[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF55672.1

[Show Plain Result]


## Summary of Sequence Search
    1::455
    2::452     2e-85  42%  456 aa  FPRA_MYCTU RecName: Full=NADPH-ferredoxin reductase fprA;       
    9::452     6e-83  40%  456 aa  FPRA_MYCLE RecName: Full=NADPH-ferredoxin reductase fprA;       
   45::497     1e-78  38%  498 aa  ADRO_SALFO RecName: Full=NADPH:adrenodoxin oxidoreductase,
   40::488     1e-77  38%  492 aa  ADRO_BOVIN RecName: Full=NADPH:adrenodoxin oxidoreductase,
   42::490     1e-73  38%  494 aa  ADRO_MOUSE RecName: Full=NADPH:adrenodoxin oxidoreductase,
   40::487     8e-73  37%  491 aa  ADRO_HUMAN RecName: Full=NADPH:adrenodoxin oxidoreductase,
   42::490     1e-72  37%  494 aa  ADRO_RAT RecName: Full=NADPH:adrenodoxin oxidoreductase,
  111::539     1e-68  36%  555 aa  FPRB_MYCLE RecName: Full=Probable ferredoxin/ferredoxin--NADP
   31::464     3e-64  35%  466 aa  ADRO_DROME RecName: Full=NADPH:adrenodoxin oxidoreductase,
   41::446     2e-60  34%  515 aa  ADRO_DICDI RecName: Full=Probable NADPH:adrenodoxin oxidoreductase,
  111::546     2e-58  33%  575 aa  FPRB_MYCTU RecName: Full=Probable ferredoxin/ferredoxin--NADP
  111::546     2e-58  33%  575 aa  FPRB_MYCBO RecName: Full=Probable ferredoxin/ferredoxin--NADP
   19::383     9e-58  39%  469 aa  ADRO_SCHPO RecName: Full=Probable NADPH:adrenodoxin oxidoreductase,
   18::486     1e-45  32%  493 aa  ADRO_YEAST RecName: Full=Probable NADPH:adrenodoxin oxidoreductase,
  154::487     2e-21  32%  493 aa  GLTB_BACSU RecName: Full=Glutamate synthase [NADPH] small chain;   
 1757::1875    5e-18  41% 2111 aa  GLT1_SCHPO RecName: Full=Putative glutamate synthase [NADPH];        
 1826::1945    9e-16  43% 2194 aa  GLSN_MEDSA RecName: Full=Glutamate synthase [NADH], amyloplastic;    
  309::468     2e-15  32%  639 aa  YGFT_ECOLI RecName: Full=Uncharacterized protein ygfT;
 1785::1891    6e-14  35% 2145 aa  GLT1_YEAST RecName: Full=Glutamate synthase [NADH];       
  329::539     1e-13  28%  659 aa  AEGA_ECOLI RecName: Full=Protein aegA;
  148::310     4e-13  30%  472 aa  GLTD_ECOLI RecName: Full=Glutamate synthase [NADPH] small chain;   
  110::248     2e-10  28%  413 aa  GLTD_RHOSH RecName: Full=Putative glutamate synthase [NADPH] small
  126::374     1e-09  29%  413 aa  YEIT_SALTI RecName: Full=Uncharacterized oxidoreductase yeiT;      
  126::374     4e-09  29%  413 aa  YEIT_SALTY RecName: Full=Uncharacterized oxidoreductase yeiT;      
  126::276     2e-08  32%  412 aa  YEIT_ECO57 RecName: Full=Uncharacterized oxidoreductase yeiT;      
  126::276     2e-08  32%  412 aa  YEIT_ECOLI RecName: Full=Uncharacterized oxidoreductase yeiT;      
  173::313     5e-08  27%  482 aa  GLTD_AZOBR RecName: Full=Glutamate synthase [NADPH] small chain;   
  553::695     1e-06  28% 1032 aa  YGFK_ECOLI RecName: Full=Uncharacterized protein ygfK;
    1::184     4e-06  29%  448 aa  NAOX_METJA RecName: Full=Putative NADH oxidase;       
  553::695     2e-05  28% 1032 aa  YGFK_ECO57 RecName: Full=Uncharacterized protein ygfK;
   18::148     3e-04  34%  526 aa  OOXA2_RHIME RecName: Full=Opine oxidase subunit A;       
    8::49      4e-04  36%  447 aa  FMO1_SCHPO RecName: Full=Thiol-specific monooxygenase;       
  123::213     6e-04  29%  535 aa  FMO2_MOUSE RecName: Full=Dimethylaniline monooxygenase
  182::230     6e-04  41%  381 aa  DHPH_BACSH RecName: Full=Phenylalanine dehydrogenase;       
