[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF55454.1

[Show Plain Result]


## Summary of Sequence Search
    1::335
    4::324     6e-59  40%  324 aa  YHDH_ECOLI RecName: Full=Putative quinone oxidoreductase yhdH;     
   29::330     1e-51  38%  330 aa  YHFP_BACSU RecName: Full=Putative quinone oxidoreductase yhfP;     
   23::336     6e-12  29%  339 aa  ADH2_BACST RecName: Full=Alcohol dehydrogenase;         Short=ADH; 
    6::292     4e-11  24%  346 aa  YGD6_SCHPO RecName: Full=Zinc-type alcohol dehydrogenase-like
    6::269     4e-10  26%  334 aa  QOR_YEAST RecName: Full=Probable quinone oxidoreductase;       
   13::202     1e-09  28%  333 aa  ZDH1_STAAC RecName: Full=Zinc-type alcohol dehydrogenase-like
   13::202     2e-09  28%  335 aa  ZDH1_STAAW RecName: Full=Zinc-type alcohol dehydrogenase-like
   13::202     2e-09  28%  335 aa  ZDH1_STAAS RecName: Full=Zinc-type alcohol dehydrogenase-like
   13::202     3e-09  28%  335 aa  ZDH1_STAAR RecName: Full=Zinc-type alcohol dehydrogenase-like
   13::202     6e-09  28%  335 aa  ZDH1_STAAN RecName: Full=Zinc-type alcohol dehydrogenase-like
   13::202     6e-09  28%  335 aa  ZDH1_STAAM RecName: Full=Zinc-type alcohol dehydrogenase-like
   30::303     4e-08  26%  375 aa  CADH3_ARATH RecName: Full=Cinnamyl alcohol dehydrogenase 3;        
   54::300     1e-07  23%  365 aa  QORL2_NEMVE RecName: Full=Quinone oxidoreductase-like protein 2
   33::344     3e-07  24%  348 aa  ADH1_KLUMA RecName: Full=Alcohol dehydrogenase 1;       
   23::217     7e-07  28%  361 aa  TDH_ERWCT RecName: Full=L-threonine 3-dehydrogenase;       
   30::304     9e-07  26%  376 aa  CADH2_ARATH RecName: Full=Cinnamyl alcohol dehydrogenase 2;        
  116::294     2e-06  26%  396 aa  RT4I1_BOVIN RecName: Full=Reticulon-4-interacting protein 1,
   25::304     2e-06  29%  346 aa  MECR2_CAEEL RecName: Full=Probable trans-2-enoyl-CoA reductase 2,
   37::345     2e-06  26%  347 aa  YBI2_SCHPO RecName: Full=Zinc-type alcohol dehydrogenase-like
   23::216     2e-06  27%  341 aa  TDH_PSEHT RecName: Full=L-threonine 3-dehydrogenase;       
   95::294     2e-06  30%  396 aa  RT4I1_MOUSE RecName: Full=Reticulon-4-interacting protein 1,
 1826::1989    3e-06  30% 2542 aa  PKS41_DICDI RecName: Full=Probable polyketide synthase 41;       
   23::267     3e-06  26%  341 aa  TDH_SHESM RecName: Full=L-threonine 3-dehydrogenase;       
   23::267     3e-06  26%  341 aa  TDH_SHESA RecName: Full=L-threonine 3-dehydrogenase;       
 1830::1993    3e-06  30% 2552 aa  PKS40_DICDI RecName: Full=Probable polyketide synthase 40;       
   23::222     5e-06  28%  341 aa  TDH_SHESH RecName: Full=L-threonine 3-dehydrogenase;       
  104::326     6e-06  23%  329 aa  YOGA_BACSU RecName: Full=Uncharacterized zinc-type alcohol
   23::267     6e-06  26%  341 aa  TDH_SHESW RecName: Full=L-threonine 3-dehydrogenase;       
   23::267     6e-06  26%  341 aa  TDH_SHEON RecName: Full=L-threonine 3-dehydrogenase;       
   23::267     8e-06  26%  341 aa  TDH_SHESR RecName: Full=L-threonine 3-dehydrogenase;       
   23::267     8e-06  26%  341 aa  TDH_SHEB9 RecName: Full=L-threonine 3-dehydrogenase;       
   23::267     8e-06  26%  341 aa  TDH_SHEB5 RecName: Full=L-threonine 3-dehydrogenase;       
   23::267     8e-06  26%  341 aa  TDH_SHEB2 RecName: Full=L-threonine 3-dehydrogenase;       
  116::281     8e-06  26%  396 aa  RT4I1_HUMAN RecName: Full=Reticulon-4-interacting protein 1,
   96::261     1e-05  29%  484 aa  VAT1_DANRE RecName: Full=Synaptic vesicle membrane protein VAT-1
   23::286     1e-05  26%  341 aa  TDH_SHEWM RecName: Full=L-threonine 3-dehydrogenase;       
   23::267     1e-05  26%  341 aa  TDH_SHEB8 RecName: Full=L-threonine 3-dehydrogenase;       
   23::219     1e-05  27%  342 aa  TDH_BURVG RecName: Full=L-threonine 3-dehydrogenase;       
   23::219     1e-05  27%  342 aa  TDH_BURS3 RecName: Full=L-threonine 3-dehydrogenase;       
   23::219     1e-05  27%  342 aa  TDH_BURM1 RecName: Full=L-threonine 3-dehydrogenase;       
   23::219     1e-05  27%  342 aa  TDH_BURCJ RecName: Full=L-threonine 3-dehydrogenase;       
   23::219     1e-05  27%  342 aa  TDH_BURCH RecName: Full=L-threonine 3-dehydrogenase;       
   23::219     1e-05  27%  342 aa  TDH_BURCC RecName: Full=L-threonine 3-dehydrogenase;       
   23::219     1e-05  27%  342 aa  TDH_BURCA RecName: Full=L-threonine 3-dehydrogenase;       
  166::349     1e-05  25%  353 aa  ADH1_NEUCR RecName: Full=Alcohol dehydrogenase 1;       
   18::219     1e-05  27%  343 aa  TDH_VIBPA RecName: Full=L-threonine 3-dehydrogenase;       
  102::357     1e-05  24%  387 aa  RT4I1_DANRE RecName: Full=Reticulon-4-interacting protein 1
   23::267     2e-05  26%  341 aa  TDH_SHEPC RecName: Full=L-threonine 3-dehydrogenase;       
   23::214     2e-05  27%  343 aa  TDH_BURPS RecName: Full=L-threonine 3-dehydrogenase;       
   23::214     2e-05  27%  343 aa  TDH_BURP6 RecName: Full=L-threonine 3-dehydrogenase;       
   23::214     2e-05  27%  343 aa  TDH_BURP1 RecName: Full=L-threonine 3-dehydrogenase;       
   23::214     2e-05  27%  343 aa  TDH_BURP0 RecName: Full=L-threonine 3-dehydrogenase;       
   23::214     2e-05  27%  343 aa  TDH_BURMS RecName: Full=L-threonine 3-dehydrogenase;       
   23::214     2e-05  27%  343 aa  TDH_BURMA RecName: Full=L-threonine 3-dehydrogenase;       
   23::214     2e-05  27%  343 aa  TDH_BURM9 RecName: Full=L-threonine 3-dehydrogenase;       
   23::214     2e-05  27%  343 aa  TDH_BURM7 RecName: Full=L-threonine 3-dehydrogenase;       
   36::332     2e-05  25%  351 aa  ADH5_YEAST RecName: Full=Alcohol dehydrogenase 5;       
   36::332     2e-05  25%  351 aa  ADH5_SACPS RecName: Full=Alcohol dehydrogenase 5;       
   23::214     3e-05  27%  342 aa  TDH_BURCM RecName: Full=L-threonine 3-dehydrogenase;       
   23::214     3e-05  27%  342 aa  TDH_BURA4 RecName: Full=L-threonine 3-dehydrogenase;       
  181::301     3e-05  32%  376 aa  ETR1_YARLI RecName: Full=Probable trans-2-enoyl-CoA reductase,
   27::221     4e-05  27%  344 aa  TDH_RHILO RecName: Full=L-threonine 3-dehydrogenase;       
   23::214     4e-05  27%  342 aa  TDH_AERS4 RecName: Full=L-threonine 3-dehydrogenase;       
   23::267     5e-05  26%  341 aa  TDH_SHEFN RecName: Full=L-threonine 3-dehydrogenase;       
   27::221     5e-05  28%  345 aa  TDH_RHIL3 RecName: Full=L-threonine 3-dehydrogenase;       
   23::214     5e-05  26%  343 aa  TDH_BURXL RecName: Full=L-threonine 3-dehydrogenase;       
   23::214     5e-05  26%  343 aa  TDH_BURTA RecName: Full=L-threonine 3-dehydrogenase;       
   23::214     5e-05  26%  343 aa  TDH_BURPP RecName: Full=L-threonine 3-dehydrogenase;       
   23::214     5e-05  26%  342 aa  TDH_BURP8 RecName: Full=L-threonine 3-dehydrogenase;       
   12::226     5e-05  26%  340 aa  QOR_LEIAM RecName: Full=Probable quinone oxidoreductase;       
   18::337     7e-05  25%  343 aa  TDH_VIBVY RecName: Full=L-threonine 3-dehydrogenase;       
   27::221     7e-05  27%  344 aa  TDH_RHIME RecName: Full=L-threonine 3-dehydrogenase;       
  109::221     7e-05  28%  340 aa  TDH_PSEA6 RecName: Full=L-threonine 3-dehydrogenase;       
   16::221     7e-05  26%  341 aa  TDH_COLP3 RecName: Full=L-threonine 3-dehydrogenase;       
   35::202     7e-05  25%  330 aa  QOR_LAMGU RecName: Full=Quinone oxidoreductase;       
    7::255     7e-05  25%  332 aa  QORX_HUMAN RecName: Full=Quinone oxidoreductase PIG3;       
   32::207     9e-05  25%  336 aa  ZDH1_STAES RecName: Full=Zinc-type alcohol dehydrogenase-like
   23::214     9e-05  26%  341 aa  TDH_YERPY RecName: Full=L-threonine 3-dehydrogenase;       
   23::214     9e-05  26%  341 aa  TDH_YERPS RecName: Full=L-threonine 3-dehydrogenase;       
   23::214     9e-05  26%  341 aa  TDH_YERPB RecName: Full=L-threonine 3-dehydrogenase;       
