[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF55467.1

[Show Plain Result]


## Summary of Sequence Search
    1::282
   19::292     4e-04  25%  298 aa  IOLE_BACC3 RecName: Full=Inosose dehydratase;       
   19::292     4e-04  25%  298 aa  IOLE_BACAH RecName: Full=Inosose dehydratase;       
    1::282

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxDQVAELGMYPVLEKLKELNIASVEVSQIPMNEENTAALERGISELGIEVGALSVAFGP
IOLE_BACC3      ------------DDMPELGAENTFEQISEMALAGFNGSEVGNKPRNTVVLKKSLELRNLEIASAWFSTFL
IOLE_BACAH      ------------DDMPELGAENTFEQISEMALAGFNGSEVGNKPRNTVVLKKSLELRNLEIASAWFSTFL


                         .         .         *         .         .         .         .:140
query           SAAPGVDSLENDFDKIVADCKRLGVKYTRIGMMPFQAMTSKEATETWAAQVEPYAARLAVEGITLCYHNH
IOLE_BACC3      TTKPLEETVE-EFIKHRDFLHDMGAKVIVVGLMDVPLFKNKPVEEEWNKLADGHLGKLAQEGLHIVYHHH
IOLE_BACAH      TTKPLEETVE-EFIKHRDFLHDMGAKVIVVGLMDVPLFKNKPVEEEWNKLADGHLGKLAQEGLHIVYHHH


                         +         .         .         .         .         *         .:210
query           HVDLHKFGNERIFDIVRRVAPSLFFEVDLHWVQRGGMAPLDMLKEYAGVCKLIHVKDFRVTELPEEAMEL
IOLE_BACC3      MTGVQTTAEEKLMDITDSALVSLLFDTG-HLVF-SGEEPLYILKKYLPRIKHVHLKDIR-----QEVVDI
IOLE_BACAH      MTGVQTTAEEKLMDITDSALVSLLFDTG-HLVF-SGEEPLYILKKYLPRIKHVHLKDIR-----QEVVDI


                         .         .         .         +         .         .         .:280
query           FTAGDFMKGYEKFVNIVEFAEVGQGNMNWPELLPASKAAGAEYFFIEQDMTYGRDPFDCIKDSREYLxxx
IOLE_BACC3      VKENEL--SFLQAVKNGAFTVPGDGVIEFDEVFTILANSDYQGWFVEQDPALA-NPFEYALKAREFI---
IOLE_BACAH      VKENEL--SFLQAVKNGAFTVPGDGVIEFDEVFTILANSDYQGWFVEQDPALA-NPFEYALKAREFI---


                         .         *         .         .         .         .         +:350
query           xx
IOLE_BACC3      --
IOLE_BACAH      --