   64::212     0.001  29%  402 aa  Y119_XANC8 RecName: Full=Putative reductase XC_0119;       
   64::212     0.001  29%  402 aa  Y115_XANCP RecName: Full=Putative reductase XCC0115;       
   43::155     0.001  25%  345 aa  PDXB_VESOH RecName: Full=Erythronate-4-phosphate dehydrogenase;    
  138::235     0.001  34%  472 aa  DLDH2_HALMA RecName: Full=Dihydrolipoyl dehydrogenase 2;       
  109::210     0.001  34%  364 aa  DHLE_BACLI RecName: Full=Leucine dehydrogenase;       
    1::455

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxRPLRVAVVGAGPAGIYASDLLMKSDTDVQIDLFERMPAPFGLIRYGVAPDHPRIKGIVKSLHNVMDKE
FPRA_MYCTU      --RPYYIAIVGSGPXXXXXXXXXXXEDLDMAVDMLEMLPTPWGLVRSGVAPDHPKIKSISKQFEKTAEDP
FPRA_MYCLE      ------IAIVGSGPSGFFXXXXXXXXEINVAVDMLEMLPTPWGLVRSGVAPDHPKIKSISKQFEKTAEDP
ADRO_SALFO      -----KVCIVGGGPAGFYTAQHLVKTRTDVQVDIYERLPVPFGLVRFGVAPDHPEVKNVINTFTQTARHA
ADRO_BOVIN      -----QICVVGSGPAGFYTAQHLLKHHSRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSD
ADRO_MOUSE      -----QICVVGSGPAGFYTAQHLLKHHTHAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSD
ADRO_HUMAN      -----QICVVGSGPAGFYTAQHLLKHP-QAHVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSG
ADRO_RAT        -----QICVVGSGPAGFYTAQHLLKHHTRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSD
FPRB_MYCLE      --RPLTVAIVGSGPAAMYAADELL-TQPGVWVNVFEKLPTPYGLVRAGLAPDHQNTKKVTELFDRVAEHR
ADRO_DROME      -----RICIVGAGPAGFYAAQLILKQLDNCVVDVVEKLPVPFGLVRFGVAPDHPEVKNVINTFTKTAEHP
ADRO_DICDI      ---PFNLCIIGSGPAGLYTAAKVHRQIPHANITILEKLPYPFGLVRSGISPDHQNEKKVKNTLEKVLHPH
FPRB_MYCTU      --QPLTVAVVGSGPAAMYAADELLVQQ-GVQVNVFEKLPTPYGLVRSGVAPDHQNTKRVTRLFDRIAGHR
FPRB_MYCBO      --QPLTVAVVGSGPAAMYAADELLVQQ-GVQVNVFEKLPTPYGLVRSGVAPDHQNTKRVTRLFDRIAGHR
ADRO_SCHPO      ------VGIIGSGPAAFYTAHRLLRNDPNVKIDMFESRPVPFGLVRYGVAPDHPEVKHVEHKFSEIAEST
ADRO_YEAST      ------VSIVGSGPSGFYAYHLLKKSPIPLNVTIWEKLPVPFGLSRYGVAPDHPEVKNXXXXXXXTNQKH
GLTB_BACSU      -----KVAIVGSGPAGLASADQLNQAGHSVTV--FERADRAGGLLTYGI-PNMKLEKGIVERRIKLLTQE
GLT1_SCHPO      -----RVAIIGSGPAGLAAADQLNRAGHHVVI--YERADRPGGLLQYGI-PNMKLDKKVVERRIQLMIDE
GLSN_MEDSA      -----RVAIVGSGPSGLAAADQLNKMGHIVTV--FERADRIGGLMMYGVPNMKTDKVDIVQRRVNLMAEE
YGFT_ECOLI      --RSEKVAVIGAGPAGLGCADILARAG--VQVDVFDRHPEIGGMLTFGIPP-FKLDKTVLSQRREIFTAM
GLT1_YEAST      ------VGVIGSGPAGLACADMLNRAGHTVTV--YERSDRCGGLLMYGI-PNMKLDKAIVQRRIDLLSAE
AEGA_ECOLI      -----RVAIIGAGPAGLACADVLTRNGVGVTV--YDRHPEIGGLLTFGI-PSFKLDKSLLARRREIFSAM
GLTD_ECOLI      -----KVAIIGAGPAGLACADVLTRNG--VKAVVFDRHPEIGGLLTFGI-PAFKLEKEVMTRRREIFTGM
GLTD_RHOSH      -----------------------------LQVTVYDRYDRAGGLLTYGI-PGFKLEKDVVARRVEQLEQA
YEIT_SALTI      -----KVAIIGAGPAGLQASVTLTHLGYDVTI--YEKQPQPGGWLRHGIP--------AFRLPQSVLDQE
YEIT_SALTY      -----KVAIIGAGPAGLQASVTLTHLGYDVTI--YEKQPQPGGWLRHGIP--------AFRLPQSVLDQE
YEIT_ECO57      -----KVAIIGAGPAGLQASVTLTNQGYDVTI--YEKEAHPGGWLRNGI-PQFRLPQSVLDAEIARIEKM
YEIT_ECOLI      -----KVAIIGAGPAGLQASVTLTNQGYDVTI--YEKEAHPGGWLRNGI-PQFRLPQSVLDAEIARIEKM
GLTD_AZOBR      ------------------------------EVHVYDRYDRMGGLLVYGI-PGFKLEKSVVERRVKLLADA
YGFK_ECOLI      ------VAVIGAGPAGLAAGYFLARAGHPV--TLFEREANAGGVVK-NIIPQFRIPAELIQHDIDFVAAH
NAOX_METJA      ----MRAIIIGSGAAGLTTASTIRKYNKDMEIVVITKEKE----IAYSPCAIPYVIEGAIKSFDDIITPE
YGFK_ECO57      ------VAVIGAGPAGLAAGYFLARAGHPV--TLFEREANAGGVVK-NIIPQFRIPAELIQHDIDFVAAH
OOXA2_RHIME     ------VLISGAGPAGMTAA--LEASAAGARVAVLDENPRPGGQIYRDITRNRPERKSYLKQLAEVFDRS
