[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF55698.1

[Show Plain Result]


## Summary of Sequence Search
    1::266
   61::305     1e-48  47%  340 aa  Y480_MYCTU RecName: Full=UPF0012 hydrolase Rv0480c/MT0498;       
    5::261     4e-35  34%  276 aa  NIT2_RAT RecName: Full=Nitrilase homolog 2;         EC=3.5.-.-;
    5::260     6e-35  35%  277 aa  NIT2_DANRE RecName: Full=Nitrilase homolog 2;         EC=3.5.-.-;
    5::261     3e-34  34%  276 aa  NIT2_MOUSE RecName: Full=Nitrilase homolog 2;         EC=3.5.-.-;
   45::302     7e-34  34%  322 aa  YAUB_SCHPO RecName: Full=UPF0012 hydrolase C26A3.11;       
    5::260     6e-33  31%  276 aa  NIT2_BOVIN RecName: Full=Nitrilase homolog 2;         EC=3.5.-.-;
    5::260     1e-32  33%  276 aa  NIT2_HUMAN RecName: Full=Nitrilase homolog 2;         EC=3.5.-.-;
    5::259     2e-31  33%  275 aa  NIT2_PONAB RecName: Full=Nitrilase homolog 2;         EC=3.5.-.-;
    5::252     2e-31  33%  276 aa  NIT2B_XENLA RecName: Full=Nitrilase homolog 2-B;       
    5::252     7e-31  32%  276 aa  NIT2_XENTR RecName: Full=Nitrilase homolog 2;         EC=3.5.-.-;
    5::252     2e-30  32%  276 aa  NIT2A_XENLA RecName: Full=Nitrilase homolog 2-A;       
   54::311     1e-26  29%  328 aa  NIT2_DICDI RecName: Full=Nitrilase homolog 2;         EC=3.5.-.-;
   14::280     3e-26  36%  291 aa  NIT1_DICDI RecName: Full=Nitrilase homolog 1;         EC=3.5.-.-;
   94::251     2e-25  36%  262 aa  YBEM_ECOLI RecName: Full=Putative UPF0012 hydrolase ybeM;       
   94::251     2e-25  36%  262 aa  YBEM_ECO57 RecName: Full=UPF0012 hydrolase ybeM;       
    7::266     4e-24  32%  272 aa  Y601_SYNY3 RecName: Full=UPF0012 hydrolase sll0601;       
   45::306     4e-23  31%  323 aa  NIT1_MOUSE RecName: Full=Nitrilase homolog 1;         EC=3.5.-.-;
   11::276     7e-23  29%  291 aa  NIT3_YEAST RecName: Full=Probable hydrolase NIT3;       
   50::311     9e-23  33%  328 aa  NIT1_BOVIN RecName: Full=Nitrilase homolog 1;         EC=3.5.-.-;
   49::310     4e-22  32%  327 aa  NIT1_HUMAN RecName: Full=Nitrilase homolog 1;         EC=3.5.-.-;
   14::275     2e-21  30%  292 aa  NIT1_RAT RecName: Full=Nitrilase homolog 1;         EC=3.5.-.-;
   35::290     4e-20  33%  460 aa  NFT1_DROME RecName: Full=Nitrilase and fragile histidine triad
    7::297     6e-20  31%  307 aa  NIT2_YEAST RecName: Full=Probable hydrolase NIT2;       
   17::276     6e-20  29%  440 aa  NFT1_CAEEL RecName: Full=Nitrilase and fragile histidine triad
    5::267     8e-19  33%  276 aa  NIT2_SCHPO RecName: Full=Probable hydrolase nit2;       
