[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF55431.1

[Show Plain Result]


## Summary of Sequence Search
    1::100
    1::100     1e-55 100%  100 aa  CLPS_CORGL RecName: Full=ATP-dependent Clp protease adapter protein
    1::100     1e-55 100%  100 aa  CLPS_CORGB RecName: Full=ATP-dependent Clp protease adapter protein
    3::101     2e-51  92%  101 aa  CLPS_COREF RecName: Full=ATP-dependent Clp protease adapter protein
   16::113     4e-44  84%  113 aa  CLPS_CORDI RecName: Full=ATP-dependent Clp protease adapter protein
   14::111     1e-41  78%  111 aa  CLPS_CORA7 RecName: Full=ATP-dependent Clp protease adapter protein
   19::99      2e-39  88%  101 aa  CLPS_CORJK RecName: Full=ATP-dependent Clp protease adapter
   15::109     1e-33  64%  112 aa  CLPS_RHOOB RecName: Full=ATP-dependent Clp protease adapter protein
   15::111     2e-33  63%  112 aa  CLPS_RHOSR RecName: Full=ATP-dependent Clp protease adapter protein
   11::104     1e-32  63%  106 aa  CLPS_NOCFA RecName: Full=ATP-dependent Clp protease adapter protein
    4::103     1e-28  57%  105 aa  CLPS_MYCPA RecName: Full=ATP-dependent Clp protease adapter protein
    4::103     1e-28  57%  105 aa  CLPS_MYCA1 RecName: Full=ATP-dependent Clp protease adapter protein
   28::99      6e-28  71%  101 aa  CLPS_MYCTU RecName: Full=ATP-dependent Clp protease adapter
   28::99      6e-28  71%  101 aa  CLPS_MYCTA RecName: Full=ATP-dependent Clp protease adapter
   27::99      6e-28  68%  101 aa  CLPS_MYCMM RecName: Full=ATP-dependent Clp protease adapter
   28::99      6e-28  71%  101 aa  CLPS_MYCBT RecName: Full=ATP-dependent Clp protease adapter
   28::99      6e-28  71%  101 aa  CLPS_MYCBP RecName: Full=ATP-dependent Clp protease adapter
   28::99      6e-28  71%  101 aa  CLPS_MYCBO RecName: Full=ATP-dependent Clp protease adapter
   35::106     2e-27  69%  108 aa  CLPS_MYCLE RecName: Full=ATP-dependent Clp protease adapter protein
    8::102     2e-25  55%  105 aa  CLPS_STRAW RecName: Full=ATP-dependent Clp protease adapter protein
   11::93      3e-25  57%   96 aa  CLPS_STRCO RecName: Full=ATP-dependent Clp protease adapter
   44::95      5e-06  35%  120 aa  CLPS_PSEMY RecName: Full=ATP-dependent Clp protease adapter
   13::106     2e-05  30%  106 aa  CLPS_HALHL RecName: Full=ATP-dependent Clp protease adapter protein
   31::106     3e-05  31%  106 aa  CLPS_XYLFT RecName: Full=ATP-dependent Clp protease adapter protein
   31::106     3e-05  31%  106 aa  CLPS_XYLFM RecName: Full=ATP-dependent Clp protease adapter protein
   31::106     3e-05  31%  106 aa  CLPS_XYLF2 RecName: Full=ATP-dependent Clp protease adapter protein
   44::95      3e-05  33%  120 aa  CLPS_PSEPW RecName: Full=ATP-dependent Clp protease adapter
   44::95      3e-05  33%  120 aa  CLPS_PSEPK RecName: Full=ATP-dependent Clp protease adapter
   44::95      3e-05  33%  120 aa  CLPS_PSEPG RecName: Full=ATP-dependent Clp protease adapter
   44::95      3e-05  33%  120 aa  CLPS_PSEP1 RecName: Full=ATP-dependent Clp protease adapter
   46::97      3e-05  31%  122 aa  CLPS_PSEAE RecName: Full=ATP-dependent Clp protease adapter
   46::97      3e-05  31%  122 aa  CLPS_PSEAB RecName: Full=ATP-dependent Clp protease adapter
   46::97      3e-05  31%  122 aa  CLPS_PSEA7 RecName: Full=ATP-dependent Clp protease adapter
   34::106     3e-05  31%  106 aa  CLPS_METCA RecName: Full=ATP-dependent Clp protease adapter protein