FMO1_SCHPO      -----KIAIIGAGPSGLVTAKALLAEKAFDQVTLFERRGSPGGVWNY-----------------------
FMO2_MOUSE      ----------------------------------------------------------------------
DHPH_BACSH      ----------------------------------------------------------------------
Y119_XANC8      ----------------------------------------------------------------------
Y115_XANCP      ----------------------------------------------------------------------
PDXB_VESOH      -------------------------------------------------------VRSRTKVNHVLLDGS
DLDH2_HALMA     ----------------------------------------------------------------------
DHLE_BACLI      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QLRFLGNIEVGKDITVEELREFYDAIVFSTGATGDQDLRVPGSDLEGSWGAGEFVGFYDGNPNFERNWDL
FPRA_MYCTU      RFRFFGNVVVGEHVQPGELSERYDAVIYAVGAQSDRMLNIPGEDLPGSIAAVDFVGWYNAHPHFEQSPDL
FPRA_MYCLE      RFRFFGNVIVGKHIEPAELAERYDAVIYAVGAQSDRALNIPGEDLPGSIAAVDFVGWYNAHPNFERSPDL
ADRO_SALFO      RCSFHGNVRVGKDVTVEELQEAYHAVVLSYGAEGNRTMGVPGEDLAGVYSAKDFVGWYNGLPNRELRPDL
ADRO_BOVIN      RCAFYGNVEVGRDVTVQELQDAYHAVVLSYGAEDHQALDIPGEELPGVFSARAFVGWYNGLPNRELAPDL
ADRO_MOUSE      RCAFQGNVVVGRDVSVPELREAYHAVVLSYGAEDHQPLGIPGEELPGVVSARAFVGWYNGLPNQELAPDL
ADRO_HUMAN      RCAFWGNVEVGRDVTVPELREAYHAVVLSYGAEDHRALEIPGEELPGVCSARAFVGWYNGLPNQELEPDL
ADRO_RAT        RCAFRGNVVVGRDVSVPELREAYHAVVLSYGAEDHQPLEIPGEELPGVVSARAFVGWYNGLPNQKLAPDL
FPRB_MYCLE      RFRFFLNVEIGRHLSHDELLAHHHAVLYAVGAPDDRRLNIDGMGIPGTGTATELVAWINAHPDFAYPVDL
ADRO_DROME      RLRYFGNISLGTDVSLRELRDRYHAVLLTYGADQDRQLELENEQLDNVISARKFVAWYNGLPGAENAPDL
ADRO_DICDI      QIQFIGNVDIEKDIKFQYIKDNFHAVVLACGIEGDKKLGIPGETLKNVYFAREFIGWLNGNKDQHKQFDL
FPRB_MYCTU      RFRFYLNVEIGKXXXXXXXXXXXXXXXXXXXXPDDRRLTIDGMGLPGTGTATELVAWLNGHPDFDLPVDL
FPRB_MYCBO      RFRFYLNVEIGKXXXXXXXXXXXXXXXXXXXXPDDRRLTIDGMGLPGTGTATELVAWLNGHPDFDLPVDL
ADRO_SCHPO      QFRFLGNVNVGTDVSLRDLTKNYDCLVLAYGAAGDKRLGIPGEDLSGVYSAREVVGWYNSDPNQNLELDL
ADRO_YEAST      KFSFVGGITIGKEILLKELLDNQDAVILSYGCTGDRKLNIPGEGTKGVFSSREFVNWYNGHPDFAKDWS-
GLTB_BACSU      GIDFVTNTEIGVDITADELKEQFDAVILCTGAQKQRDLLIEGRDSKGVHYAMDYLSYLDSNFKDKQFIDA
GLT1_SCHPO      GIEVLTNVEVGKDVSLDELHKVYDAVVLASGSTVPRDLPIPNRDSKGIHFAMEFL---------------
GLSN_MEDSA      GINFVVNANIGLDYSLERLREENDAIVLAVGATKPRDLPVPGRELSGVHFAMEFL---------------
YGFT_ECOLI      GIDFHLNCEIGRDITFSDLTSEYDAVFIGVGTYGMMRADLPHEDAPGVIQALPFLTAHTGLPESEEYTDV
GLT1_YEAST      GIDFVTNTEIGKTISMDELKNKHNAVVYAIGSTIPRDLPIKGRELK------------------------
AEGA_ECOLI      GIHFELNCEVGKDVSLDSLLEQYDAVFVGVGTYRSMKAGLPNEDAPGVYDALPFVMGLEELPE-EPFINT
GLTD_ECOLI      GIEFKLNTEVGRDVQLDDLLSDYDAVFLGVGTYQSMRGGLENEDADGVYAALPFMGF--GETRDEPFVSM
GLTD_RHOSH      GVQFVLNCNVGEDLSFDAIRGQHDAVLIATGVYKQRDLAAPG---VGSAGVVQALSYLTGDEVDDDGLDA
YEIT_SALTI      IARIVENCDVGGSLSLAQLKAEYRAVLMTVGMSCGSDLPLQASHVEIAVDFLQRARQADGDISVPRS---
YEIT_SALTY      IARIVENCEVGGSLSLAQLKAEYRAVLMTVGMSCGSGLPLQASHVEIAVDFLQRARQADGDISVPRS---
YEIT_ECO57      GVTIKCNNEIGKTLTLEQLKAENRAVLVTVGLSSGSGLPLEHSDVE---IAVDFL-----LRARQAQGDI
YEIT_ECOLI      GVTIKCNNEVGNTLTLEQLKAENRAVLVTVGLSSGSGLPLEHSDVE---IAVDFL-----QRARQAQGDI
GLTD_AZOBR      GVIYHPNFEVGRDASLPELRRKHVAVLVATGVYKARDIKAPGSGLGNIVAALDYVSLGDTVEAYENSLNA
YGFK_ECOLI      GVKF--EYGCSPDLTIEQLKQGFHYVLIATGTDKNSGVKLAG-DNQNVWKSLPFLREYNKGTALK-----
NAOX_METJA      DYKRERNIDILTETTVIDVNEFYDYLVLATGAEPFIP-PIEGKDLDGVFKVRTIE---DGRAILKYIEEN
YGFK_ECO57      GVKF--EYGCSPDLTVEQLKQDFHYVLIATGTDKNSGVKLAG-DNQNVLKSLPFLREYNKGTALK-----