   23::214     9e-05  26%  341 aa  TDH_YERP3 RecName: Full=L-threonine 3-dehydrogenase;       
   23::214     9e-05  26%  341 aa  TDH_YERE8 RecName: Full=L-threonine 3-dehydrogenase;       
   23::214     9e-05  27%  342 aa  TDH_AERHH RecName: Full=L-threonine 3-dehydrogenase;       
   44::294     9e-05  24%  377 aa  MECR_DANRE RecName: Full=Trans-2-enoyl-CoA reductase,
  174::344     9e-05  23%  348 aa  ADH2_KLULA RecName: Full=Alcohol dehydrogenase 2;       
   18::337     1e-04  25%  343 aa  TDH_VIBVU RecName: Full=L-threonine 3-dehydrogenase;       
   23::338     1e-04  25%  341 aa  TDH_SERP5 RecName: Full=L-threonine 3-dehydrogenase;       
   27::221     1e-04  27%  345 aa  TDH_RHIEC RecName: Full=L-threonine 3-dehydrogenase;       
   27::221     1e-04  27%  345 aa  TDH_RHIE6 RecName: Full=L-threonine 3-dehydrogenase;       
   23::214     1e-04  28%  341 aa  TDH_PHOLL RecName: Full=L-threonine 3-dehydrogenase;       
 1687::1848    1e-04  31% 2380 aa  PKS25_DICDI RecName: Full=Probable polyketide synthase 25;       
  113::334     1e-04  24%  339 aa  ADH3_BACST RecName: Full=Alcohol dehydrogenase;       
   35::204     2e-04  23%  329 aa  QOR_PIG RecName: Full=Quinone oxidoreductase;       
   38::204     2e-04  23%  329 aa  QOR_HUMAN RecName: Full=Quinone oxidoreductase;       
   32::207     2e-04  24%  336 aa  ZDH1_STAEQ RecName: Full=Zinc-type alcohol dehydrogenase-like
   23::214     3e-04  26%  341 aa  TDH_YERPP RecName: Full=L-threonine 3-dehydrogenase;       
   23::214     3e-04  26%  341 aa  TDH_YERPN RecName: Full=L-threonine 3-dehydrogenase;       
   23::214     3e-04  26%  341 aa  TDH_YERPG RecName: Full=L-threonine 3-dehydrogenase;       
   23::214     3e-04  26%  341 aa  TDH_YERPE RecName: Full=L-threonine 3-dehydrogenase;       
   23::214     3e-04  26%  341 aa  TDH_YERPA RecName: Full=L-threonine 3-dehydrogenase;       
   27::218     3e-04  28%  345 aa  TDH_RHILW RecName: Full=L-threonine 3-dehydrogenase;       
   38::247     3e-04  22%  329 aa  QOR_CAVPO RecName: Full=Quinone oxidoreductase;       
  113::336     3e-04  21%  337 aa  ADH1_BACST RecName: Full=Alcohol dehydrogenase;       
  138::244     4e-04  31%  327 aa  QOR_SALTY RecName: Full=Quinone oxidoreductase;       
   38::202     4e-04  23%  330 aa  QOR_BOVIN RecName: Full=Zeta-crystallin;
    2::67      6e-04  38%  337 aa  YBJS_ECOLI RecName: Full=Uncharacterized protein ybjS;
  109::217     6e-04  27%  341 aa  TDH_SHEPA RecName: Full=L-threonine 3-dehydrogenase;       
  109::217     6e-04  27%  341 aa  TDH_SHELP RecName: Full=L-threonine 3-dehydrogenase;       
  109::217     6e-04  27%  341 aa  TDH_SHEHH RecName: Full=L-threonine 3-dehydrogenase;       
   27::221     6e-04  26%  344 aa  TDH_MESSB RecName: Full=L-threonine 3-dehydrogenase;       
  105::323     6e-04  30%  386 aa  QORL_ARATH RecName: Full=Quinone oxidoreductase-like protein
  109::217     7e-04  27%  341 aa  TDH_SHEAM RecName: Full=L-threonine 3-dehydrogenase;       
  109::214     7e-04  28%  341 aa  TDH_ALTMD RecName: Full=L-threonine 3-dehydrogenase;       
  111::337     0.001  25%  343 aa  TDH_PHOPR RecName: Full=L-threonine 3-dehydrogenase;       
  109::216     0.001  26%  341 aa  TDH_CHRVO RecName: Full=L-threonine 3-dehydrogenase;       
   78::244     0.001  28%  325 aa  QOR_PSEAE RecName: Full=Quinone oxidoreductase;       
  159::205     0.001  40%  329 aa  QORH_ARATH RecName: Full=Putative quinone-oxidoreductase homolog,
    2::86      0.001  29%  310 aa  HLDD_ENTS8 RecName: Full=ADP-L-glycero-D-manno-heptose-6-epimerase;
    1::335

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxPINSVVLTQDEDGNFSTAYQDTYSDPSFLGEGDVLIEVGWSSLNYKDAMALKGDKGVVRTVPLIP
YHDH_ECOLI      ----------LLLEQQDGKTLASVQTL--DESRLPEGDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIP
YHFP_BACSU      ---------------------------------LPKDGVLIKVAYSGINYKDGLAGKAGGNIVREYPLIL
ADH2_BACST      ---------------------------------LEEGEVLVKIEACGVCHTDLHAAHGDWPIKPKLPLIP
YGD6_SCHPO      -----------VVHDEISGFDQLKPEEYEVPQKLNPGEVLVKLKAASLNYRDLIITKGXXXXXXXXXXXX
QOR_YEAST       -----PEQQKVILIDEIGGYDVIKYEDYPVPS-ISEEELLIKNKYTGVNYIESYFRKGIYPCEK--PYVL
ZDH1_STAAC      ---------------EEGNLFKVYEQRKPTPE---NDDILVKVNSISVNPVDT---KQRQMEVTQAPRVL
ZDH1_STAAW      ---------------EEGNLFKVYEQRKPTPE---NDDILVKVNSISVNPVDT---KQRQMEVTQAPRVL
ZDH1_STAAS      ---------------EEGNLFKVYEQRKPTPE---NDDILVKVNSISVNPVDT---KQRQMEVTQAPRVL
ZDH1_STAAR      ---------------EEGNLFKVYEQRKPTPE---NDDILVKVNSISVNPVDT---KQRQMEVTQAPRVL
ZDH1_STAAN      ---------------EEGNLFKVYEQRKPTPE---NDDILVKVNSISVNPVDT---KQRQMKVTQAPRVL
ZDH1_STAAM      ---------------EEGNLFKVYEQRKPTPE---NDDILVKVNSISVNPVDT---KQRQMKVTQAPRVL
CADH3_ARATH     ----------------------------------GENDVTVKILFCGVCHSDLHTIKNHWGFSR-YPIIP
QORL2_NEMVE     ------------------------EDKFSTEN-LGTSQVRVAVHSCGINFADILKCIGKYQEKPELPFVP
ADH1_KLUMA      -------------------------------------ELLINVKYSGVCHTDLHAWQGDWPLDTKLPLVG
TDH_ERWCT       ---------------------------------LGHNDIMIKIRKSAICGTDVHIYNWDEWSQKTVPMVV
CADH2_ARATH     ----------------------------------GENDVTVKILFCGVCHSDLHTIKNHWGFSR-YPIIP
RT4I1_BOVIN     ------------------------------------------------------------------PLTL
MECR2_CAEEL     -------------------------ETVEVPAEPGSGECLVEWLASPINPLDINRIQGNYAVRAELPVIG
YBI2_SCHPO      -----------------------------NPAELGPYDVLVEVVATSINPLDYKLMNTYQMIAKALPNIP
TDH_PSEHT       ---------------------------------VGHNDLLIKIRKTAICGTDVHIYKWDEWAQKTIPMVV
RT4I1_MOUSE     -------------------------------------------GATALNMKDPLHMK-TKG--EEFPLTL
PKS41_DICDI     -----------------------YKVKVKPTSILKENEVEIKVMSTGLNYKDYLIYAG---LVESVEPIF
TDH_SHESM       ---------------------------------MGHNDLLIKIKKTAICGTDMHIYNWDEWSQKTVPMVV
TDH_SHESA       ---------------------------------MGHNDLLIKIKKTAICGTDMHIYNWDEWSQKTVPMVV
PKS40_DICDI     -----------------------YKVKVKPTSILKENEVEIKVMSTGLNYKDYLIYAG---LVESVEPIF
TDH_SHESH       ---------------------------------MGHNDLLIKIRKTAICGTDIHIYNWDEWSQKTVPMVV
YOGA_BACSU      ----------------------------------------------------------------------
TDH_SHESW       ---------------------------------MGHNDLLIKIKKTAICGTDMHIYNWDEWSQKTVPMVV
TDH_SHEON       ---------------------------------MGHNDLLIKIKKTAICGTDMHIYNWDEWSQKTVPMVV
TDH_SHESR       ---------------------------------MGHNDLLIKIKKTAICGTDMHIYNWDEWSQKTVPMVV
TDH_SHEB9       ---------------------------------MGHNDLLIKIKKTAICGTDMHIYNWDEWSQKTVPMVV
TDH_SHEB5       ---------------------------------MGHNDLLIKIKKTAICGTDMHIYNWDEWSQKTVPMVV
TDH_SHEB2       ---------------------------------MGHNDLLIKIKKTAICGTDMHIYNWDEWSQKTVPMVV
RT4I1_HUMAN     ------------------------------------------------------------------PLTL
VAT1_DANRE      ---------------------------------LKSGEVMVRVKMCGLNFADLMARQGLYDRLPSPPVTP
TDH_SHEWM       ---------------------------------MGHNDLLIKIRKTAICGTDVHIYNWDEWSQNTVPMVV
TDH_SHEB8       ---------------------------------MGHNDLLIKIKKTAICGTDMHIYNWDEWSQKTVPMVV
TDH_BURVG       ---------------------------------VGHNDVLIKIRRTAICGTDIHIWKWDDWAQKTVPMHV
TDH_BURS3       ---------------------------------VGHNDVLIKIRRTAICGTDIHIWKWDDWAQKTVPMHV
TDH_BURM1       ---------------------------------VGHNDVLIKIRRTAICGTDIHIWKWDDWAQKTVPMHV
TDH_BURCJ       ---------------------------------VGHNDVLIKIRRTAICGTDIHIWKWDDWAQKTVPMHV
TDH_BURCH       ---------------------------------VGHNDVLIKIRRTAICGTDIHIWKWDDWAQKTVPMHV
TDH_BURCC       ---------------------------------VGHNDVLIKIRRTAICGTDIHIWKWDDWAQKTVPMHV
TDH_BURCA       ---------------------------------VGHNDVLIKIRRTAICGTDIHIWKWDDWAQKTVPMHV
ADH1_NEUCR      ----------------------------------------------------------------------
TDH_VIBPA       --------------------------TEVDKPEVGHNDILIKIKKTAICGTDVHIYNWDEWSQKTVPMVV
RT4I1_DANRE     ------------------------------------------------------------------PLIL
TDH_SHEPC       ---------------------------------MGHNDLLIKIKKTAICGTDMHIYNWDEWSQKTVPMVV