   10::270     8e-19  32%  300 aa  AGUB_SOLTU RecName: Full=N-carbamoylputrescine amidase;       
   10::270     2e-18  32%  300 aa  AGUB_SOLLC RecName: Full=N-carbamoylputrescine amidase;       
   40::252     1e-17  31%  272 aa  YCU9_SCHPO RecName: Full=Probable nitrilase C965.09;       
   35::250     3e-17  29%  259 aa  MTNU_BACSU RecName: Full=UPF0012 hydrolase mtnU;       
    1::251     8e-17  28%  261 aa  YAG5_STAAU RecName: Full=UPF0012 hydrolase in agr operon;       
  107::297     4e-16  33%  326 aa  AGUB_ARATH RecName: Full=N-carbamoylputrescine amidase;       
    9::224     7e-15  29%  234 aa  YAG5_STALU RecName: Full=UPF0012 hydrolase in agr operon;AltName:
   28::284     8e-14  32%  304 aa  DCAS_AGRSK RecName: Full=N-carbamoyl-D-amino acid hydrolase;       
   28::284     2e-13  31%  304 aa  DCAS_RHIRD RecName: Full=N-carbamoyl-D-amino acid hydrolase;       
   82::276     4e-12  29%  301 aa  AGUB_ORYSJ RecName: Full=N-carbamoylputrescine amidase;       
   90::245     2e-10  30%  256 aa  YAFV_ECOLI RecName: Full=UPF0012 hydrolase yafV;       
   22::257     2e-09  30%  285 aa  YPQQ_PSEFL RecName: Full=UPF0012 hydrolase in pqqF 5'region;       
    5::244     5e-09  31%  545 aa  NADE_XYLFT RecName: Full=Probable glutamine-dependent NAD(+)
    5::244     5e-09  31%  545 aa  NADE_XYLFA RecName: Full=Probable glutamine-dependent NAD(+)
   25::304     3e-07  29%  346 aa  NRL3_ARATH RecName: Full=Nitrilase 3;         EC=3.5.5.1;
  358::492     3e-07  29%  513 aa  YHCX_BACSU RecName: Full=UPF0012 hydrolase yhcX;       
   58::280     6e-07  31%  512 aa  VNN1_MOUSE RecName: Full=Pantetheinase;       
    4::248     6e-07  27%  576 aa  NADE2_THEMA RecName: Full=Probable glutamine-dependent NAD(+)
   56::312     3e-06  28%  520 aa  VNN2_HUMAN RecName: Full=Vascular non-inflammatory molecule 2;     
   57::306     5e-05  27%  510 aa  VNN1_BOVIN RecName: Full=Pantetheinase;       
  176::279     2e-04  27%  514 aa  VNN1_CANFA RecName: Full=Pantetheinase;       
   24::266     2e-04  30%  341 aa  AMIE_BURCH RecName: Full=Aliphatic amidase;       
   24::266     2e-04  30%  341 aa  AMIE_BURCC RecName: Full=Aliphatic amidase;       
   24::266     2e-04  30%  341 aa  AMIE_BURCA RecName: Full=Aliphatic amidase;       
  166::242     3e-04  32%  504 aa  BTD_TAKRU RecName: Full=Biotinidase;         Short=Biotinase;      
   43::177     6e-04  29%  359 aa  AROB_SHESA RecName: Full=3-dehydroquinate synthase;       
   24::187     6e-04  27%  345 aa  AMIE_NOCFA RecName: Full=Aliphatic amidase;       