OOXA2_RHIME     TIDYAPRATVGRDETVAKVRNVVDAVVLATGAQ-ERPMPVPGWTLQ------------------------
FMO1_SCHPO      ----------------------------------------------------------------------
FMO2_MOUSE      -----GQWEVYTQSNGKEQRTVFDAVMVCSGHHIQ-----PHLPLKSFPGIERFRGQYFHSREYKHPVGF
DHPH_BACSH      ---------------------------------------------------------------------L
Y119_XANC8      ----------------------------------------------------------------------
Y115_XANCP      ----------------------------------------------------------------------
PDXB_VESOH      QVKFVGSTVTGLDHIDQDYLKSKGIKFFSAQGCN-------------SMAVAEFVISAIVNLADELDFDY
DLDH2_HALMA     -----------------ESLSFEHAIV----ATGSRPMAVPGFEFDGE----HILSSKDALA-----LES
DHLE_BACLI      --RYITAEDVGT--TVEDMDIIHDETDFVTGIS-------PAFGSSGNPSPVTAYGVYKGMXXXXXXXSL


                         +         .         .         .         .         *         .:210
query           SAEKVAVVGVGNVALDVARILAKTGDELLVTEIPDNVYESLAKNQAKEVHVFGRRGPAQAKFTPLELKEL
FPRA_MYCTU      SGARAVVIGNGNVALDVARILLTDPDVLARTDIADHALESLRPRGIQEVVIVGRRGPLQAAFTTLELREL
FPRA_MYCLE      SGSRAVVIGNGNVALDVTRILITDPDVLAFTDIADHALESLRPRGIEEVVIVGRRGPLQTAFTTLELREL
ADRO_SALFO      SCETAVILGQGNVALDVARMLLSPVDILKKTDITQHALDALAESSVRRVLIVGRRGPLQVACTIKELREM
ADRO_BOVIN      SCDTAVILGQGNVALDVARILLTPPDHLEKTDITEAALGALRQSRVKTVWIVGRRGPLQVAFTIKELREM
ADRO_MOUSE      SCDTAVILGQGNVALDVARILLTPPEHLEKTDITEAALGALRQSRVKTVWIVGRRGPLQVAFTIKELREM
ADRO_HUMAN      SCDTAVILGQGNVALDVARILLTPPEHLERTDITKAALGVLRQSRVKTVWLVGRRGPLQVAFTIKELREM
ADRO_RAT        SCDTAVILGQGNVALDVARILLTPPEHLEKTDITEVALGVLRQSRVKTVWIVGRRGPLQVAFTIKELREM
FPRB_MYCLE      SHERVVVIGNGNVALDVARLLTADPDNLARTDISEFALHVLGGSXXXXXXXXXXXGPAHSAFTLPELIGL
ADRO_DROME      SGRDVTIVGQGNVAVDVARMLLSPLDALKTTDTTEYALEALSCSQVERVHLVGRRGPLQAAFTIKELREM
ADRO_DICDI      SNENLAIVGQGNVALDVARLLKKNSDELKKTDITSTSFDKINKSNVKNIHIIGRRGPLEVSFTNKEIREI
FPRB_MYCTU      SHERVVIIGNGNXXXXXXXXXXXXPHELAATDIADHALSALRNSXXXXXXXXXXXGPAHSAFTLPELIGL
FPRB_MYCBO      SHERVVIIGNGNXXXXXXXXXXXXPHELAATDIADHALSALRNSXXXXXXXXXXXGPAHSAFTLPELIGL
ADRO_SCHPO      SVEDAVVIGHGNVSLDVARILLSNPAQLSPTDINPLFLKSLERSNLKRLHIVGRRNIFSVSFTIKELREL
ADRO_YEAST      KVSKVGIIGNGNVALDITRVLISNQDEIWETDISSLALNLLRRAPVKDVKLIARRDFVHSKFTNKELREL
GLTB_BACSU      KGKDVIVIGGGD-----------TGADCVATAL---------RQKAKSVHQFGKHPKPPARTNDNMWPEQ
GLT1_SCHPO      ----------------------------------------------------------------------
GLSN_MEDSA      ----------------------------------------------------------------------
YGFT_ECOLI      EGKRVVVLGGGDTTMDCLR---------------------------------------------------
GLT1_YEAST      ----------------------------------------------------------------------
AEGA_ECOLI      AGLNVVVLGGGDTAMDCVRTALRHGSNVTCAYRRDEANMPGSKKEVKNAREEGANFEFNVQPVALELNEQ
GLTD_ECOLI      EGKRVVVLGGGDTAMDCVRTSVRQG---------------------------------------------
GLTD_RHOSH      SGKRVVVIGGGDTAMDCVRTAIRQG---------------------------------------------
YEIT_SALTI      ----ALIIGGGDVAMDVASTLKILGCPSVTCVAREELAEEFTSTQALGVSIIDGFTPVAVSGNKVTFHHV
YEIT_SALTY      ----ALIIGGGDVAMDVASTLKILGCPSVTCVAREELAEEFTSTQALGVSIIDGFTPVAVSGNKVTFHHV
YEIT_ECO57      SIPQSAIIGGGDVAMDVASTLKVLG---------------------------------------------
YEIT_ECOLI      SIPQSAIIGGGDVAMDVASTLKVLG---------------------------------------------
GLTD_AZOBR      AGKHVVVLGGGDTAMDCVRTAIRQG---------------------------------------------
YGFK_ECOLI      LGKHVVVVGAGNTAMDCAR---------------------------------------------------