   29::87      4e-05  27%  104 aa  CLPS_DESAH RecName: Full=ATP-dependent Clp protease adapter
   27::84      4e-05  33%  102 aa  CLPS_AZOSE RecName: Full=ATP-dependent Clp protease adapter
   31::106     4e-05  31%  106 aa  CLPS_ALHEH RecName: Full=ATP-dependent Clp protease adapter protein
   31::106     1e-04  31%  106 aa  CLPS_XYLFA RecName: Full=ATP-dependent Clp protease adapter protein
   10::106     1e-04  31%  106 aa  CLPS_XANCP RecName: Full=ATP-dependent Clp protease adapter protein
   10::106     1e-04  31%  106 aa  CLPS_XANC8 RecName: Full=ATP-dependent Clp protease adapter protein
   44::95      1e-04  31%  120 aa  CLPS_AZOVD RecName: Full=ATP-dependent Clp protease adapter
   46::111     1e-04  32%  122 aa  CLPS_ACIAC RecName: Full=ATP-dependent Clp protease adapter protein
  664::697     1e-04  41%  927 aa  TEX10_CHICK RecName: Full=Testis-expressed sequence 10 protein
   34::106     1e-04  34%  106 aa  CLPS_VIBFM RecName: Full=ATP-dependent Clp protease adapter protein
   34::106     1e-04  34%  106 aa  CLPS_VIBF1 RecName: Full=ATP-dependent Clp protease adapter protein
   24::92      1e-04  29%   95 aa  CLPS_SYNE7 RecName: Full=ATP-dependent Clp protease adapter
   31::72      1e-04  43%  106 aa  CLPS_EDWI9 RecName: Full=ATP-dependent Clp protease adapter
   22::88      1e-04  31%  106 aa  CLPS_CHRVO RecName: Full=ATP-dependent Clp protease adapter
    6::68      2e-04  33%  102 aa  CLPS_SHEAM RecName: Full=ATP-dependent Clp protease adapter
   44::95      2e-04  31%  120 aa  CLPS_PSEF5 RecName: Full=ATP-dependent Clp protease adapter
    8::79      2e-04  29%  114 aa  CLPS_BDEBA RecName: Full=ATP-dependent Clp protease adapter
   24::87      2e-04  32%   91 aa  CLPS_SYNP6 RecName: Full=ATP-dependent Clp protease adapter
   31::72      2e-04  40%  106 aa  CLPS_SODGM RecName: Full=ATP-dependent Clp protease adapter
   30::71      2e-04  40%  105 aa  CLPS_KLEP7 RecName: Full=ATP-dependent Clp protease adapter
   30::71      2e-04  40%  105 aa  CLPS_KLEP3 RecName: Full=ATP-dependent Clp protease adapter
   31::72      3e-04  38%  106 aa  CLPS_ENTS8 RecName: Full=ATP-dependent Clp protease adapter
   29::77      3e-04  35%  104 aa  CLPS_BORPE RecName: Full=ATP-dependent Clp protease adapter
   29::77      3e-04  35%  104 aa  CLPS_BORPA RecName: Full=ATP-dependent Clp protease adapter
   29::77      3e-04  35%  104 aa  CLPS_BORBR RecName: Full=ATP-dependent Clp protease adapter
   43::94      4e-04  31%  119 aa  CLPS_MARAV RecName: Full=ATP-dependent Clp protease adapter
   31::106     5e-04  27%  106 aa  CLPS_XANOR RecName: Full=ATP-dependent Clp protease adapter protein
   31::106     5e-04  27%  106 aa  CLPS_XANOM RecName: Full=ATP-dependent Clp protease adapter protein
   31::106     5e-04  27%  106 aa  CLPS_XANAC RecName: Full=ATP-dependent Clp protease adapter protein
