------------------------
TDH_BACSU       HILSLP----------------------------------------------------------------
TDH_ALTMD       AMLGIP----------------------------------------------------------------
ADH1_KLULA      VLVGLP----------------------------------------------------------------
TDH_YERPY       AMLGIPPSDMSIDWNYGREMFETWKMAALIQSGL---DLTPIITH-----RFPIDEFQQGF------DAM
TDH_YERPS       AMLGIPPSDMSIDWNYGREMFETWKMAALIQSGL---DLTPIITH-----RFPIDEFQQGF------DAM
TDH_YERPP       AMLGIPPSDMSIDWNYGREMFETWKMAALIQSGL---DLTPIITH-----RFPIDEFQQGF------DAM
TDH_YERPN       AMLGIPPSDMSIDWNYGREMFETWKMAALIQSGL---DLTPIITH-----RFPIDEFQQGF------DAM
TDH_YERPG       AMLGIPPSDMSIDWNYGREMFETWKMAALIQSGL---DLTPIITH-----RFPIDEFQQGF------DAM
TDH_YERPE       AMLGIPPSDMSIDWNYGREMFETWKMAALIQSGL---DLTPIITH-----RFPIDEFQQGF------DAM
TDH_YERPB       AMLGIPPSDMSIDWNYGREMFETWKMAALIQSGL---DLTPIITH-----RFPIDEFQQGF------DAM
TDH_YERPA       AMLGIPPSDMSIDWNYGREMFETWKMAALIQSGL---DLTPIITH-----RFPIDEFQQGF------DAM
TDH_YERP3       AMLGIPPSDMSIDWNYGREMFETWKMAALIQSGL---DLTPIITH-----RFPIDEFQQGF------DAM
TDH_THETN       SILGLP----------------------------------------------------------------
TDH_BURXL       ALLGIPP--AQTAIDWTQVIFKGLEIKGIYGREMFETWY--KMVAMLQSGLDLSPILTHHFKVDDYREAF
TDH_BURPP       ALLGIPP--AQTAIDWTQVIFKGLEIKGIYGREMFETWY--KMVAMLQSGLDLSPILTHHFKVDDYQEAF
TDH_BURP8       ALLGIPP--AQTAIDWTQVIFKGLEIKGIYGREMFETWY--KMVAMLQSGLDLSPILTHRFAVDDYEKAF
ADHP_ECOLI      ----------------------------------------------------------------------
ADH1_CANAL      VLVGLPA---------------------------------------------------------------
TDH_THET8       RILGIPSD--PIRFDLAGELVMRGITAFGIAGRRLWQTWMTALVYSGRVDLSPL--LTHRLPLSRYREAF
TDH_SHISS       AMLGIP----------------------------------------------------------------
TDH_PYRFU       SLLG------------------------------------------------------------------
TDH_FRATN       SLLGISA--GDISVDWGAILFKG-----------------------------------------------
TDH_CITK8       AMLGIP----------------------------------------------------------------
TDH_BURPS       ALLGIPP--AQTAIDWNQVIFKGLEIKGIYGREMFETWY--KMVAMLQSGLDLSPIITHRFAVDDYEKGF
TDH_BURP6       ALLGIPP--AQTAIDWNQVIFKGLEIKGIYGREMFETWY--KMVAMLQSGLDLSPIITHRFAVDDYEKGF
TDH_BURP1       ALLGIPP--AQTAIDWNQVIFKGLEIKGIYGREMFETWY--KMVAMLQSGLDLSPIITHRFAVDDYEKGF
TDH_BURP0       ALLGIPP--AQTAIDWNQVIFKGLEIKGIYGREMFETWY--KMVAMLQSGLDLSPIITHRFAVDDYEKGF
TDH_BURMS       ALLGIPP--AQTAIDWNQVIFKGLEIKGIYGREMFETWY--KMVAMLQSGLDLSPIITHRFAVDDYEKGF
TDH_BURMA       ALLGIPP--AQTAIDWNQVIFKGLEIKGIYGREMFETWY--KMVAMLQSGLDLSPIITHRFAVDDYEKGF
TDH_BURM9       ALLGIPP--AQTAIDWNQVIFKGLEIKGIYGREMFETWY--KMVAMLQSGLDLSPIITHRFAVDDYEKGF
TDH_BURM7       ALLGIPP--AQTAIDWNQVIFKGLEIKGIYGREMFETWY--KMVAMLQSGLDLSPIITHRFAVDDYEKGF
TDH_AERS4       AMLGIP----------------------------------------------------------------
ADH1_ZYMMO      VAVGLP----------------------------------------------------------------
TDH_SYMTH       SLLG--LPGRPLELDLAADVIRGLVLQG-ITGRRMWQTWY-QVRSLYRAGLAERLRPLVTHPLEQIDAAM
TDH_SALAR       AMLGIP----------------------------------------------------------------
TDH_PROMH       ALLGIPP--SDMAIDWGQVIFKGLMFETWYKMAALIQDLSPIITH-----QFPIDEFQKGF------DIM
TDH_FRATW       SLLGISA--