NAOX_METJA      GCKKVAVVGAGAIGLEMAYGLKCRGLDVLVVEMAPQV---------------------------------
YGFK_ECO57      LGKHVVVVGAGNTAMDCAR---------------------------------------------------
OOXA2_RHIME     ----------------------------------------------------------------------
FMO1_SCHPO      ----------------------------------------------------------------------
FMO2_MOUSE      EGKRILVVGIGNSAADIASELSKTAAQVFVS---------------------------------------
DHPH_BACSH      SGKTYAIQGLGKVGYKVAEQLLKAGADLFVTDIHENVLNSI-KQKSEEL---------------------
Y119_XANC8      ----------------------------------------------------------------------
Y115_XANCP      ----------------------------------------------------------------------
PDXB_VESOH      QKKTLGIIGIGNVGARLAKKAKLMGIKTLLNDPPRQMYENL-----------------------------
DLDH2_HALMA     VPEKLLVVGAGYIGMELSTVFAKLGAEVTVVEMLDDVYETVVRDRAEELGI-------------------
DHLE_BACLI      EGKTVAVQGVGNVAYNLCRHLHEEGAKLIVTDINKEAVE-------------------------------


                         .         .         .         +         .         .         .:280
query           DHSDTIEVIVNPEDIDYDAASEQARRDSKSQDLVCQTLESYAMRDPKGAPHKLFIHFFESPVEILGEDGK
FPRA_MYCTU      ADLDGVDVVIDPAELD-GITDEDAAAVGKVCKQNIKVLRGYADREPRPGHRRMVFRFLTSPIEIKGK-RK
FPRA_MYCLE      ADIEGVDVLVDPAQLE-GISDENAAAAGKTTRQNIKVLRDYTVRTPKPGHRRIVFRFLTSPIEIKGK-GK
ADRO_SALFO      VNLPGTR--PEMEASEFEGIAETLKSLARPRKRLTELLLKAAIETPNKAERAWGFRFLRRPLEVLPSTDR
ADRO_BOVIN      IQLPGTRPMLDPADFLQDRIKEAARPRKRLMELLLRTTEKPGVEEXXXXXXXXXLRFFRSPQQVLSPDGR
ADRO_MOUSE      IQLPGTRPILDPSDF---LGLQDRIKDVXXXXXXXXXXXXXXATEKPGASRAWGLRFFRSPQQVLTPDGR
ADRO_HUMAN      IQLPGARPILDP--VDFLGLQDKIKEVXXXXXXXXXXXXXXXXXXPGPXXXXXXLRFFRSPQQVLSPDGR
ADRO_RAT        IQLPGTQPILDPSDF---LGLQDRIKDVXXXXXXXXXXXXXXXXXXPGVEEXXXLRFFRSPQQVLTPDGR
FPRB_MYCLE      --KATSEVVLDAGDVEGDFATVSDSLTRKKLEVLSSLVDS----SKPTSRRRIRLAYQLTPKRVLGNQ-R
ADRO_DROME      LKLPNVDTRWRTEDFSIDMQLDKLQRPRKR--LTELMLKSLKEQGRISGSKQFLPIFLRAPKAIAGE---
ADRO_DICDI      LTLQNVNTFINTLDVSEEDVSKLERAKKRTFELFKQHLKPFDQEIANNGNMNLIFHFLRSPVELLDKYXX
FPRB_MYCTU      --TAGADVVLDPGDHQLDDLAIVADPLTRNKLEILSTLGDGSAPARRVGRPRIRLAYRLTPRRVLG----
FPRB_MYCBO      --TAGADVVLDPGDHQLDDLAIVADPLTRNKLEILSTLGDGSAPARRVGRPRIRLAYRLTPRRVLG----
ADRO_SCHPO      NYSTKWMNETDASGLDRPXXXXXXXXVSEIQKAVSEKRVAPYSKDKK----CWNLEFGLTPVEILGHKGN
ADRO_YEAST      WELEKIRGRIDPKFFQKEMPSKYDRAFNRRVEMCSEYLKNYKKAPPPSSGYDKFLDYLKTPLKINRDDGA
GLTB_BACSU      PHVFTLEYA-------YEEAEAKFGRDPREYSI--QTTKMVA--DKNGKLKELHTIQME---KVKNEHGK
GLT1_SCHPO      ----------------------------------------------------------------------
GLSN_MEDSA      ----------------------------------------------------------------------
YGFT_ECOLI      ----------------------------------------------------------------------
GLT1_YEAST      ----------------------------------------------------------------------
AEGA_ECOLI      GH--------------------------------------------------------------------
GLTD_ECOLI      ----------------------------------------------------------------------
GLTD_RHOSH      ----------------------------------------------------------------------
YEIT_SALTI      RHSG--ELTLEAENIIL-AVGQHARLDNKAQHNIIDT-HNYQTDDP------------------------
YEIT_SALTY      RHSG--ELTLEAENIIL-AVGQHARLDTKAQHNIIDT-HNYQTDDP------------------------
YEIT_ECO57      ----------------------------------------------------------------------