   31::72      5e-04  38%  106 aa  CLPS_SHISS RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_SHIFL RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_SHIF8 RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_SHIDS RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_SHIBS RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_SHIB3 RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_SALTY RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_SALTI RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_SALSV RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_SALPK RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_SALPC RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_SALPB RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_SALPA RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_SALNS RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_SALHS RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_SALEP RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_SALDC RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_SALCH RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_SALAR RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_SALA4 RecName: Full=ATP-dependent Clp protease adapter
   34::88      5e-04  31%  106 aa  CLPS_PHOPR RecName: Full=ATP-dependent Clp protease adapter
   27::84      5e-04  28%  102 aa  CLPS_NITMU RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_ESCF3 RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_ECOUT RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_ECOSM RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_ECOSE RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_ECOLU RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_ECOLI RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_ECOLC RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_ECOL6 RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_ECOL5 RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_ECOK1 RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_ECOHS RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_ECODH RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_ECOBW RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_ECO8A RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_ECO81 RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_ECO7I RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_ECO5E RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_ECO57 RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_ECO55 RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_ECO45 RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_ECO27 RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_ECO24 RecName: Full=ATP-dependent Clp protease adapter
   31::72      5e-04  38%  106 aa  CLPS_CITK8 RecName: Full=ATP-dependent Clp protease adapter
   27::84      5e-04  29%  102 aa  CLPS_AZOSB RecName: Full=ATP-dependent Clp protease adapter
   31::72      6e-04  38%  106 aa  CLPS_YERPY RecName: Full=ATP-dependent Clp protease adapter
   31::72      6e-04  38%  106 aa  CLPS_YERPS RecName: Full=ATP-dependent Clp protease adapter
   31::72      6e-04  38%  106 aa  CLPS_YERPP RecName: Full=ATP-dependent Clp protease adapter
   31::72      6e-04  38%  106 aa  CLPS_YERPN RecName: Full=ATP-dependent Clp protease adapter
   31::72      6e-04  38%  106 aa  CLPS_YERPG RecName: Full=ATP-dependent Clp protease adapter
   31::72      6e-04  38%  106 aa  CLPS_YERPE RecName: Full=ATP-dependent Clp protease adapter
   31::72      6e-04  38%  106 aa  CLPS_YERPB RecName: Full=ATP-dependent Clp protease adapter
   31::72      6e-04  38%  106 aa  CLPS_YERPA RecName: Full=ATP-dependent Clp protease adapter
   31::72      6e-04  38%  106 aa  CLPS_YERP3 RecName: Full=ATP-dependent Clp protease adapter