TDH_BURPS       ---------------------------------VGHNDVLIKIRRTAICGTDIHIWKWDDWAQKTVPMHV
TDH_BURP6       ---------------------------------VGHNDVLIKIRRTAICGTDIHIWKWDDWAQKTVPMHV
TDH_BURP1       ---------------------------------VGHNDVLIKIRRTAICGTDIHIWKWDDWAQKTVPMHV
TDH_BURP0       ---------------------------------VGHNDVLIKIRRTAICGTDIHIWKWDDWAQKTVPMHV
TDH_BURMS       ---------------------------------VGHNDVLIKIRRTAICGTDIHIWKWDDWAQKTVPMHV
TDH_BURMA       ---------------------------------VGHNDVLIKIRRTAICGTDIHIWKWDDWAQKTVPMHV
TDH_BURM9       ---------------------------------VGHNDVLIKIRRTAICGTDIHIWKWDDWAQKTVPMHV
TDH_BURM7       ---------------------------------VGHNDVLIKIRRTAICGTDIHIWKWDDWAQKTVPMHV
ADH5_YEAST      -------------------------------------EILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIG
ADH5_SACPS      -------------------------------------EILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIG
TDH_BURCM       ---------------------------------VGHNDVLIKIHRTAICGTDIHIWKWDDWAQKTVPMHV
TDH_BURA4       ---------------------------------VGHNDVLIKIHRTAICGTDIHIWKWDDWAQKTVPMHV
ETR1_YARLI      ----------------------------------------------------------------------
TDH_RHILO       ---------------------------------IGPNDVLIKIRKTAICGTDVHIYNWDQWAQKTVPMVT
TDH_AERS4       ---------------------------------LGHNDLLIKIRKTAICGTDMHIYNWDEWAQKTVPMVV
TDH_SHEFN       ---------------------------------MGHNDLLIKIRKTAICGTDVHIYNWDEWSQKTVPMIA
TDH_RHIL3       ---------------------------------VGPNDVLIRVKKSAICGTDVHIWNWDQWAQKTVPMVV
TDH_BURXL       ---------------------------------VGHNDVMIRITRTAICGTDIHIWKWDDWAQKTVPMHV
TDH_BURTA       ---------------------------------VGHNDVLIKIRRTAICGTDIHIWKWDDWAQKTVPMHV
TDH_BURPP       ---------------------------------VGHNDVMIRITRTAICGTDIHIWKWDDWAQKTVPMHV
TDH_BURP8       ---------------------------------VGHNDVMIRITRTAICGTDIHIWKWDDWAQKTVPMHV
QOR_LEIAM       ----------VVSLSKDFRSSTSVVEAHL-PEEVPEGMVRVSVKYAGVNASDLNFTNGSYFKNVQPPFDC
TDH_VIBVY       --------------------------TEVDKPVLGHNDLLIKIKKTAICGTDVHIYNWDEWSQKTIPVVR
TDH_RHIME       ---------------------------------IGPNDVLIRVRKSAICGTDVHIWNWDQWAEKTVPMVV
TDH_PSEA6       ----------------------------------------------------------------------
TDH_COLP3       --------------------------TRTEKPKLGHNDLLIKIKKTAICGTDIHIYNWDEWAQKTVPMVV
QOR_LAMGU       -----------------------------------EHQVLIKVQACGVNPVDTYIRSGTYSRKPRLPYTP
QORX_HUMAN      --------------DKPGGPENLYVKEVAKPS-PGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNIL
ZDH1_STAES      -------------------------------------ELLVKVQSISVNPVDT---KQRTMPVDKVPRVL
TDH_YERPY       ---------------------------------LGHNDIMIKIRKTAICGTDVHIYNWDEWSQKTVPMVV
TDH_YERPS       ---------------------------------LGHNDIMIKIRKTAICGTDVHIYNWDEWSQKTVPMVV
TDH_YERPB       ---------------------------------LGHNDIMIKIRKTAICGTDVHIYNWDEWSQKTVPMVV
TDH_YERP3       ---------------------------------LGHNDIMIKIRKTAICGTDVHIYNWDEWSQKTVPMVV
TDH_YERE8       ---------------------------------LGHNDIMIKIRKTAICGTDVHIYNWDEWSQKTVPMVV
TDH_AERHH       ---------------------------------LGHNDLLIKIRKTAICGTDIHIYNWDEWSQKTVPMVV
MECR_DANRE      -------NCTALLYRNHGEPSQVVQLESLDLPQVGAECVLVKMLAAPINPSDLNMLQGTYAILPELPAVG
ADH2_KLULA      ----------------------------------------------------------------------
TDH_VIBVU       --------------------------TEVDKPVLGHNDLLIKIKKTAICGTDVHIYNWDEWSQKTIPVVR
TDH_SERP5       ---------------------------------LGHNDIMIKIRKTAICGTDVHIYNWDEWSQKTVPMVV
TDH_RHIEC       ---------------------------------VGPNDVLIRVKKSAICGTDVHIWNWDQWAQKTVPMVV
TDH_RHIE6       ---------------------------------VGPNDVLIRVKKSAICGTDVHIWNWDQWAQKTVPMVV
TDH_PHOLL       ---------------------------------LGHNDVMIKIRKTAICGTDVHIYNWDDWSQKTVPMVV
PKS25_DICDI     ----------------------------SKDSILKPYDIEVEIKATGLNYKDYLVLKGDS-------VDF
ADH3_BACST      ----------------------------------------------------------------------
QOR_PIG         -----------------------------------DNQVLIKVHACGVNPVDTYIRSGTHNMKPLLPYTP
QOR_HUMAN       --------------------------------------VLIKVHACGVNPVETYIRSGTYSRKPLLPYTP
ZDH1_STAEQ      -------------------------------------ELLVKVQSISVNPVDT---KQRTMPVDKAPRVL
TDH_YERPP       ---------------------------------LGHNDIMIKIRKTAICGTDVHIYNWDEWSQKTVPMVV
TDH_YERPN       ---------------------------------LGHNDIMIKIRKTAICGTDVHIYNWDEWSQKTVPMVV
TDH_YERPG       ---------------------------------LGHNDIMIKIRKTAICGTDVHIYNWDEWSQKTVPMVV
TDH_YERPE       ---------------------------------LGHNDIMIKIRKTAICGTDVHIYNWDEWSQKTVPMVV
TDH_YERPA       ---------------------------------LGHNDIMIKIRKTAICGTDVHIYNWDEWSQKTVPMVV
TDH_RHILW       ---------------------------------VGPNDVLIRVRKSAICGTDVHIWNWDQWAQKTVPMVV
QOR_CAVPO       --------------------------------------VLIKVHACGINPVETYIRSGTYTRIPLLPYTP
ADH1_BACST      ----------------------------------------------------------------------
QOR_SALTY       ----------------------------------------------------------------------
QOR_BOVIN       --------------------------------------VLIKVQACGVNPVDTYIRSGTHNIKPLLPYTP
YBJS_ECOLI      ----------------------------------------------------------------------
TDH_SHEPA       ----------------------------------------------------------------------
TDH_SHELP       ----------------------------------------------------------------------
TDH_SHEHH       ----------------------------------------------------------------------
TDH_MESSB       ---------------------------------IGPNDVLIKVRKAAICGTDVHIWNWDEWARKTVPLVT
QORL_ARATH      -----------------------------------EDQVLIKVVAAALNPVDAKRRQGKKATDSPLPTVP
TDH_SHEAM       ----------------------------------------------------------------------
TDH_ALTMD       ----------------------------------------------------------------------
TDH_PHOPR       ----------------------------------------------------------------------
TDH_CHRVO       ----------------------------------------------------------------------
QOR_PSEAE       ----------------------------------------------------------------------
QORH_ARATH      ----------------------------------------------------------------------
HLDD_ENTS8      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GIDVVGTVIESADPRFGRGDEVVLNGAGLGENRHGGFTQRLKVPSEPLLHIPFNFSAQQVXXXXXXXXXX
YHDH_ECOLI      GIDFAGTVRTSEDPRFHAGQEVLLTGWGVGENHWGGLAEQARVKGDWLVAMPQGLDARKAMIIGTAGFTA
YHFP_BACSU      GIDAAGTVVSSNDPRFAEGDEVIATSYELGVSRDGGLSEYASVPGDWLVPLPQNLSLKEAMVYGTAGFTA
ADH2_BACST      GHEGVGIVVEVAKDRVGTGQETLLNG---GYSVDGGYAEYCKAPADYVAKIPDNLDPVEVAPILCAGVT-
YGD6_SCHPO      GSDGAGIIEKVGEEGFEKGDSVVCNHSALGGTRDGCFQKYAVLPAHALVHAPKNLSFEEIATLPCAAVTA
QOR_YEAST       GREASGTVVAKGKTNFEVGDQVAYIS-------NSTFAQYSKISSQPVMKLPKGTSDEELKLYAAGLLQV
ZDH1_STAAC      GFDAIGTV-EAIGPDFSPGDVVFYAGS---PNRQGSNATYQLVSEAIVAKAPHNISANEAVSLPLTGITA
ZDH1_STAAW      GFDAIGTV-EAIGPDFSPGDVVFYAGS---PNRQGSNATYQLVSEAIVAKAPHNISANEAVSLPLTGITA
ZDH1_STAAS      GFDAIGTV-EAIGPDFSPGDVVFYAGS---PNRQGSNATYQLVSEAIVAKAPHNISANEAVSLPLTGITA
ZDH1_STAAR      GFDAIGTV-EAIGPNFSPGDVVFYAGS---PNRQGSNATYQLVSEAIVAKAPHNISANEAVSLPLTGITA
ZDH1_STAAN      GFDAIGTV-EAIGPDFSPGDVVFYAGS---PNRQGSNATYQLVSEAIVAKAPHNISANEAVSLPLTGITA
ZDH1_STAAM      GFDAIGTV-EAIGPDFSPGDVVFYAGS---PNRQGSNATYQLVSEAIVAKAPHNISANEAVSLPLTGITA
CADH3_ARATH     GHEIVGTKVGKNVTKFKEGDRV---GVGVGTRNQGGYSDVIVVDHRFVLSIPDGLPSDS---GAPLLCAG
QORL2_NEMVE     GTEISGEVVESKVTSLSKGDR-VLGVCGQG----GGMAEECVLPQTALWKIPSSLSFTQAAALAISYGTA
ADH1_KLUMA      GHEGAGIVVAMGENVTGWGDYAGLNGSCMGYTHDGSFQQYATADAVQAARIPKNVDLAEVAPILCAGVTV
TDH_ERWCT       GHEYVGEIVAIGQEGFHIGDRVCRNAIGVGVNRPGSFAEYLVIPAYNAFRIPDNISDE----LAAIFDPF
CADH2_ARATH     GHEIVGTKVGKNVTKFKEGDRVVIIGSGTSRNQ-GGYSDVIVVDHRFVLSIPDGLPSDS---GAPLLCAG
RT4I1_BOVIN     GRDVSGVVMECGDVRYFKGDEV---WAAVPPWKQGTLSEFVVVSGNEVSHKPRSLTHTQAASLPYVALTA
MECR2_CAEEL     GSEGVGRVVKASGSRFKSGDHVTIFSANTPI-----WTEFGVVDDDELVRIPLDLAATLMINPPTAWIML
YBI2_SCHPO      GYDFAGRVLASEVKEFSATQRVWGCQSFPRAGRQGGSATHIVTGDKDVWHLPDGVSFNE---GAGFGIAG