YEIT_ECOLI      ----------------------------------------------------------------------
GLTD_AZOBR      ----------------------------------------------------------------------
YGFK_ECOLI      ----------------------------------------------------------------------
NAOX_METJA      ----------------------------------------------------------------------
YGFK_ECO57      ----------------------------------------------------------------------
OOXA2_RHIME     ----------------------------------------------------------------------
FMO1_SCHPO      ----------------------------------------------------------------------
FMO2_MOUSE      ----------------------------------------------------------------------
DHPH_BACSH      ----------------------------------------------------------------------
Y119_XANC8      -----------------------------------------------------------------GFGAD
Y115_XANCP      -----------------------------------------------------------------GFGAD
PDXB_VESOH      ----------------------------------------------------------------------
DLDH2_HALMA     ----------------------------------------------------------------------
DHLE_BACLI      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VVGLKTERTQLDGNGGVTGTGEFKTWDVQSVYRAVGYRSDAIEGVPFDDERAVVPNDGGHIIDPEVGSPI
FPRA_MYCTU      VERIVLGRNELDGSGRVAATGEREELPAQLVVRSVGYRGVPTPGLPFDDQSGTIPNVGGRI----NGSP-
FPRA_MYCLE      VERIVLGQNELDDNGRVAATGVREELPAQLIVRSIGYRGVPTPGLPFDDSSVTIPNTNGRV------NGS
ADRO_SALFO      AAGIRLAVNRLEGDGGVVATGEVEDVECGLVISSIGYKSLPIDAVPFDGRKAIIPNTMGRV------QQT
ADRO_BOVIN      AAGIRLAVTRLEGIGEATPTGDVEDLPCGLVLSSIGYKSRPIDSVPFDPKLGVVPNMEGRVVD------V
ADRO_MOUSE      VAGIRLAVTSLEGVGESTPTGDVEDLPCGLLLSSVGYKSRPIDSVPFDPKLGVIPNTEGRVVN------V
ADRO_HUMAN      AAGVRLAVTRLEGVDEATPTGDMEDLPCGLVLSSIGYKSRPVDSVPFDSKLGVIPNVEGRVMD------V
ADRO_RAT        VAGIRLAVTRLEGVGESTPTGDVEDLPCGLLLSSVGYKSRPIDSVPFDPKLGIIPNTEGRVVN------A
FPRB_MYCLE      ATGVEFS---------VTGTEESRRFDAGLVLTSVGYRGKRIRDLPFDEEAAVIPNDGGRVVDPSRGRPM
ADRO_DROME      ---MEFSVTELQQEAAVP-TSSTERLPSHLILRSIGYKSSCVDGINFDTRRGRVHNINGRILDDATGEVD
ADRO_DICDI      LSKIKLEKNKLTQQKKAIGSGEFEIIECSSLFRSIGYTTKQFPSVPFDFNSVSIPNKYGKVLEPNSDKFI
FPRB_MYCTU      ------QRRAGGVQFSVTGTDELRQLDAGLVLTSIGYRGKPIPDLPFDEQAALVPNDGGRVIDPGTGEPV
FPRB_MYCBO      ------QRRAGGVQFSVTGTDELRQLDAGLVLTSIGYRGKPIPDLPFDEQAALVPNDGGRVIDPGTGEPV
ADRO_SCHPO      V---ENVRFQITDSIRTDAESKFTTIPAQLFIRSIGYKSMPLPGVPFDDAKGIVKNVNGFV--------R
ADRO_YEAST      INSLSLCNNRLNEDNSLKDVNNIMTYKVDLLITSLGY-----AGVPMPESKLSIGFDKDHIANKQSGEIF
GLTB_BACSU      Y-----EFRELPGTE--------KVWPAQLVFIAIGF-----EGT----EQPLLKQFGVNSVNNKISAAI
GLT1_SCHPO      ----------------------------------------------------------------------
GLSN_MEDSA      ----------------------------------------------------------------------
YGFT_ECOLI      ----------------------------------------------------------------------
GLT1_YEAST      ----------------------------------------------------------------------
AEGA_ECOLI      ----------------------------------------------------------------------
GLTD_ECOLI      ----------------------------------------------------------------------
GLTD_RHOSH      ----------------------------------------------------------------------
YEIT_SALTI      ----------------------------------------------------------------------
YEIT_SALTY      ----------------------------------------------------------------------
YEIT_ECO57      ----------------------------------------------------------------------