   31::72      6e-04  38%  106 aa  CLPS_YERE8 RecName: Full=ATP-dependent Clp protease adapter
   29::70      6e-04  33%  104 aa  CLPS_BORA1 RecName: Full=ATP-dependent Clp protease adapter
   31::72      8e-04  38%  106 aa  CLPS_SERP5 RecName: Full=ATP-dependent Clp protease adapter
   31::72      8e-04  38%  106 aa  CLPS_SALG2 RecName: Full=ATP-dependent Clp protease adapter
   31::72      8e-04  38%  106 aa  CLPS_ERWT9 RecName: Full=ATP-dependent Clp protease adapter
    1::91      8e-04  25%  113 aa  CLPS_DEIRA RecName: Full=ATP-dependent Clp protease adapter
   29::104     8e-04  33%  104 aa  CLPS_BURPP RecName: Full=ATP-dependent Clp protease adapter protein
   29::104     8e-04  31%  104 aa  CLPS_BURP8 RecName: Full=ATP-dependent Clp protease adapter protein
    1::100

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSSPSAPLATPDVELDVHTLSSENLPWLCIVWDDPVNLMSYVTYVFQTVLGFSKKRATELMMQVHTEGKA
CLPS_CORGL      MSSPSAPLATPDVELDVHTLSSENLPWLCIVWDDPVNLMSYVTYVFQTVLGFSKKRATELMMQVHTEGKA
CLPS_CORGB      MSSPSAPLATPDVELDVHTLSSENLPWLCIVWDDPVNLMSYVTYVFQTVLGFSKKRATELMMQVHTEGKA
CLPS_COREF      -SSPSAPTAEPDVEMDVHTVSSENLPWLCIVWDDPVNLMSYVTYVFQTVLGYSRKRANELMMQVHTEGKA
CLPS_CORDI      ----SSSMATPDEEMAVEVASSENLPWMCIVWDDPVNLMSYVTYVFQTILGYSKKRATELMMQVHTEGKA
CLPS_CORA7      ----SSPMATPELDIEVDVATSENLPWMCIVWDDPVNLMSYVSYVFQTVLGYDKKRANELMMQVHTEGKA
CLPS_CORJK      ------------------TLTEPNLPWMCICWDDPVNLMSYVTYVFQTVLGYSRKRATELMMQVHTEGKA
CLPS_RHOOB      ---PASPQVTPAESEVVEVDEANDRPWVTVVWDDPVNLMHYVTYIFQKLFGYSKARATELMMQVHSEGKA
CLPS_RHOSR      ---PASPQVTPAESEVVEIDEANDRPWVTVVWDDPVNLMHYVTYIFQKLFGYSKAKATELMMQVHSEGKA
CLPS_NOCFA      ----SAAQATPEAVEYTEILEAEDRPWVTVVWDDPVNLMHYVTYIFQKLFGYSKAKATELMLQVHNEGKA
CLPS_MYCPA      MSAPTEPKSRPGTTGQRESAPEDVTPWVTIVWDDPVNLMTYVTYVFQKLFGYSEPHATKLMLQVHNEGKA
CLPS_MYCA1      MSAPTEPKSRPGTTGQRESAPEDVTPWVTIVWDDPVNLMTYVTYVFQKLFGYSEPHATKLMLQVHNEGKA
CLPS_MYCTU      --------------------------WVTIVWDDPVNLMSYVTYVFQKLFGYSEPHATKLMLQVHNEGKA
CLPS_MYCTA      --------------------------WVTIVWDDPVNLMSYVTYVFQKLFGYSEPHATKLMLQVHNEGKA
CLPS_MYCMM      -------------------------PWVTIVWDDPVNLMTYVTYVFQKLFGYSEPHATKLMLQVHNEGRA
CLPS_MYCBT      --------------------------WVTIVWDDPVNLMSYVTYVFQKLFGYSEPHATKLMLQVHNEGKA
CLPS_MYCBP      --------------------------WVTIVWDDPVNLMSYVTYVFQKLFGYSEPHATKLMLQVHNEGKA
CLPS_MYCBO      --------------------------WVTIVWDDPVNLMSYVTYVFQKLFGYSEPHATKLMLQVHNEGKA
CLPS_MYCLE      --------------------------WVTIVWDDPVNLMAYVTYVFQKLFGYSEPHATKLMLQVHNEGKA
CLPS_STRAW      -----APLEIEKTESEVFAVPEPDVPWVTIVHNDPVNLMSYVTYVFQTYFGYSKDKATKLMLDVHHKGRA
CLPS_STRCO      ---------------EVFAVPEPDVPWVTIVHNDPVNLMSYVTYVFQSYFGYSKDKATKLMMDVHHKGRA
CLPS_PSEMY      -----------------------------VLFNDDYTPMDFVVEVLETFFGMNRELATKIMLTVHTEGRA
CLPS_HALHL      ----------PEVEAAKPSLKQPPM-YKVVLLNDDYTPMDFVVEVLQRFFNKDRSQATQIMLHVHTRGKG
CLPS_XYLFT      -----------------------------LLLNDDYTPMDFVIVVLQQFFAMDLKKATQVMLHVHTRGRG
CLPS_XYLFM      -----------------------------LLLNDDYTPMDFVIVVLQQFFAMDLKKATQVMLHVHTRGRG
CLPS_XYLF2      -----------------------------LLLNDDYTPMDFVIVVLQQFFAMDLKKATQVMLHVHTRGRG
CLPS_PSEPW      -----------------------------VLFNDDYTPMDFVVEVLETFFSLNRELATKIMLTVHTEGRA
CLPS_PSEPK      -----------------------------VLFNDDYTPMDFVVEVLETFFSLNRELATKIMLTVHTEGRA
CLPS_PSEPG      -----------------------------VLFNDDYTPMDFVVEVLETFFSLNRELATKIMLTVHTEGRA
CLPS_PSEP1      -----------------------------VLFNDDYTPMDFVVEVLETFFSLNRELATKIMLTVHTEGRA