   59::166     0.001  29%  359 aa  AROB_SHESW RecName: Full=3-dehydroquinate synthase;       
   24::266     0.001  27%  344 aa  AMIE_VARPS RecName: Full=Aliphatic amidase;       
    1::266

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRIALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEELDGEFSTAVKELA
Y480_MYCTU      MRIALAQIRSGTDPAANLQLVGKYAGEAATAGAQLVVFPEATMCRLGVP-LRQVAEPVDGPWANGVRRIA
NIT2_RAT        -RLALIQLQVSSIKSDNITRACSLVREAAKQGANIVSLPECFNSPYGTNYFPEYAEKIPGESTKKLSEVA
NIT2_DANRE      -RLAVVQLHVSKIKADNLGRAQTLVKEAAGQGAKVVVLPECFNSPYGTGFFKEYAEKIPGESTQVLSETA
NIT2_MOUSE      -RLALIQLQVSSIKSDNLTRACSLVREAAKQGANIVSLPECFNSPYGTTYFPDYAEKIPGESTQKLSEVA
YAUB_SCHPO      -RIGLVQLANTKDKSENLQLARLKVLEAAKNGSNVIVLPEIFNSPYGTGYFNQYAEPIEESSPSALSSMA
NIT2_BOVIN      -RLALIQLQVSSIKSENLTRACGLIREASKQGAQIVSLPECFNSPYGTKYFPDYAEKIPGDSTQKLSEVA
NIT2_HUMAN      -RLALIQLQISSIKSDNVTRACSFIREAATQGAKIVSLPECFNSPYGAKYFPEYAEKIPGESTQKLSEVA
NIT2_PONAB      -RLALIQLQISSINSDNVTRACSFIREAATQGAKIVSLPECFNSPYGTKYFPEYAEKIPGESTQKLSEVA
NIT2B_XENLA     -RLSLVQFLVSPVKSDNLNKACKLIKEAAQKGAQIVALPECFNSPYGTKYFPEYAEKIPGESTELLSQVA
NIT2_XENTR      -RLSLVQFLVSPVKSENLNRACKLIKEAAQKGAQIVALPECFNSPYGTKYFPEYAEKIPGESTERLSQVA
NIT2A_XENLA     -KLSLVQFLVSPVKSDNLNRACKLIKEAAQKGAQIVALPECFNSPYGTTYFPEYAEKIPGESTELLSQVA
NIT2_DICDI      -KFAGIQLLCGDNKEENVQNAIKHIDEAAKNGAKLISLPECFNSPYSTSTFEKYSETEDGETVKKLSEAA
NIT1_DICDI      -RIGLGQITSTNNKEDNFRKCKEMIEKAVENKVNLFCLPECFAFSGGIHQFESRAEYLDGGIIERYKDLA
YBEM_ECOLI      ----------------------------------------------------------------------
YBEM_ECO57      ----------------------------------------------------------------------
Y601_SYNY3      ---AALQMTSRPNLTENLQEAEELIDLAVRQGAELVGLPE----NFAFLGNETEKLEQATAIATATEKMA
NIT1_MOUSE      --VAVCQVTSTPNKQENFKTCAELVQEAARLGACLAFLPEAFDFARNPAETLLLSEPLNGDLLGQYSQLA
NIT3_YEAST      IKVALVQLSGSSDKMANLQRAATFIERAMKEDTKLVVLPECFNSPYSTDQFRKYSEVINPEPSTSVQNLA
NIT1_BOVIN      --VAVCQVTSTPDKEQNFKTCAELIREAARLGACLAFLPEAARDPEETRRL---SEPLSGNLLEEYTQLA
NIT1_HUMAN      --VAVCQVTSTPDKQQNFKTCAELVREAARLGACLAFLPEAFD-FIARDPAETLSEPLGGKLLEEYTQLA
NIT1_RAT        --VAVCQVTSTPNKQENFKTCAELVQEATRLGACLAFLPEAFDFARNPAETXXXXXXXXXXXXXQYSQLA
NFT1_DROME      --IAVGQMRSTSDKAANLSQVIELVDRAKSQNACMLFLPECCD-FVGESRTQTLSEGLDGELMAQYRELA
NIT2_YEAST      -RVAVAQLCSSADLTKNLKVVKELISEAIQKKADVVFLPEASSQNPLHSRYLAQKSQLQSSITDLVRDNS
NFT1_CAEEL      --IAVCQMTSDNDLEKNFQAAKNMIERAGEKKCEMVFLPECFDFGLNKNEQIDLAMATDCEYMEKYRELA
NIT2_SCHPO      ---AVAQLNSSGSILKNLAICKELISQAAAKGAKCIFFPEASD--FIAHNSDEAIELTNSKFIRDVRESA
AGUB_SOLTU      --VAALQFACTDDVSTNVATAERLVRAAHQKGANIILIQELFE---GYYFCQAQKEELGHPTIVRMQNLA