TDH_PSEHT       GHEYVGEVVDMGQEGFKVGDRVCRNTTGVGVNREGAFAEYLVIPAFNAFKIPDNISDE----LASIFDPF
RT4I1_MOUSE     GRDVSGVVMECGDVKFQPGDEV---WAAVPPWKQGTLSEFVVVSGNEVSHKPKSLTHTQAASLPYVALTA
PKS41_DICDI     GIEFSGIIISTGSKEFKVGDHVY----GIGKSTT---SSHIITDIDVISHKPSNISHSEASSIPVVYLT-
TDH_SHESM       GHEYVGEVVDIGQEGFKIGDRVCRNTSGVGVNREGSFAEYLVIPAFNAFKIPDDIS----DDLASIFDPF
TDH_SHESA       GHEYVGEVVDIGQEGFKIGDRVCRNTSGVGVNREGSFAEYLVIPAFNAFKIPDDIS----DDLASIFDPF
PKS40_DICDI     GIEFSGIIIGSGNKEFKVGDSVY----GTGKSTT---SSHIITDIDVISHKPSNISHSEASSIPVVYLT-
TDH_SHESH       GHEYVGEVIDMGIEGFDVGDRVCRNTSGVGVNRDGAFAEYLVIPAFNAFKIPDDIS----DDLASIFDPF
YOGA_BACSU      ----------------------------LGGPSDGTLAEYVIIPSQNAIKKPAYLSWEEAGVLPLSALT-
TDH_SHESW       GHEYVGEVVDIGQEGFNIGDRVCRNTSGVGVNREGSFAEYLVIPAFNAFKIPDDIS----DDLASIFDPF
TDH_SHEON       GHEYVGEVVDIGQEGFNIGDRVCRNTSGVGVNREGSFAEYLVIPAFNAFKIPDDIS----DDLASIFDPF
TDH_SHESR       GHEYVGEVVDIGQEGFKIGDRVCRNTSGVGVNREGSFAEYLVIPAFNAFKIPDDIS----DDLASIFDPF
TDH_SHEB9       GHEYVGEVVDIGQEGFKIGDRVCRNTSGVGVNREGSFAEYLVIPAFNAFKIPDDIS----DDLASIFDPF
TDH_SHEB5       GHEYVGEVVDIGQEGFKIGDRVCRNTSGVGVNREGSFAEYLVIPAFNAFKIPDDIS----DDLASIFDPF
TDH_SHEB2       GHEYVGEVVDIGQEGFKIGDRVCRNTSGVGVNREGSFAEYLVIPAFNAFKIPDDIS----DDLASIFDPF
RT4I1_HUMAN     GRDVSGVVMECGDVKYFKGDEV---WAAVPPWKQGTLSEFVVVSGNEVSHKPKSLTHTQAASLPYVALTA
VAT1_DANRE      GMECSG-VIEAV------GEEVTDRKVGLVLNRSGMWQEVVVVASTHTFLMPEGMSFEEA---AALPVNY
TDH_SHEWM       GHEYVGEVVDIGQEGFSIGDRVCRNTSGVGVNRDGAFAEYLVIPAFNAFKIPDDIS----DDLASIFDPF
TDH_SHEB8       GHEYVGEVVDIGQEGFKIGDRVCRNTSGVGVNREGSFAEYLVIPAFNAFKIPDDIS----DDLASIFDPF
TDH_BURVG       GHEYVGEIVEMGQEGFAIGDRVCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEIS----DDLASIFDPF
TDH_BURS3       GHEYVGEIVEMGQEGFAIGDRVCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEIS----DDLASIFDPF
TDH_BURM1       GHEYVGEIVEMGQEGFAIGDRVCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEIS----DDLASIFDPF
TDH_BURCJ       GHEYVGEIVEMGQEGFAIGDRVCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEIS----DDLASIFDPF
TDH_BURCH       GHEYVGEIVEMGQEGFAIGDRVCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEIS----DDLASIFDPF
TDH_BURCC       GHEYVGEIVEMGQEGFAIGDRVCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEIS----DDLASIFDPF
TDH_BURCA       GHEYVGEIVEMGQEGFAIGDRVCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEIS----DDLASIFDPF
ADH1_NEUCR      ----------------------------------------------------------------------
TDH_VIBPA       GHEYVGEVVEIGDRVSGEGHHLCRNTIGVGVNREGAFAEYLVIPAFNAFKIPDEIS----DDLASIFDPF
RT4I1_DANRE     GRDVSGEIMECGDVKYFKGDQV---WAAIPPWKQGSLAEFVVVSGNEVSHKPKSLRHDEAASIPYVAATA
TDH_SHEPC       GHEYVGEVVDIGQEGFKIGDRVCRNTSGVGVNREGSFAEYLVIPAFNAFKIPDDIS----DDLASIFDPF
TDH_BURPS       GHEYVGEIVEMGQEGFSIGDRVCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEIS----DDLAAIFDPF
TDH_BURP6       GHEYVGEIVEMGQEGFSIGDRVCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEIS----DDLAAIFDPF
TDH_BURP1       GHEYVGEIVEMGQEGFSIGDRVCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEIS----DDLAAIFDPF
TDH_BURP0       GHEYVGEIVEMGQEGFSIGDRVCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEIS----DDLAAIFDPF
TDH_BURMS       GHEYVGEIVEMGQEGFSIGDRVCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEIS----DDLAAIFDPF
TDH_BURMA       GHEYVGEIVEMGQEGFSIGDRVCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEIS----DDLAAIFDPF
TDH_BURM9       GHEYVGEIVEMGQEGFSIGDRVCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEIS----DDLAAIFDPF
TDH_BURM7       GHEYVGEIVEMGQEGFSIGDRVCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEIS----DDLAAIFDPF
ADH5_YEAST      GHEGAGVVVKLGSNVKGWGDFAGLNGTGTGFTHDGTFQEYATADAVQAAHIPPNVNLAEVAPILCAGITV
ADH5_SACPS      GHEGAGVVVKLGSNVKGWGDFAGLNGTGTGFTHDGTFQEYATADAVQAAHIPPNVNLAEVAPILCAGITV
TDH_BURCM       GHEYVGEIVEMGQEGFAIGDRVCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEIS----DDLASIFDPF
TDH_BURA4       GHEYVGEIVEMGQEGFAIGDRVCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEIS----DDLASIFDPF
ETR1_YARLI      ----------------------------------------------------------------------
TDH_RHILO       GHEFVGTVADCRNCRAGRG-HLCRNTLGVGVNRPGAFGEYLAIPQHNVVPIPDDVPDE----IAAIFDPL
TDH_AERS4       GHEYVGEVVAVGQEGFAVGDRVCRNTIGVGVNRPGSFAEYLVIPAFNAFKLPDNIPDE----LAAIFDPF
TDH_SHEFN       GHEYVGEVVDVGQEGFSIGDRVCRNTSGVGVNRDGAFAEYLVLPAFNAFKIP----ADIPDDLAAIFDPF
TDH_RHIL3       GHEFSGEIAESAVTRYHVGERVCRNTLGVGVNRPGSFGEFVCIPESNVVPIPDDISDE----IAAIFDPF
TDH_BURXL       GHEYVGEIVEMGQEGFAIGDRVCRNTVGVGVNREGAFAEYLVIPAFNAFKIPPEIS----DDLAAIFDPF
TDH_BURTA       GHEYVGEIVEMGQEGFSIGDRVCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEIS----DDLAAIFDPF
TDH_BURPP       GHEYVGEIVEMGQEGFAIGDRVCRNTVGVGVNREGAFAEYLVIPAFNAFKIPPEIS----DDLAAIFDPF
TDH_BURP8       GHEYVGEIVEMGQEGFSIGDRVCRNTVGVGVNREGAFAEYLVIPAFNAFKIPPEIS----DDLAAIFDPF
QOR_LEIAM       GFEAAGTVVQ-----IGAGVANVKVGDHVVLMQYGCFAEFLDAPAERCIPVP-----ELKPEYSVLPVSA
TDH_VIBVY       GFEIGDRVITCGHCRNCRGGRTHLNTIGVGVNRTGCFSEYLVIPAFNAFKIPANIS----DDLASIFDPF
TDH_RHIME       GHEFMGEVVEVGPARAGRG-HLCRNTLGVGVNRPGSFAEFVCLPEYNVVSIPDDVPDE----IAAIFDPF
TDH_PSEA6       ------------------------NTSGVGVNRAGAFAEYLSIPAFNAFKIPDNIS----DDLAAIFDPF
TDH_COLP3       GHEYAGEVVGIGQEGFTLGDRVCRNTVGVGVNRAGSFAEYLVIPAYNAFKLPDEIS----DDLASIFDPF
QOR_LAMGU       GLDVAG-LIEAVGERFKKGDRVFTT-----STVSGGYAEYALAADHTVYKLPGELDFQK---GAAIGVPY
QORX_HUMAN      GLEASGHVAELGPGCQGHGDTAMALLPG------GGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTA
ZDH1_STAES      GFDAVGVIEKIGDQMFQEGDVVFYSGS---PNQNGSNEEYQLIEEYLVAKAPTNLKSEQAASLPLTGLTA
TDH_YERPY       GHEYVGEVVAIGQEGFNIGDRVCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDE----LAAIFDPF
TDH_YERPS       GHEYVGEVVAIGQEGFNIGDRVCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDE----LAAIFDPF
TDH_YERPB       GHEYVGEVVAIGQEGFNIGDRVCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDE----LAAIFDPF
TDH_YERP3       GHEYVGEVVAIGQEGFNIGDRVCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDE----LAAIFDPF
TDH_YERE8       GHEYVGEVVAIGQEGFNIGDRVCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDE----LAAIFDPF
TDH_AERHH       GHEYVGEVVAIGQEGFAVGDRVCRNTIGVGVNRPGAFAEYLVIPAFNAFKLPDNVPDE----LAAIFDPF
MECR_DANRE      GNEGVAQVMEVGDKTLKVGDWVIPKDAGIGTWRTAAV-----LKADDLVTLPKDI---PVLSAATLGVNP
ADH2_KLULA      ----------------------------------------------------------------------
TDH_VIBVU       GFEIGDRVITCGHCRNCRGGRTHLNTIGVGVNRTGCFSEYLVIPAFNAFKIPANIS----DDLASIFDPF
TDH_SERP5       GHEYVGEVVAIGQEGFTVGDRVCRNTTGVGVNRPGSFAEYLVIPAFNAFKIPDNISDE----LASIFDPF
TDH_RHIEC       GHEFSGEIAESAVTRYHVGERVCRNTLGVGVNRPGSFGEFVCIPESNVVPIPDDISDE----IAAIFDPF
TDH_RHIE6       GHEFSGEIAESAVTRYHVGERVCRNTLGVGVNRPGSFGEFVCIPESNVVPIPDDISDE----IAAIFDPF
TDH_PHOLL       GHEYVGEVVAIGQEGFKIGDRVCRNTIGVGVNRAGCFAQYLVIPAFNAFKIPDNISDE----LAAIFDPF
PKS25_DICDI     GLDFSGRVSRKSSKEFKVGDEVY----GIGQSTS---SSHIIIDSMHACHKPSKITHVQAASIPAVYAT-
ADH3_BACST      -----------------------------GYSVDGGYAEYCRAAADYVVKIPDNLSFEEAAPIFCAGVT-
QOR_PIG         GLDVAGIVVGEHVSSFKKGDRVF-----TVSTLSGGYAEYALAADDTVYMLPEKLDFKQ---GAAIGIPY
QOR_HUMAN       GSDVAGVIEAVGDSAFKKGDRVFTSST-----ISGGYAEYALAADHTVYKLPEKLDFKQ---GAAIGIPY
ZDH1_STAEQ      GFDAVGVIEKIGDQMFQEGDVVFYSGS---PNQNGSNEEYQLIEEYLVAKAPTNLKSEQAASLPLTGLTA
TDH_YERPP       GHEYVGEVVAIGQEGFNIGDRVCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDE----LAAIFDPF
TDH_YERPN       GHEYVGEVVAIGQEGFNIGDRVCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDE----LAAIFDPF
TDH_YERPG       GHEYVGEVVAIGQEGFNIGDRVCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDE----LAAIFDPF
TDH_YERPE       GHEYVGEVVAIGQEGFNIGDRVCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDE----LAAIFDPF
TDH_YERPA       GHEYVGEVVAIGQEGFNIGDRVCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDE----LAAIFDPF
TDH_RHILW       GHEFSGEIAESAVTRYHVGERVCRNTLGVGVNRPGSFGEFVCIPESNVVAIPEDISDE----IAAIFDPF
QOR_CAVPO       GTDVAGVVIGNDVSAFKKGDRVFTTST-----ISGGYAEYALASDHTVYRLPEKLDFRQ---GAAIGIPY