YEIT_ECOLI      ----------------------------------------------------------------------
GLTD_AZOBR      ----------------------------------------------------------------------
YGFK_ECOLI      ----------------------------------------------------------------------
NAOX_METJA      ----------------------------------------------------------------------
YGFK_ECO57      ----------------------------------------------------------------------
OOXA2_RHIME     ----------------------------------------------------------------------
FMO1_SCHPO      ----------------------------------------------------------------------
FMO2_MOUSE      ----------------------------------------------------------------------
DHPH_BACSH      ----------------------------------------------------------------------
Y119_XANC8      TLGVFFEKPGSDKKAGTAGWYNSAAFDTHA--KAAGLYSKSINGDAFSDEARLIKTDMGGQVDLVVASPV
Y115_XANCP      TLGVFFEKPGSDKKAGTAGWYNSAAFDTHA--KAAGLYSKSINGDAFSDEARLIKTDMGGQVDLVVASPV
PDXB_VESOH      ----------------------------------------------------------------------
DLDH2_HALMA     ----------------------------------------------------------------------
DHLE_BACLI      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           TGLYATGWIKRGPIGLIGNTKSDAKETTEMLLADHAAGSLPAPAKPELESIIEFLDERKVAFTTWDGWHL
FPRA_MYCTU      -NEYVVGWIKRGPTGVIGTNKKDAQDTVDTLIKNLGNAKEGAECKPEADQVADWLAARQPKLVTSAHWQV
FPRA_MYCLE      RNEYVVGWIKRGPTGVIGTNKKDSQDTVDTLMENLAANDTEKFGADHADRLAEWLAERQPKLVTSAHWQA
ADRO_SALFO      AGLYCSGWVKRGPTGVIATTMNDSFDTARTLLQDIGKGTLDSSVKPGSQGVSALLEKRGVKPVSFSDWEK
ADRO_BOVIN      PGLYCSGWVKRGPTGVITTTMTDSFLTGQILLQDLKAGHLPSGPRPGSAFIKALLDSRGVWPVSFSDWEK
ADRO_MOUSE      PGLYCSGWVKRGPTGVITTTMTDSFLTSQALLEDLKAGLLPSGPRPGYVAIQALLSNRGVRPVSFSDWEK
ADRO_HUMAN      PGLYCSGWVKRGPTGVIATTMTDSFLTGQMLLQDLKAGLLPSGPRPGYAAIQALLSSRGVRPVSFSDWEK
ADRO_RAT        PGLYCSGWVKRGPTGVITTTMTDSFLTSQVLLKDLKAGLLPSGPRPGYTAIQALLSDRGVRPVSFSDWEK
FPRB_MYCLE      PGAYVAGWIKRGPTGFIGTNKLCSVQTVQAVVADFNAGWLTDPVAEPAE-LAKLVHARQPDTVDSVGWRA
ADRO_DROME      PGLYVAGWLGTGPTGVIVTTMNGAFAVAKTICDDINTNALTSSVKPGYDA-----DGKRV--VTWDGWQR
ADRO_DICDI      NGLYVSGWLKGGPSGSIPNISANSEETASIIHQDY-----------------------------------
FPRB_MYCTU      PGAYVAGWIKRGPTGFIGTNKSCSMQTVQALVADFNDGRLPVATPTALDQLVQARQPQAIGCA---GWRA
FPRB_MYCBO      PGAYVAGWIKRGPTGFIGTNKSCSMQTVQALVADFNDGRLPVATPTALDQLVQARQPQAIGCA---GWRA
ADRO_SCHPO      PGIYTSGWVKHGPIGV------------------------------------------------------
ADRO_YEAST      PHLYASGWIRKGSQGVIASTMQDAFEVGDRVIQDVVSGAL---------SLENSIDLSNIKHTTWKDWER
GLTB_BACSU      DGVFAAGDARRGQVWAINEGREVAREVDRYLM--------------------------------------
GLT1_SCHPO      ----------------------------------------------------------------------
GLSN_MEDSA      ----------------------------------------------------------------------
YGFT_ECOLI      ----------------------------------------------------------------------
GLT1_YEAST      ----------------------------------------------------------------------
AEGA_ECOLI      ----------------------------------------------------------------------
GLTD_ECOLI      ----------------------------------------------------------------------
GLTD_RHOSH      ----------------------------------------------------------------------
YEIT_SALTI      ----------------------------------------------------------------------
YEIT_SALTY      ----------------------------------------------------------------------