CLPS_PSEAE      -----------------------------VLFNDDYTPMDFVVEVLEVFFNMDREKATKIMLTVHTQGKA
CLPS_PSEAB      -----------------------------VLFNDDYTPMDFVVEVLEVFFNMDREKATKIMLTVHTQGKA
CLPS_PSEA7      -----------------------------VLFNDDYTPMDFVVEVLEVFFNMDREKATKIMLTVHTQGKA
CLPS_METCA      --------------------------------NDDFTPMEFVVHVLMLFFGMNEEKATQVMLHVHTRGVG
CLPS_DESAH      -----------------------------VLHNDDYTTMEFVVQILITVFGKSLEKASIIMLNIHKQGKG
CLPS_AZOSE      -----------------------------LLLNDDFTPMDFVIVVLQKFFGMDRERATRVMLQVHREGMG
CLPS_ALHEH      -----------------------------IILNDDYTPMDFVVEVLQKFFHMDRARATQVMLHVHTRGEG
CLPS_XYLFA      -----------------------------LLLNDDYTPMDFVIVVLQQFFAMDLKKATQVMLHVHTRGCG
CLPS_XANCP      -----------DHGLVVETSKPEVAPYQVLLLNDDYTPMDFVVTVLQQFFNLELERATQVMLHVHTRGRG
CLPS_XANC8      -----------DHGLVVETSKPEVAPYQVLLLNDDYTPMDFVVTVLQQFFNLELERATQVMLHVHTRGRG
CLPS_AZOVD      -----------------------------VMFNDDYTPMDFVVEVLEKFFNLNRELATKVMLTVHTEGRA
CLPS_ACIAC      -----------------------------VMLNDDYTPMEFVIVVLQEFFGKDREAATQIMLKIHLDGKG
TEX10_CHICK     --------------------------WKCQVQDNAVNDVDYFSFLFSTLIGFSREELTSL----------
CLPS_VIBFM      --------------------------------NDDYTPMEFVVEVLDKFFSMDLEKATQLMLTVHYEGKA
CLPS_VIBF1      --------------------------------NDDYTPMEFVVEVLDKFFSMDLEKATQLMLTVHYEGKA
CLPS_SYNE7      -----------------------------LLHNDDFNPMEYVVMVLQTVPSLTQPQAVDIMMEAHTNGTG
CLPS_EDWI9      -----------------------------ILNNDDYTPMEFVIEVLQTFFAYDIERATQLMLTVHYKGKA
CLPS_CHRVO      ----------------------ENPPYKVLLLNDDFTPMDFVVQVLQQFFHMNREKATHIMLQVHTQGHG
CLPS_SHEAM      -----------NIERVVERADTELMPYKVILNNDDYTPMDFVVEVLQLFFKMNEHQATEIMLQIHHQGKA
CLPS_PSEF5      -----------------------------VLFNDDYTPMDFVVEVLEMFFNLNRELATKVMLAVHTEGRA
CLPS_BDEBA      -SNSNYPFASPEGEAGVQLVPKLDTPYKVILLNDDYTPMDFVVLVLRRFFAKTEEQATEIMLDVHKKGAG
CLPS_SYNP6      -----------------------------LLHNDDFNPMEYVVMVLQTVPSLTQPQAVDIMMEAHTNGTG
CLPS_SODGM      -----------------------------ILINDDYTPMEFVIDVLQKFFSYDVERATQLMLRVHYQGKA
CLPS_KLEP7      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLTVHYEGKA
CLPS_KLEP3      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLTVHYEGKA
CLPS_ENTS8      -----------------------------ILMNDDYTPMEFVIDVLQKFFSYDVERATQLMLTVHYQGKA
CLPS_BORPE      -----------------------------VLLNDDYTPMEFVVKVLQKFFGKNSEDATRIMLQVHHEGRA
CLPS_BORPA      -----------------------------VLLNDDYTPMEFVVKVLQKFFGKNSEDATRIMLQVHHEGRA
CLPS_BORBR      -----------------------------VLLNDDYTPMEFVVKVLQKFFGKNSEDATRIMLQVHHEGRA
CLPS_MARAV      -----------------------------VLLNDDYTPMDFVVDVLMKFFAMNEEKATQVMLLVHTQGKA
CLPS_XANOR      -----------------------------LLLNDDYTPMDFVVTVLEQFFNLNLEQATQIMLHVHTRGRG
CLPS_XANOM      -----------------------------LLLNDDYTPMDFVVTVLEQFFNLNLEQATQIMLHVHTRGRG
CLPS_XANAC      -----------------------------LLLNDDYTPMDFVVTVLEQFFNLNLEQATQIMLHVHTRGRG