ADH1_BACST      -----------------------------GYSVDGGYAEYCRAAADYVVKIPDNLSFEEAAPIFCAGVT-
QOR_SALTY       ----------------------------------------------------------------------
QOR_BOVIN       GFDVAGIIVGESVSAFKKGDRVFTT-----RTISGGYAEYALAADHTVYTLPEKLDFKQ---GAAIGIPY
YBJS_ECOLI      ----------------------------------------------------------------------
TDH_SHEPA       ------------------------NTSGVGVNREGAFAEYLVIPAFNAFKIPDDIS----DDLASIFDPF
TDH_SHELP       ------------------------NTSGVGVNREGAFAEYLVIPAFNAFKIPDDIS----DDLASIFDPF
TDH_SHEHH       ------------------------NTSGVGVNREGAFAEYLVIPAFNAFKIPDDIS----DDLASIFDPF
TDH_MESSB       GHEFVGEVVDVGSARAGRG-HLCRNTLGVGVHRPGAFAEYISLPQHNVVAIPDDVPDE----IAAIFDPL
QORL_ARATH      GYXXXXXXXXXXXXXXXEGDEVYANKALEGPKQFGSLAEYTAVEEKLLALKPKNIDFAQAAGLPLAIET-
TDH_SHEAM       ------------------------NTTGVGVNREGSFAEYLVIPAFNAFKIPDDIS----DDLAAIFDPF
TDH_ALTMD       ------------------------NTEGVGVNRPGAFAEYLVIPAFNAFKIPDNIS----DDLASIFDPF
TDH_PHOPR       ------------------------NTTGVGVNRDGAFAEFLVIPAFNAFKIPAGIS----DDLASIFDPF
TDH_CHRVO       ------------------------NTTGVGVNREGAFAEYLVIPAFNAFPIPDDIS----DDLASIFDPF
QOR_PSEAE       --------------RFKVGDRVAYATGPLG-----AYSELHVLAEEKLVHLPDGIDFEQAAAVMLKGL--
QORH_ARATH      ----------------------------------------------------------------------
HLDD_ENTS8      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXSVNALVDQGIKPEDGEILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAEYLTSLGASDIIDRAE
YHDH_ECOLI      MLCVMALEDAGVRPQDGEIXXXXXXXXXXXXXXXLLHKLGYQVVAVSGRESTH-EYLKSLGASRVLPRDE
YHFP_BACSU      ALSVHRLEQNGLSPEKXXXXXXXXXXXXXXXXXXMLNKRGYDVVASTGNREA-ADYLKQLGASEVISRED
ADH2_BACST      --TYKALKVSGARP--GEWVAIYGIGGLGHIALQYAKAMGLNVVAVDISDE-KSKLAKDLGADIAINKED
YGD6_SCHPO      WNGLFGSKEHQVKP--XXXXXXXXXXXXSTFALQFALAAG-ANVTVTSSSDEKLEFAKKLGATHTINYKK
QOR_YEAST       LTALSFTNEAYHVKKGDYVLLFAAAGGVGLILNQLLKMKGAHTIAVASAKEYGAEYLINASKEDILRQVL
ZDH1_STAAC      YETFFDTFKISTNPAENEVLIINGAGGVGSIATQIAKRYGLTVITTASRQET-TEWCEKMGADIVLNHKE
ZDH1_STAAW      YETFFDTFKISHNPAENEVLIINGAGGVGSIATQIAKRYGLTVITTASRQET-TEWCEKMGADIVLNHKE
ZDH1_STAAS      YETFFDTFKISHNPAENEVLIINGAGGVGSIATQIAKRYGLTVITTASRQET-TEWCEKMGADIVLNHKE
ZDH1_STAAR      YETFFDTFKISHNPSENSVLIINGAGGVGSIATQIAKRYGLTVITTASRQET-TEWCEKMGADIVLNHKE
ZDH1_STAAN      YETFFDTFKISHNPSENSVLIINGAGGVGSIATQIAKRYGLTVITTASRQET-TEWCEKMGADIVLNHKE
ZDH1_STAAM      YETFFDTFKISHNPSENSVLIINGAGGVGSIATQIAKRYGLTVITTASRQET-TEWCEKMGADIVLNHKE
CADH3_ARATH     ITVYSPMKYYGMTKESGKRLGVNGLGGLGHIAVKIGKAFGLRVTVISRSSEKEREAIDRLGADSFLVTTD
QORL2_NEMVE     YIGLKHKAN--LQPGQXXXXXXXXXXXXXXXXXXXXNVFGAKVIGAS--RKEKLVIVQEIGATATIDREN
ADH1_KLUMA      Y---KALKSAHIKAGDW-VAISGACGGLGSLAIQYAKAMGYRVLGIDAGDE-KAKLFKELGGEYFIDFTK
TDH_ERWCT       GNAVHTALSFDLVGED--VLITGA-GPIGMMAAAVCRHVGARNVVITDVNAYRLELASKMGATRAVNVAE
CADH2_ARATH     ITVYSPMKYYGMTKESGKRLGVNGLGGLGHIAVKIGKAFGLRVTVISRSSEKEREAIDRLGADSFLVTTD
RT4I1_BOVIN     WSAINKVGGLNDRNCTGKVLILGASGGVGTFAIQVMKAWDAHVTAVCS--QDASELVRKLGADDVIDYKS
MECR2_CAEEL     KKYVNL--------QKGDYIIQNSNSGVGRSVIEMCKALGYKSINIVRNREALKTDLWRIGADHVFTEEE
YBI2_SCHPO      LTAWEVLVRQMKVKPGTKLVIEGASGGVGTFAVALAKALEVTTISST----ENLDLCKSLGATHTLDYKK
TDH_PSEHT       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVAKHVGARHVVISDVNEYRLELARKMGATRAVNVA-
RT4I1_MOUSE     WSAINGLSDKNCKGK--RALILGASGGVGTFAIQVMKAWGAHVTAVCSKDA--SELVRKLGADEVIDYTL
PKS41_DICDI     --SYHSLYNIGALKNNETILIHSATGGVGLSTLEILKWKGHSLIFVTVGSNEKEEYL-------------
TDH_SHESM       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVCRHVGARHVVITDVNEYRLELARKMGATRAVNVAQ
TDH_SHESA       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVCRHVGARHVVITDVNEYRLELARKMGATRAVNVAQ
PKS40_DICDI     --SYHSLYNIGALKNNETILIHSATGGVGLSTLEILKWKGHSLIFVTVGSNEKEEYL-------------
TDH_SHESH       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVCRHVGARHVVITDVNEYRLELANKMGATRAVNVAK
YOGA_BACSU      --AYRALFTKGQLKKGEHLLIPGIGSGVATYALFMAKAIG-ATVSVTSRSEEKRKKALKLGADYAFD--S
TDH_SHESW       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVCRHVGARHVVITDVNEYRLELARKMGATRAVNVSK
TDH_SHEON       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVCRHVGARHVVITDVNEYRLELARKMGATRAVNVAQ
TDH_SHESR       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVCRHVGARHVVITDVNEYRLELARKMGATRAVNVAQ
TDH_SHEB9       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVCRHVGARHVVITDVNEYRLELARKMGATRAVNVSK
TDH_SHEB5       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVCRHVGARHVVITDVNEYRLELARKMGATRAVNVSK
TDH_SHEB2       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVCRHVGARHVVITDVNEYRLELARKMGATRAVNVSK
RT4I1_HUMAN     WSAINKVGGLNDKNCTGKVLILGASGGVGTFAIQVMKAWDAHVTAVCS--QDASELVRKLGADDVIDYKS
VAT1_DANRE      ITAYMMLFDFGHLRPNQSVLVHMAAGGVGIAATQLCKTVNDVTVFGTASASKH-EVISQGGVTHPID---
TDH_SHEWM       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVCRHVGARHVVITDVNEYRLELAQKMGATRAVNVAK
TDH_SHEB8       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVCRHVGARHVVITDVNEYRLELARKMGATRAVNVSK
TDH_BURVG       GNATHTALSFNLVGED--VLITGA-GPIGIMAVAIAKHVGARNVVITDINDYRLELARKMGATRAVNVAR
TDH_BURS3       GNATHTALSFNLVGED--VLITGA-GPIGIMAVAIAKHVGARNVVITDINDYRLELARKMGATRAVNVAR
TDH_BURM1       GNATHTALSFNLVGED--VLITGA-GPIGIMAVAIAKHVGARNVVITDINDYRLELARKMGATRAVNVAR
TDH_BURCJ       GNATHTALSFNLVGED--VLITGA-GPIGIMAVAIAKHVGARNVVITDINDYRLELARKMGATRAVNVAR
TDH_BURCH       GNATHTALSFNLVGED--VLITGA-GPIGIMAVAIAKHVGARNVVITDINDYRLELARKMGATRAVNVAR
TDH_BURCC       GNATHTALSFNLVGED--VLITGA-GPIGIMAVAIAKHVGARNVVITDINDYRLELARKMGATRAVNVAR
TDH_BURCA       GNATHTALSFNLVGED--VLITGA-GPIGIMAVAIAKHVGARNVVITDINDYRLELARKMGATRAVNVAR
ADH1_NEUCR      ------LKESGVRPGQC-VAIVGAGGGLGSMAIQYANAMGLHAIAIDGGEE-KGKNCRELGAQAYVDFTT
TDH_VIBPA       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVAKHVGARHVVITDVNEYRLELARKMGVTRAVNVAE
RT4I1_DANRE     W---SAIVNTGGLNKDNSVLILGGSGGVGTFAIQMVKAWG-AHVTVTCSQNAE-RLVRDLGADDVVDYTA
TDH_SHEPC       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVCRHVGARHVVITDVNEYRLELARKMGATRAVNVSK
TDH_BURPS       GNATHTALSFNLVGED--VLITGA-GPIGVMAVAIAKHVGARNVVITDINDYRLELARKMGATRAVN---
TDH_BURP6       GNATHTALSFNLVGED--VLITGA-GPIGVMAVAIAKHVGARNVVITDINDYRLELARKMGATRAVN---
TDH_BURP1       GNATHTALSFNLVGED--VLITGA-GPIGVMAVAIAKHVGARNVVITDINDYRLELARKMGATRAVN---
TDH_BURP0       GNATHTALSFNLVGED--VLITGA-GPIGVMAVAIAKHVGARNVVITDINDYRLELARKMGATRAVN---
TDH_BURMS       GNATHTALSFNLVGED--VLITGA-GPIGVMAVAIAKHVGARNVVITDINDYRLELARKMGATRAVN---
TDH_BURMA       GNATHTALSFNLVGED--VLITGA-GPIGVMAVAIAKHVGARNVVITDINDYRLELARKMGATRAVN---
TDH_BURM9       GNATHTALSFNLVGED--VLITGA-GPIGVMAVAIAKHVGARNVVITDINDYRLELARKMGATRAVN---
TDH_BURM7       GNATHTALSFNLVGED--VLITGA-GPIGVMAVAIAKHVGARNVVITDINDYRLELARKMGATRAVN---
ADH5_YEAST      Y---KALKRANVIPGQW-VTISGACGGLGSLAIQYALAMGYRVIGIDG-GNAKRKLFEQLGGEIFIDFTE
ADH5_SACPS      Y---KALKRANVIPGQW-VTISGACGGLGSLAIQYALAMGYRVIGIDG-GNAKRKLFEQLGGEIFIDFTE
TDH_BURCM       GNATHTALSFNLVGED--VLITGA-GPIGVMAAAIAKHVGARNVVITDINDYRLELARKMGATRAVN---
TDH_BURA4       GNATHTALSFNLVGED--VLITGA-GPIGVMAAAIAKHVGARNVVITDINDYRLELARKMGATRAVN---
ETR1_YARLI      ----------------------GGNSGVGRAAIQIGHIRGLKSISVVRDREVLKKELTDLGATHVITEEE
TDH_RHILO       GNAVHTALSFDLVGED--VLVTGA-GPIGIMGALVAQCVGARKVVITDINPVRLALAKKLGVQHVVDASK
TDH_AERS4       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVCRHVGARHVVITDVNEYRLELARKMGATRAVN---
TDH_SHEFN       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVCKHVGARHVVITDVNEYRLDLARKMGATRAVNVAT
TDH_RHIL3       GNAVHTALSFDLVGED--VLVTGA-GPIGIMGALVAKRSGARKVVITDINPHRLELARKLGIDHVVDASK
TDH_BURXL       GNATHTALSFNLVGED--VLITGA-GPIGIMAVAIAKHVGARNVVITDVNDYRLELARKMGATRAVN---
TDH_BURTA       GNATHTALSFNLVGED--VLITGA-GPIGVMAVAIAKHVGARNVVITDINDYRLDLARRMGATRAVN---
TDH_BURPP       GNATHTALSFNLVGED--VLITGA-GPIGIMAVAIAKHVGARNVVITDVNDYRLELARKMGATRAVN---
TDH_BURP8       GNATHTALSFNLVGED--VLITGA-GPIGIMAVAIAKHVGARNVVITDVNDYRLELARKMGATRAVN---
QOR_LEIAM       LTAAVALGEVGRVKKGDVALVXXXXXXXXQIAVQLLKHVYGCTVIGTCSSEEKAEFLKSIGCDHVINYKT