YEIT_ECO57      ----------------------------------------------------------------------
YEIT_ECOLI      ----------------------------------------------------------------------
GLTD_AZOBR      ----------------------------------------------------------------------
YGFK_ECOLI      ----------------------------------------------------------------------
NAOX_METJA      ----------------------------------------------------------------------
YGFK_ECO57      ----------------------------------------------------------------------
OOXA2_RHIME     ----------------------------------------------------------------------
FMO1_SCHPO      ----------------------------------------------------------------------
FMO2_MOUSE      ----------------------------------------------------------------------
DHPH_BACSH      ----------------------------------------------------------------------
Y119_XANC8      RKLPSTGEVKRSALKPIGNTTATAIDTNKDTIIQ---ASIEPATEQEIEDTITVMGGQ-----DWELW--
Y115_XANCP      RKLPSTGEVKRSALKPIGNTTATAIDTNKDTIIQ---ASIEPATEQEIEDTITVMGGQ-----DWELW--
PDXB_VESOH      ----------------------------------------------------------------------
DLDH2_HALMA     ----------------------------------------------------------------------
DHLE_BACLI      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LDAAERALGEPEGRERKKIVEWNDMVRHARxxxxx
FPRA_MYCTU      IDAFERAAGEPHGRPRVKLASLAELLR--------
FPRA_MYCLE      IDRFERAAGEPHGRPRVKLPNLAELLR--------
ADRO_SALFO      IDSEETRRGETRGKPREKMLDVGEMLQVAR-----
ADRO_BOVIN      LDAEEVSRGQASGKPREKLLDPQEMLR--------
ADRO_MOUSE      LDAEEVSRGQGTGKPREKLVDRREMLR--------
ADRO_HUMAN      LDAEEVARGQGTGKPREKLVDPQEMLR--------
ADRO_RAT        LDAEEVARGQGTGKPREKLVDRREMLQ--------
FPRB_MYCLE      IDAAEIAQGSTEGRPRRKFTDVADM----------
ADRO_DROME      INDFESAAGKAKGKPREKIVSIEEMLRVA------
ADRO_DICDI      -----------------------------------
FPRB_MYCTU      IDAAEIARGSADGRVRNKFTDVAEMLAAA------
FPRB_MYCBO      IDAAEIARGSADGRVRNKFTDVAEMLAAA------
ADRO_SCHPO      -----------------------------------
ADRO_YEAST      INKKELLRGKKEHKTRSKFLTFEEL----------
GLTB_BACSU      -----------------------------------
GLT1_SCHPO      -----------------------------------
GLSN_MEDSA      -----------------------------------
YGFT_ECOLI      -----------------------------------
GLT1_YEAST      -----------------------------------
AEGA_ECOLI      -----------------------------------
GLTD_ECOLI      -----------------------------------
GLTD_RHOSH      -----------------------------------
YEIT_SALTI      -----------------------------------
YEIT_SALTY      -----------------------------------
YEIT_ECO57      -----------------------------------
YEIT_ECOLI      -----------------------------------
GLTD_AZOBR      -----------------------------------
YGFK_ECOLI      -----------------------------------
NAOX_METJA      -----------------------------------
YGFK_ECO57      -----------------------------------
OOXA2_RHIME     -----------------------------------
FMO1_SCHPO      -----------------------------------
FMO2_MOUSE      -----------------------------------
DHPH_BACSH      -----------------------------------
Y119_XANC8      IDALDSA----------------------------
Y115_XANCP      IDALDSA----------------------------
PDXB_VESOH      -----------------------------------
DLDH2_HALMA     -----------------------------------
DHLE_BACLI      -----------------------------------