CLPS_SHISS      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_SHIFL      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_SHIF8      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_SHIDS      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_SHIBS      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_SHIB3      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_SALTY      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_SALTI      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_SALSV      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_SALPK      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_SALPC      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_SALPB      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_SALPA      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_SALNS      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_SALHS      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_SALEP      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_SALDC      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_SALCH      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_SALAR      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_SALA4      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_PHOPR      --------------------------------NDDYTPMDFVIEVLQKFFSMDMEKATQLMLNVHYEGKA
CLPS_NITMU      -----------------------------ILLNDDFTPMDFVVTVLQTFFSMNREQATQIMLKVHMDGAG
CLPS_ESCF3      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLTVHYQGKA
CLPS_ECOUT      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_ECOSM      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_ECOSE      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_ECOLU      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_ECOLI      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_ECOLC      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_ECOL6      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_ECOL5      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_ECOK1      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_ECOHS      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_ECODH      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_ECOBW      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_ECO8A      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_ECO81      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_ECO7I      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_ECO5E      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_ECO57      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_ECO55      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_ECO45      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_ECO27      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_ECO24      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_CITK8      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKA
CLPS_AZOSB      -----------------------------LLLNDDFTPMDFVIVVLQKYFSMDRERATRVMLQVHREGMG
CLPS_YERPY      -----------------------------ILNNDDYTPMEFVIDVLQKFFSYDIERATQLMLNVHYQGKA
CLPS_YERPS      -----------------------------ILNNDDYTPMEFVIDVLQKFFSYDIERATQLMLNVHYQGKA
CLPS_YERPP      -----------------------------ILNNDDYTPMEFVIDVLQKFFSYDIERATQLMLNVHYQGKA
CLPS_YERPN      -----------------------------ILNNDDYTPMEFVIDVLQKFFSYDIERATQLMLNVHYQGKA
CLPS_YERPG      -----------------------------ILNNDDYTPMEFVIDVLQKFFSYDIERATQLMLNVHYQGKA
CLPS_YERPE      -----------------------------ILNNDDYTPMEFVIDVLQKFFSYDIERATQLMLNVHYQGKA
CLPS_YERPB      -----------------------------ILNNDDYTPMEFVIDVLQKFFSYDIERATQLMLNVHYQGKA
CLPS_YERPA      -----------------------------ILNNDDYTPMEFVIDVLQKFFSYDIERATQLMLNVHYQGKA
CLPS_YERP3      -----------------------------ILNNDDYTPMEFVIDVLQKFFSYDIERATQLMLNVHYQGKA