TDH_VIBVY       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVAKHVGARHVVITDVNEYRLDLARKMGVTRAVNVAE
TDH_RHIME       GNAVHTALSFDLVGED--VLVTGA-GPIGIMGAMVAKRCGARKVVITDINPVRLDLARKLGIDHVVDASK
TDH_PSEA6       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVAQHVGARHVVITDVNEYRLDLARKMGASRAVNVAK
TDH_COLP3       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVAKHVGARHVVITDINEYRLDLARKMGATRAVDVSK
QOR_LAMGU       FTAYRALLHSACAKAGESVLVHGASGGVGLAACQIARACCFKVLGTAGTEEGQRVVLQN-GAHEVFNHRE
QORX_HUMAN      FQLLHLV---GNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPL-VTAGSQKKLQMAEKLGAAAGFNKED
ZDH1_STAES      YETLFDVFGISKEPSENKLLIINGAGGVGSIATQIAKFYG-LKVITTASREDTIKWSVNMGADVVLNKKD
TDH_YERPY       GNAVHTALSFDLVGED--VLVSGA-GPIGIMAAAVCKHVGARHVVITDVNEYRLDLARKMGVTRAVN---
TDH_YERPS       GNAVHTALSFDLVGED--VLVSGA-GPIGIMAAAVCKHVGARHVVITDVNEYRLDLARKMGVTRAVN---
TDH_YERPB       GNAVHTALSFDLVGED--VLVSGA-GPIGIMAAAVCKHVGARHVVITDVNEYRLDLARKMGVTRAVN---
TDH_YERP3       GNAVHTALSFDLVGED--VLVSGA-GPIGIMAAAVCKHVGARHVVITDVNEYRLDLARKMGVTRAVN---
TDH_YERE8       GNAVHTALSFDLVGED--VLVSGA-GPIGIMAAAVCKHVGARHVVITDVNEYRLDLARKMGVTRAVN---
TDH_AERHH       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVCRHVGARHVVITDVNEYRLELARKMGATRAVN---
MECR_DANRE      CTAYRMLTDFEELKAGDTVIQNAANSGVGQAVIQIAAAKGIHTINVIRDRRQLSDRLTAMGATHVITRPE
ADH2_KLULA      ------------------VAISGACGGLGSLAIQYAKAMGYRVLGIDTGAE-KAKLFKELGGEYFVDYAD
TDH_VIBVU       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVAKHVGARHVVITDVNEYRLDLARKMGVTRAVNVAE
TDH_SERP5       GNAVHTALSFDLVGED--VLVSGA-GPIGIMAAAVCKHVGARHVVITDVNEYRLDLARKMGVTRAVNVSK
TDH_RHIEC       GNAVHTALSFDLVGED--VLVTGA-GPIGIMGALVAKRSGARKVVITDINPHRLDLARKLGIDHVVDASK
TDH_RHIE6       GNAVHTALSFDLVGED--VLVTGA-GPIGIMGALVAKRSGARKVVITDINPHRLDLARKLGIDHVVDASK
TDH_PHOLL       GNAVHTALSFDLVGED--VLVSGA-GPIGIMAAAVCKHVGARHVVITDVNEYRLELARKMGVTRAVN---
PKS25_DICDI     --SIHSLYNIGNLREGESILIHSGSGGVGLSALEILKSNNHSSIFVTVGSEEKKQYL-------------
ADH3_BACST      --TYKALKVTGAKP--GEWVAIYGIGGLGHVAVQYAKAMGLNVVAVDIGDE-KLELAKELGADLVVDAAK
QOR_PIG         FTACLALLHSACVKAGEIVLIHGASGGVGIAACQIARAYGLKVLGTAGTEEGQNIVLQN-GAHEVFNHRE
QOR_HUMAN       FTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQN-GAHEVFNHRE
ZDH1_STAEQ      YETLFDVFGISKEPSENKLLIINGAGGVGSIATQIAKFYG-LKVITTASREDTIKWSVNMGADVVLNKKD
TDH_YERPP       GNAVHTALSFDLVGED--VLVSGA-GPIGIMAAAVCKHVGARHVVIADVNEYRLDLARKMGVTRAVN---
TDH_YERPN       GNAVHTALSFDLVGED--VLVSGA-GPIGIMAAAVCKHVGARHVVIADVNEYRLDLARKMGVTRAVN---
TDH_YERPG       GNAVHTALSFDLVGED--VLVSGA-GPIGIMAAAVCKHVGARHVVIADVNEYRLDLARKMGVTRAVN---
TDH_YERPE       GNAVHTALSFDLVGED--VLVSGA-GPIGIMAAAVCKHVGARHVVIADVNEYRLDLARKMGVTRAVN---
TDH_YERPA       GNAVHTALSFDLVGED--VLVSGA-GPIGIMAAAVCKHVGARHVVIADVNEYRLDLARKMGVTRAVN---
TDH_RHILW       GNAVHTALSFDLVGED--VLVTGA-GPIGIMGALVAKRSGARKVVITDINPHRLALARKLGIDHVVD---
QOR_CAVPO       FTACRALFHSARAKAGESVLVHGASGGVGLAACQIARAYGLKVLGTAGTEEGQKVVLQN-GAHEVFNHRD
ADH1_BACST      --TYKALKVTGAKP--GEWVAIYGIGGLGHVAVQYAKAMGLNVVAV-DLGDEKLELAKQLGADLVVNHDD
QOR_SALTY       -----------VKPDE-PFLFHAAAGGVGLIACQWAKALGAKLIGTVGSAQK-AQRALDAGAWQVINYRE
QOR_BOVIN       FTAYRALLHSACVKPGESVLVHGASGGVGIAACQIARAYGLKVLGTASTEEGQKIVLEN-GAHKVFNHKE
YBJS_ECOLI      -----------------KVLVTGATSGLGRNAVEFLCQKG-ISVRATGRNEAMGKLLEKMGAEFV--PAD
TDH_SHEPA       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVCRHVGARHVVITDVNEYRLELAEKMGATRAVNVAK
TDH_SHELP       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVCRHVGARHVVITDVNEYRLELAKKMGATRAVNVAK
TDH_SHEHH       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVCRHVGARHVVITDVNEYRLELAQKMGATRAVNVAK
TDH_MESSB       GNAVHTALSFDLVGED--VLVTGA-GPIGIMGALVAQCVGARKVVITDINPGRLALAKKLGVRHVVNARE
QORL_ARATH      -------ADEGLVRTEKSILVLNGAGGVGSLVIQLAKHVGASKVAATASTE-KLELVRSLGADLAIDYTK
TDH_SHEAM       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVCRHVGARHVVITDVNEYRLELARKMGATRAVNVAK
TDH_ALTMD       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVAKHVGARHVVVTDINPYRLELAKKMGATRTVD---
TDH_PHOPR       GNAVHTALSFDLVGED--VLITGA-GPIGIMAAAVAKHVGARHVVITDVNEYRLDLARKMGVTRAVNVAN
TDH_CHRVO       GNAVHTALSFNLVGED--VLITGA-GPIGIMAVAIAKHVGARHVVITDVNDYRLELAKKMGATRAVNVA-
QOR_PSEAE       --TTQYLLRQTYELRGGEILFHAAAGGVGLFACQWAKALGVQLIGTVSSPEK-ARLARQHGAWETIDYSH
QORH_ARATH      ------------------ILVTAASGGVGHYAVQLAKLANAHVTATCGAR--NIEFVKSLGADEVLD---
HLDD_ENTS8      ------------------IIVTGGAGFIGSNIVKALNDIGYTDILVVDNLKDGTKFLVDLNIADYMDKED


                         .         .         .         +         .         .         .:280
query           LSEKGRPLQKGRWAGVVDSVGSHTLVNAIAQTKWGGIVTACGMAQGPDLPGTVLPFILRGVHLVGINSVD
YHDH_ECOLI      FAE-SRPLEKQVWAGAIDTVGDKVLAKVLAQMNYXXXXXXXXXXXXFTLPTTVMPFILRNVRLQGVDSVM
YHFP_BACSU      VYDGTKALSKQQWQGAVDPVGGKQLASLLSKIQYGGSVAVSGLTGGGEVPATVYPFILRGVSLLGIDSVY
ADH2_BACST      PVKAIHDQVGGVHAAISVAVNKKAFEQAYQSVKRGGTLVVVGLPNA-DLPIPIFDTVLNGVSVKG--SIV
YGD6_SCHPO      TPQWASPALKMTYHHVIEVGGEKTLPQSIACLAKDGMISMIGFVASPNLTSIIGQILNRNANIRGI----
QOR_YEAST       KFTNGKGVDAS-----FDSVGKDTFEISLAALKRKGVFVSFGNASGLIPPFSITRLSPKNITLV------
ZDH1_STAAC      ----------------------------------------------------------------------
ZDH1_STAAW      ----------------------------------------------------------------------
ZDH1_STAAS      ----------------------------------------------------------------------
ZDH1_STAAR      ----------------------------------------------------------------------
ZDH1_STAAN      ----------------------------------------------------------------------
ZDH1_STAAM      ----------------------------------------------------------------------
CADH3_ARATH     SQKMKEAV--GTMDFIIDTVSAHALLPLFSLLKVSGKLVALGLLEKPDLP--IFPLVL-GRKMVGGSQIG
QORL2_NEMVE     IKDKVKELTDGHGANVIEAVGGDVFKQCLKCIAWNGYIIPVGFASGPQIPANIL--LVKNCSAVGL----
ADH1_KLUMA      TKDMVAEVTNGVAHAVINSVSEAAISTSVLYTRSNGTVVLVGLPRDAQCKSDVFNQVVKSISIVG--SYV
TDH_ERWCT       ----------------------------------------------------------------------
CADH2_ARATH     SQKMKEAV--GTMDFIIDTVSAHALLPLFSLLKVNGKLVALGLPEKPDLP--IFSLVL-GRKMVGGSQIG
RT4I1_BOVIN     GNVEAQLKSSKPFDFILDNVGGSTETWALKLKKWSG----------------------------------
MECR2_CAEEL     FKGTSRQFLKSRPKLALNGVGGKSALQISSVLERGGCVTYGGMSKAHEFTTSALVFCVRGV-AVGM----
YBI2_SCHPO      DNLVERLADLGPYDFVFDCVNDNVLYRASSKVKPDGAFFGIGSYVGSRLSRTLRPRVLGGSHSYYNILLH
TDH_PSEHT       ----------------------------------------------------------------------
RT4I1_MOUSE     GSVEEQLKSLKLFDFILDNVGGSTETWALFLKKWSG----------------------------------
PKS41_DICDI     ----------------------------------------------------------------------
TDH_SHESM       ESLKDVMKELGMTEGFLEMSGVPSAFHAMLDTNHGGKIAMLGIPGG------------------------
TDH_SHESA       ESLKDVMKELGMTEGFLEMSGVPSAFHAMLDTNHGGKIAMLGIPGG------------------------
PKS40_DICDI     ----------------------------------------------------------------------
TDH_SHESH       ESLEG-----------------------------------------------------------------
YOGA_BACSU      YSNWDEQLQGKKIDVVLDSIGPALFSEYFRHVKPNGRIVSFGASSGDNLSFPVRSLFFPQVNVLG-TSMG
TDH_SHESW       ESLKDVMKELGMTEGFLEMSGVPSAFHAMLDTNHGGKIAMLGIPGG------------------------
TDH_SHEON       ENLKDVMKELGMTEGFLEMSGVPSAFRAMLDTNHGGKIAMLGIPGG------------------------
TDH_SHESR       ENLKDVMKELGMTEGFLEMSGVPSAFHAMLDTNHGGKIAMLGIPGG------------------------
TDH_SHEB9       ESLKDVMKELGMTEGFLEMSGVPSAFHAMLDTNHGGKVAMLGIPGG------------------------
TDH_SHEB5       ESLKDVMKELGMTEGFLEMSGVPSAFHAMLDTNHGGKVAMLGIPGG------------------------
TDH_SHEB2       ESLKDVMKELGMTEGFLEMSGVPSAFHAMLDTNHGGKVAMLGIPGG------------------------
RT4I1_HUMAN     GSVEEQLKSLKPFDFILDNVGGST----------------------------------------------
VAT1_DANRE      ----------------------------------------------------------------------
TDH_SHEWM       EDLKDVMSELGMTEGFLEMSGVPSAFHSMLDTNHGGKVAMLGI-PGGDMAIDWSKVIFKGLIIKGI----
TDH_SHEB8       ENLKDVMKELGMTEGFLEMSGVPSAFHAMLDTNHGGKVAMLGIPSG------------------------