AGUB_SOLLC      --VAALQFACTDDVSTNVATAERLVRAAHQKGANIILIQELFE---GYYFCQAQKEEFFHRAKVRMQNLA
YCU9_SCHPO      ----------------------------------LILFPELITSGYECGNTFTQIAEIAGEFKT-MSNLA
MTNU_BACSU      --------------------------------ADVLVLPELWTTGYXXXXXXXXXXXXGRSAQSWLKKTA
YAG5_STAAU      MKVQIYQLPVFGDSSKNETQITQWFEKNMNAEVDVVVLPEMWNNGYDLEHLNEKADNNLGQSFSFIKHLA
AGUB_ARATH      -----------------------------------------------------------------MQKLA
YAG5_STALU      ----------------------------------VVILPEMWNNGYALEQLEEKAD-FDLERSTDIKNLA
DCAS_AGRSK      --------------------LLDMLTKAASRGANFIVFPELALTTFFPRWHFTDEAELDSFYETEMPEKA
DCAS_RHIRD      --------------------LLDMLTNAASRGVNFIVFPELALTTFFPRWHFTDEAELDSFYETEMPETA
AGUB_ORYSJ      ------------------------------------------------------------------QKLA
YAFV_ECOLI      ----------------------------------------------------------------------
YPQQ_PSEFL      MRVALYQCPPRPDVAGNLQRLHQVAMEATD--ADLLVLPEMFLSGYNIGAVGALAEAQDGPSXXXXXXXX
NADE_XYLFT      LRIAMAQVAQNAERI--IALIEQARD---EHGADVVMFPELALSGYPPEDLLLRPGFL-AHCQVAIERIA
NADE_XYLFA      LRIAMAQVAQNAERI--IALIEQARD---EHGADVVMFPELALSGYPPEDLLLRPGFL-AHCQVAIERIA
NRL3_ARATH      VRVTIVQSSTVYN--DTPATL-DKAEKAASKGAKLVLFPEAFIGGYPRGFRFGLAVGVHNE------EGR
YHCX_BACSU      ----------------------------------------------------------------------
VNN1_MOUSE      ----------------NLDLLEGAIVSAAKQGAHIIVTPEIYGVRFTRDTIYPYLEEIPDPQSTPVQELA
NADE2_THEMA     LRVTLAQLNTLGDFEGNLKKAIEALRVAEDRGSDLLVFPELFLPGYPPEDLMLRLSFLNRKYLQKFAQHT
VNN2_HUMAN      ---------------ENIDILETAIKQAAEQGARIIVTPEDALYGWKFTREDPQVNWIPCQVQARLSCLA
VNN1_BOVIN      ----------------NLDLLEGAVTSASKQGAHIIVTPEDGIYGFNFTREDPQVNWIDRFGHTPVQQLA
VNN1_CANFA      ----------------------------------------------------------------------
AMIE_BURCH      ------RLHTKAEVLDNARRIADVGMKQGLPGMDLVVFPEYSTHGIMYDRQEMTASTIPGEFAAACRK-A
AMIE_BURCC      ------RLHTKAEVLDNARRIADVGMKQGLPGMDLVVFPEYSTHGIMYDRQEMTASTIPGEFAAACRK-A
AMIE_BURCA      ------RLHTKAEVLDNARRIADVGMKQGLPGMDLVVFPEYSTHGIMYDRQEMTASTIPGEFAAACRK-A
BTD_TAKRU       ----------------------------------------------------------------------
AROB_SHESA      ----------------------------------------------------------------------
AMIE_NOCFA      ------RLHTKAEVLDNCRRIADVGMKSGLPGMDLVVFPEYSTQGYDEQEMYDTAATVPGEETAIFSAAC
AROB_SHESW      ----------------------------------------------------------------------
AMIE_VARPS      ------RLHTKAEVLDNARKIGEVGMKKGLPGMDLVIFPEYSTHGYDTKEMYDTASAIPGE-ETAI--FA


                         .         .         *         .         .         .         .:140
query           DELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAGLHQGYNKIHTYDAFGYRESDTVKPGDELVVFE