CLPS_YERE8      -----------------------------ILNNDDYTPMEFVIDVLQKFFSYDIERATQLMLNVHYQGKA
CLPS_BORA1      -----------------------------VLLNDDYTPMEFVVKVLQKFFGKNQEEATRIMLQVHHEGRG
CLPS_SERP5      -----------------------------ILNNDDYTPMEFVIDVLQKFFSYDIERATQLMLTVHYQGKA
CLPS_SALG2      -----------------------------ILVNDDYTPMEFVIDVLQKFFSYDVERATQLMFAVHYQGKA
CLPS_ERWT9      -----------------------------ILNNDDFTPMEFVIDVLQKFFSYDIERATQLMLTVHYQGKA
CLPS_DEIRA      MTRPTIPPGPPGAEGRTQTLERTETKWRVLLLNDDYTPMDYVVQVLEQFFRKTEQEAELIMLAVHHKGQG
CLPS_BURPP      -----------------------------VLLNDDFTPMEFVVMVVQEYFNKDRETATQVMLKVHREGRG
CLPS_BURP8      -----------------------------VLLNDDFTPMEFVVMIVQEYFNKDRETATQIMLKVHREGRG


                         .         .         *         .         .         .         .:140
query           VVSSGEKDKVEGDVKKLHTAGLWATMQQAG
CLPS_CORGL      VVSSGEKDKVEGDVKKLHTAGLWATMQQAG
CLPS_CORGB      VVSSGEKDKVEGDVKKLHTAGLWATMQQAG
CLPS_COREF      VVSSGEKDKVEGDVKKLHVAGLWATMQQAG
CLPS_CORDI      VVSSGERDKVEADVKKLHTAGLWATMQQGG
CLPS_CORA7      AVSSGERDKVEADVKKLQVAGLWATMQQAG
CLPS_CORJK      VVSSGERDKVEGDVKKLQTAGLWATMQRA-
CLPS_RHOOB      VVSSGSRDKVENDVRKLHAAGLWATMQR--
CLPS_RHOSR      VVSSGSRDKVENDVRKLHAAGLWATMQHDG
CLPS_NOCFA      VVSSGSRDKMEHDVRRLHAAGLWATMQR--
CLPS_MYCPA      VVSAGSREAMEVDVSKLHAAGLWATMQQ--
CLPS_MYCA1      VVSAGSREAMEVDVSKLHAAGLWATMQQ--
CLPS_MYCTU      VVSAGSRESMEVDVSKLHAAGLWATMQQ--
CLPS_MYCTA      VVSAGSRESMEVDVSKLHAAGLWATMQQ--
CLPS_MYCMM      VVSAGSREAMEVDVSKLHAAGLWATMQQ--
CLPS_MYCBT      VVSAGSRESMEVDVSKLHAAGLWATMQQ--
CLPS_MYCBP      VVSAGSRESMEVDVSKLHAAGLWATMQQ--
CLPS_MYCBO      VVSAGSRESMEVDVSKLHAAGLWATMQQ--
CLPS_MYCLE      VVSMGSRESMEVDVSKLHAAGLWATMQQ--
CLPS_STRAW      VVSSGTREEMERDVQAMHGYGLWATLQQ--
CLPS_STRCO      VVSSGSREEMERDVQAMHGYGLWATLQQ--
CLPS_PSEMY      VCGVYTRDIAE-------------------
CLPS_HALHL      VCGVYSRDVAENDYAREHEHPLLCTMEEA-
CLPS_XYLFT      VCGFYTREVAESKVSRIHQHPLLCTMKQA-
CLPS_XYLFM      VCGFYTREVAESKVSRIHQHPLLCTMKQA-
CLPS_XYLF2      VCGFYTREVAESKVSRIHQHPLLCTMKQA-
CLPS_PSEPW      VCGLFTRDIAE-------------------
CLPS_PSEPK      VCGLFTRDIAE-------------------
CLPS_PSEPG      VCGLFTRDIAE-------------------
CLPS_PSEP1      VCGLFTRDIAE-------------------
CLPS_PSEAE      VCGLFTRDVAE-------------------
CLPS_PSEAB      VCGLFTRDVAE-------------------
CLPS_PSEA7      VCGLFTRDVAE-------------------
CLPS_METCA      VCGVFSKDVAETKVQQVNAHALLCTMEEA-
CLPS_DESAH      ICGSYTREVAETKVNTVH------------
CLPS_AZOSE      VCGVFPKDVAATKVEQV-------------
CLPS_ALHEH      VCGVFSRDVAENDWSRQHEHPLMCTLKEA-
CLPS_XYLFA      VCGFYTREVAESKVSRIHQHPLLCTMKQA-
CLPS_XANCP      VCGVYSREVAESKVSRMNQHPLLCTMEQA-
CLPS_XANC8      VCGVYSREVAESKVSRMNQHPLLCTMEQA-
CLPS_AZOVD      VCGMFTRDVAE-------------------
CLPS_ACIAC      VCGVYSRDKVEQVREAAHKAG---------
TEX10_CHICK     ------------------------------
CLPS_VIBFM      VCGTFTAEVAETKVAQVNTYSLLCTMEQA-
CLPS_VIBF1      VCGTFTAEVAETKVAQVNTYSLLCTMEQA-
CLPS_SYNE7      LVITCDIEPAEFYCEQLKSHGLSSSIE---
CLPS_EDWI9      V-----------------------------
CLPS_CHRVO      VCGVYTKDVAATKVEQV-------------
CLPS_SHEAM      V-----------------------------
CLPS_PSEF5      VCGLFTRDIAE-------------------
CLPS_BDEBA      V-----------------------------
CLPS_SYNP6      LVITCDIEPAEFYCEQLKSHGL--------
CLPS_SODGM      V-----------------------------
CLPS_KLEP7      I-----------------------------