TDH_BURVG       ES--------------------------------------------------------------------
TDH_BURS3       ES--------------------------------------------------------------------
TDH_BURM1       ES--------------------------------------------------------------------
TDH_BURCJ       ES--------------------------------------------------------------------
TDH_BURCH       ES--------------------------------------------------------------------
TDH_BURCC       ES--------------------------------------------------------------------
TDH_BURCA       ES--------------------------------------------------------------------
ADH1_NEUCR      TKDLVADVK----AATPDGLGPHAVIQAVDYVRSRGTIICIGLPAGAKFQAPVFDTVIRMITIKGSNRQD
TDH_VIBPA       ----------------------------------------------------------------------
RT4I1_DANRE     GPVEKQLKNLEKFDLILDSIGGETEKWALDLLKWSGVTLITPFLQNTDRLG-LADGMMQSAVTVGCKVVK
TDH_SHEPC       ENLKDVMKELGMTEGFLEMSGVPSAFHAMLDTNHGGKVAMLGIPGG------------------------
TDH_BURPS       ----------------------------------------------------------------------
TDH_BURP6       ----------------------------------------------------------------------
TDH_BURP1       ----------------------------------------------------------------------
TDH_BURP0       ----------------------------------------------------------------------
TDH_BURMS       ----------------------------------------------------------------------
TDH_BURMA       ----------------------------------------------------------------------
TDH_BURM9       ----------------------------------------------------------------------
TDH_BURM7       ----------------------------------------------------------------------
ADH5_YEAST      EKDIVGAIIKGGSHGVINSVSEAAIEASTRYCRPNGTVVLVGMPAHAYCNSDVFNQVVKSISIVGSNRAD
ADH5_SACPS      EKDIVGAIIKGGSHGVINSVSEAAIEASTRYCRPNGTVVLVGMPAHAYCNSDVFNQVVKSISIVGSNRAD
TDH_BURCM       ----------------------------------------------------------------------
TDH_BURA4       ----------------------------------------------------------------------
ETR1_YARLI      ASDKLFSKQIKSWTGALNCIGGKSATSIMRQLGAGGIVTYGGMSKKP-LTFPTGPFIFKDITAKG-----
TDH_RHILO       ----------------------------------------------------------------------
TDH_AERS4       ----------------------------------------------------------------------
TDH_SHEFN       ENLKDVMKELGMTEGFLEMSGVPSAFHAMLDTNHGGKIAMLGIPGG------------------------
TDH_RHIL3       ----------------------------------------------------------------------
TDH_BURXL       ----------------------------------------------------------------------
TDH_BURTA       ----------------------------------------------------------------------
TDH_BURPP       ----------------------------------------------------------------------
TDH_BURP8       ----------------------------------------------------------------------
QOR_LEIAM       ESLDGRELCPKGVDVVYECVGGHT----------------------------------------------
TDH_VIBVY       QKLDDVMVELGMTEGFLEMSGNPSAFNSMLKTNHGGRIALLGIPPS-DMGIDWNQVIFKGLVIKGIYG--
TDH_RHIME       ----------------------------------------------------------------------
TDH_PSEA6       ESLK------------------------------------------------------------------
TDH_COLP3       ESLK------------------------------------------------------------------
QOR_LAMGU       ----------------------------------------------------------------------
QORX_HUMAN      FSEATLKFTKGAGVNILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLL------------
ZDH1_STAES      LSQQ------------------------------------------------------------------
TDH_YERPY       ----------------------------------------------------------------------
TDH_YERPS       ----------------------------------------------------------------------
TDH_YERPB       ----------------------------------------------------------------------
TDH_YERP3       ----------------------------------------------------------------------
TDH_YERE8       ----------------------------------------------------------------------
TDH_AERHH       ----------------------------------------------------------------------
MECR_DANRE      MKELFKSCPRPKLA--LNGVGGKSATELLRHLQSGGLVTYGGMAKQP-----------------------
ADH2_KLULA      LIKEIVDATNGGAHGVINSVSEFAIEQSTNYVRSNGTVVLVGLPRDAKCKSDVFTQVVKSVSIVG--SYV
TDH_VIBVU       QKLDDVMAELGMTEGFLEMSGNPSAFNSMLKTNHGGRIALLGIPPS-DMGIDWNQVIFKGLVIKGIYG--
TDH_SERP5       ENLNDVMAELGMTEGFLEMSGARTLLNAM---NHGGRIAMLGIPPS-DMSIDWNQVIFKGLFIKGIYGRE
TDH_RHIEC       ----------------------------------------------------------------------
TDH_RHIE6       ----------------------------------------------------------------------
TDH_PHOLL       ----------------------------------------------------------------------
PKS25_DICDI     ----------------------------------------------------------------------
ADH3_BACST      FMKEKXXXXXXXXXXXXSKPAFQSAYNSIRR---GGACVLVGLPP-EEMPIPIFDTVLNGIKIIG--SIV
QOR_PIG         VN--------------------------------------------------------------------
QOR_HUMAN       VN--------------------------------------------------------------------
ZDH1_STAEQ      LSQQ------------------------------------------------------------------
TDH_YERPP       ----------------------------------------------------------------------
TDH_YERPN       ----------------------------------------------------------------------
TDH_YERPG       ----------------------------------------------------------------------
TDH_YERPE       ----------------------------------------------------------------------
TDH_YERPA       ----------------------------------------------------------------------
TDH_RHILW       ----------------------------------------------------------------------
QOR_CAVPO       IDEIKKSIGEKGVDVIIEMLANVNLSNDLKLLSCGGRVIIVG----------------------------
ADH1_BACST      AAQWIKEKXXXXXXXXXXXXSKAAFESAYKSIRRGGACVLVGLPP-EEIPIPIFDTVLNGVKIIG--SIV
QOR_SALTY       ESERVKEITGGKKVRVVDSVGKDTWEASLDCLQRRGLMVSFGNASGP-----------------------
QOR_BOVIN       ----------------------------------------------------------------------
YBJS_ECOLI      LTELVSSQAKVMLAGI------------------------------------------------------
TDH_SHEPA       ----------------------------------------------------------------------
TDH_SHELP       ----------------------------------------------------------------------
TDH_SHEHH       ----------------------------------------------------------------------
TDH_MESSB       ----------------------------------------------------------------------
QORL_ARATH      ENIEDLP---DKYDVVFDAIG--MCDKAVKVIKEGGKVVALTGAVTP-----------------------
TDH_SHEAM       ----------------------------------------------------------------------
TDH_ALTMD       ----------------------------------------------------------------------
TDH_PHOPR       MSELG--MTEGFDVGLEMSGVPSAFNGMLASMNHGGKVALLGIPPS-DMAVDWTQVIFKGLVIKGIYG--
TDH_CHRVO       ----------------------------------------------------------------------
QOR_PSEAE       ENVARRVLEDGKKCPVVDSVGKDTWETSLDCVAPRGLLVSFGNASGP-----------------------
QORH_ARATH      ----------------------------------------------------------------------
HLDD_ENTS8      FQVQ---IMSGEEFGEVEAVFHEGACS--STTEWDG----------------------------------


                         .         *         .         .         .         .         +:350
query           APRELRRRAWALLSEHLDTAVLDDMTTVIDVKDVAQAGEDLMAGKLHGRTAVRVH
YHDH_ECOLI      TPPERRAQAWQRLVADLPESFYTQAAKEISLSEAPNFAEAIINNQIQGRTLVKVN
YHFP_BACSU      CPMDVRAAVWERMSSDLKP---DQLLTIVDLEETPGALKDILQNRIQGRVIVKL-
ADH2_BACST      GTRK-------DMQEALDFAARGKVRPIVELEEINEVFERMEKGKINGRIVLKL-
YGD6_SCHPO      -------------------------------------------------------
QOR_YEAST       -------------------------------------------------------
ZDH1_STAAC      -------------------------------------------------------
ZDH1_STAAW      -------------------------------------------------------
ZDH1_STAAS      -------------------------------------------------------
ZDH1_STAAR      -------------------------------------------------------