CLPS_KLEP3      I-----------------------------
CLPS_ENTS8      I-----------------------------
CLPS_BORPE      VCGVYPRD----------------------
CLPS_BORPA      VCGVYPRD----------------------
CLPS_BORBR      VCGVYPRD----------------------
CLPS_MARAV      VCGVYTRDIAE-------------------
CLPS_XANOR      VCGVYSREVAESKVSRMNQHPLLCTMEQA-
CLPS_XANOM      VCGVYSREVAESKVSRMNQHPLLCTMEQA-
CLPS_XANAC      VCGVYSREVAESKVSRMNQHPLLCTMEQA-
CLPS_SHISS      I-----------------------------
CLPS_SHIFL      I-----------------------------
CLPS_SHIF8      I-----------------------------
CLPS_SHIDS      I-----------------------------
CLPS_SHIBS      I-----------------------------
CLPS_SHIB3      I-----------------------------
CLPS_SALTY      I-----------------------------
CLPS_SALTI      I-----------------------------
CLPS_SALSV      I-----------------------------
CLPS_SALPK      I-----------------------------
CLPS_SALPC      I-----------------------------
CLPS_SALPB      I-----------------------------
CLPS_SALPA      I-----------------------------
CLPS_SALNS      I-----------------------------
CLPS_SALHS      I-----------------------------
CLPS_SALEP      I-----------------------------
CLPS_SALDC      I-----------------------------
CLPS_SALCH      I-----------------------------
CLPS_SALAR      I-----------------------------
CLPS_SALA4      I-----------------------------
CLPS_PHOPR      ICGTFTAEVAETKVAQV-------------
CLPS_NITMU      VCGVYPNDVASTKVEQV-------------
CLPS_ESCF3      I-----------------------------
CLPS_ECOUT      I-----------------------------
CLPS_ECOSM      I-----------------------------
CLPS_ECOSE      I-----------------------------
CLPS_ECOLU      I-----------------------------
CLPS_ECOLI      I-----------------------------
CLPS_ECOLC      I-----------------------------
CLPS_ECOL6      I-----------------------------
CLPS_ECOL5      I-----------------------------
CLPS_ECOK1      I-----------------------------
CLPS_ECOHS      I-----------------------------
CLPS_ECODH      I-----------------------------
CLPS_ECOBW      I-----------------------------
CLPS_ECO8A      I-----------------------------
CLPS_ECO81      I-----------------------------
CLPS_ECO7I      I-----------------------------
CLPS_ECO5E      I-----------------------------
CLPS_ECO57      I-----------------------------
CLPS_ECO55      I-----------------------------
CLPS_ECO45      I-----------------------------
CLPS_ECO27      I-----------------------------
CLPS_ECO24      I-----------------------------
CLPS_CITK8      I-----------------------------
CLPS_AZOSB      VCGVFPRDIASTKVEQV-------------
CLPS_YERPY      I-----------------------------
CLPS_YERPS      I-----------------------------
CLPS_YERPP      I-----------------------------
CLPS_YERPN      I-----------------------------
CLPS_YERPG      I-----------------------------
CLPS_YERPE      I-----------------------------
CLPS_YERPB      I-----------------------------
CLPS_YERPA      I-----------------------------
CLPS_YERP3      I-----------------------------
CLPS_YERE8      I-----------------------------
CLPS_BORA1      I-----------------------------
CLPS_SERP5      I-----------------------------
CLPS_SALG2      I-----------------------------
CLPS_ERWT9      I-----------------------------
CLPS_DEIRA      VAGVYTRDVAETKVAQV-------------
CLPS_BURPP      VCGVYTRDKVEQVVTHARQAGLQCVMEEA-
CLPS_BURP8      VCGVYTRDKVEQVVTHARQAGLQCVMEEA-