ZDH1_STAAN      -------------------------------------------------------
ZDH1_STAAM      -------------------------------------------------------
CADH3_ARATH     GMKE---------------------------------------------------
QORL2_NEMVE     -------------------------------------------------------
ADH1_KLUMA      GNRADTREALDFFSRGLVKAPI----KILGLSELASVYDKMVKGQIVGRIVV---
TDH_ERWCT       -------------------------------------------------------
CADH2_ARATH     GMKE---------------------------------------------------
RT4I1_BOVIN     -------------------------------------------------------
MECR2_CAEEL     ---------WARQEEHLDEWNL----CVDEVQKLAVAGK----------------
YBI2_SCHPO      VDQEMLRDFVDFVMKHNIKTVID---SVYDFEDTVEAFNRLMTHRCKGKVIIK--
TDH_PSEHT       -------------------------------------------------------
RT4I1_MOUSE     -------------------------------------------------------
PKS41_DICDI     -------------------------------------------------------
TDH_SHESM       -------------------------------------------------------
TDH_SHESA       -------------------------------------------------------
PKS40_DICDI     -------------------------------------------------------
TDH_SHESH       -------------------------------------------------------
YOGA_BACSU      SGEEFQAML-AFIDKHKLRPVID---RIYPLEKACEAYKRMQEGRQFGNIGI---
TDH_SHESW       -------------------------------------------------------
TDH_SHEON       -------------------------------------------------------
TDH_SHESR       -------------------------------------------------------
TDH_SHEB9       -------------------------------------------------------
TDH_SHEB5       -------------------------------------------------------
TDH_SHEB2       -------------------------------------------------------
RT4I1_HUMAN     -------------------------------------------------------
VAT1_DANRE      -------------------------------------------------------
TDH_SHEWM       -------------------------------------------------------
TDH_SHEB8       -------------------------------------------------------
TDH_BURVG       -------------------------------------------------------
TDH_BURS3       -------------------------------------------------------
TDH_BURM1       -------------------------------------------------------
TDH_BURCJ       -------------------------------------------------------
TDH_BURCH       -------------------------------------------------------
TDH_BURCC       -------------------------------------------------------
TDH_BURCA       -------------------------------------------------------
ADH1_NEUCR      TQEALDFFARGLIKVPIKTVGLSKLQEVYDLME---------EGKIVGRYVV---
TDH_VIBPA       -------------------------------------------------------
RT4I1_DANRE     NLRKGVHYRWGFFAP--SGSALDEVSEMVDAGKVRPVVEEVFS------------
TDH_SHEPC       -------------------------------------------------------
TDH_BURPS       -------------------------------------------------------
TDH_BURP6       -------------------------------------------------------
TDH_BURP1       -------------------------------------------------------
TDH_BURP0       -------------------------------------------------------
TDH_BURMS       -------------------------------------------------------
TDH_BURMA       -------------------------------------------------------
TDH_BURM9       -------------------------------------------------------
TDH_BURM7       -------------------------------------------------------
ADH5_YEAST      TREALDFFARGLIKSPIHLAGLSDVPEI---------------------------
ADH5_SACPS      TREALDFFARGLIKSPIHLAGLSDVPEI---------------------------
TDH_BURCM       -------------------------------------------------------
TDH_BURA4       -------------------------------------------------------
ETR1_YARLI      -------------------------------------------------------
TDH_RHILO       -------------------------------------------------------
TDH_AERS4       -------------------------------------------------------
TDH_SHEFN       -------------------------------------------------------
TDH_RHIL3       -------------------------------------------------------
TDH_BURXL       -------------------------------------------------------
TDH_BURTA       -------------------------------------------------------
TDH_BURPP       -------------------------------------------------------
TDH_BURP8       -------------------------------------------------------
QOR_LEIAM       -------------------------------------------------------
TDH_VIBVY       --REM-FETWYKMASLIQSGL--DLTPIITKVDDFQQGFDIMRSGMSGK------
TDH_RHIME       -------------------------------------------------------
TDH_PSEA6       -------------------------------------------------------
TDH_COLP3       -------------------------------------------------------
QOR_LAMGU       -------------------------------------------------------
QORX_HUMAN      -------------------------------------------------------
ZDH1_STAES      -------------------------------------------------------
TDH_YERPY       -------------------------------------------------------
TDH_YERPS       -------------------------------------------------------
TDH_YERPB       -------------------------------------------------------
TDH_YERP3       -------------------------------------------------------
TDH_YERE8       -------------------------------------------------------
TDH_AERHH       -------------------------------------------------------
MECR_DANRE      -------------------------------------------------------
ADH2_KLULA      GNRADTREALDFFARGLVHAPI----KIVGLSELADVYDKMVKGEIVGRYVV---
TDH_VIBVU       --REM-FETWYKMASLIQSGL--DLTPIITKVDDFQQGFDIMRSGMSGK------
TDH_SERP5       MFETWYKMA-ALIQSGLDTPIITHRFTI----DQFQQGFDAMRSGQSGKVVL---
TDH_RHIEC       -------------------------------------------------------
TDH_RHIE6       -------------------------------------------------------
TDH_PHOLL       -------------------------------------------------------
PKS25_DICDI     -------------------------------------------------------
ADH3_BACST      GTRK-------DLQEALQFAAEGKVKTIIEVQPLEKINERMLKGQINGRVVL---
QOR_PIG         -------------------------------------------------------
QOR_HUMAN       -------------------------------------------------------
ZDH1_STAEQ      -------------------------------------------------------
TDH_YERPP       -------------------------------------------------------
TDH_YERPN       -------------------------------------------------------
TDH_YERPG       -------------------------------------------------------
TDH_YERPE       -------------------------------------------------------
TDH_YERPA       -------------------------------------------------------
TDH_RHILW       -------------------------------------------------------
QOR_CAVPO       -------------------------------------------------------
ADH1_BACST      GTRK-------DLQEALQFAAEGKVKTIVEVENINDVFDRMLKGQINGRVVLKV-
QOR_SALTY       -------------------------------------------------------
QOR_BOVIN       -------------------------------------------------------
YBJS_ECOLI      -------------------------------------------------------
TDH_SHEPA       -------------------------------------------------------
TDH_SHELP       -------------------------------------------------------
TDH_SHEHH       -------------------------------------------------------
TDH_MESSB       -------------------------------------------------------
QORL_ARATH      -------------------------------------------------------
TDH_SHEAM       -------------------------------------------------------
TDH_ALTMD       -------------------------------------------------------
TDH_PHOPR       --REM-FETWYKMASLIQSGL--DLTPIITHHDDFQKGFDMMRSGMSGK------
TDH_CHRVO       -------------------------------------------------------
QOR_PSEAE       -------------------------------------------------------
QORH_ARATH      -------------------------------------------------------
HLDD_ENTS8      -------------------------------------------------------