Y480_MYCTU      TEAGITVIAGMFTPTGD--------GRVTNTLIAAGPGTPNQYHKIHLYDAFGFTESRXXXXXXXXXXXX
NIT2_RAT        KENSIYLIGGSIPEEDD--------GKLYNTCAVFGGNLLVKHRKIHLFDKITFQESKTLSPGDSFSTFD
NIT2_DANRE      KKCGIYLVGGSIPEEDG--------GKLYNTCSVFGGTLLVTHRKIHLFDKIRFQESETLSPGKSLSMFE
NIT2_MOUSE      KESSIYLIGGSIP--------EEDAGKLYNTCSVFGGSLLVKHRKIHLFDKITFQESKTLSPGDSFSTFD
YAUB_SCHPO      KDTKTYLFGGSIP--------ERKDGKLYNTAMVPSGKLIAVHRKIHLFDGVSFRESDSLSPGDAMTMVD
NIT2_BOVIN      KECSMYVIGGSIP--------EKDAGKLYNTCAVFGGTLLVKHRKLHLFDKITFQESETLSPGDSFSLFD
NIT2_HUMAN      KECSIYLIGGSIP--------EEDAGKLYNTCAVFGGTLLAKYRKIHLFDKITFQESKTLSPGDSFSTFD
NIT2_PONAB      KECSIYLIGGSIP--------EEDAGKLYNTCAVFGGTLLAKYRKIHLFDKITFQESKTLSPGDSFCTFD
NIT2B_XENLA     KECGIYLIGGSIPEEDS--------GKFYNTCAVFGGTLLVKHRKIHLFDKIRFQESETLSPGDSFSVFD
NIT2_XENTR      KECGIYLIGGSIPEEDS--------GKLYNTCAVFGGTLLVKHRKIHLFDKIRFQESETLSPGDSFSVFE
NIT2A_XENLA     KECGIYLIGGSIP--------EEDCGKLYNTCAVFGGTLLVKHRKIHLFDKIRFQESETLSPGDSFSVFD
NIT2_DICDI      KRNQIFLVGGSIPEID------KATGKIYNTCFIFNGEVVKKHRKIHLFDIIRFKESETLTPGDSFSVVD
NIT1_DICDI      KQNNIWLSLGGFH--------EKILDDPNNTHLISNGVIVCEYRKMHLFDVVKMNESKVVKGGNDLVVCD
YBEM_ECOLI      ----------------------------NMLVALQAGNIVARYAKLHLYDAFAIQESRRVDAGNEIALLE
YBEM_ECO57      ----------------------------NMLVALQAGNIVARYAKLHLYDAFAIQESRRVDAGNEIALLE
Y601_SYNY3      QRFQVTILAGGFPFPVAGEAGKA----YNTATLIAPNGQELAYHKVHLFDVNTYWESATVMAGQKYPVYH
NIT1_MOUSE      RECGIWLSLGGFH--ERGQDWEQNQKIYNCHVLLNSKGVVASYRKTHLCDVEPMRESNYTKPGGTLEPVK
NIT3_YEAST      NKFKIILVGGTIPELDP-----KTDKIYNTSIIFNEDGLIDKHRKVHLFDVISFHESETLSPGEKSTTID
NIT1_BOVIN      RECGLWLSLGGFH--ERGQDWEQTQKIYNCHVIMNNMGVVATYRKTHLCDVEPMRESNSTIPGPSLESIS
NIT1_HUMAN      RECGLWLSLGGFH--ERGQDWEQTQKIYNCHVLLNSKGVVATYRKTHLCDVEPMCESNSTMPGPSLESVS
NIT1_RAT        RECGIWLSLGGFH--ERGQDWEQTQKIYNCHVLLNSKGVVASYRKTHLCDVEPMRESNYTMPGYALEPVK
NFT1_DROME      KCNKIWISLG-----GVHERNDQKI--FNAHVLLNEKGLAAVYRKLHMFDVVRLRESDTVTPGERPVSTP
NIT2_YEAST      RNIDVSIGVHLPPSEQDLLEGN---DRVRNVLLIDHEGILQEYQKLHLFDVDVLKESKSVQPGKAIPIIE
NFT1_CAEEL      RKHNIWLSLGGLHHKDPSDAAHPW----NTHLIIDSDGVTRAYNKLHLFDLVRLMESEFSKAGTEMIPPV
NIT2_SCHPO      TKHSIFVNICVHEP-----------SKVKNKLLNSSLFIESRYSKAHLFDVETLKESNTTLRGEAILPPC
AGUB_SOLTU      KELGVVIPVSFFEEANN--------AHYNSVAIIDADGTDLGYRKSHIPDGPGYQEKFYFNPGDTFKVFQ
AGUB_SOLLC      KELGVVIPVSFFEEANN--------AHYNSVAIIDADGTDLGYRKSHIPDGPGYQEKYYFNPGDTFKVFQ
YCU9_SCHPO      AKYHVNIIYGF------PEKEEKQSNIIYNSCIYENGNLGGVYRKVHLFDT----ERKHFKKGSDFPIFE
MTNU_BACSU      KKHGVHIVAGSVAVRKN--------SDVYNTMYIADGQIIKEYRKAHLFQLMD--EHLYLSAGSEDGYFE
YAG5_STAAU      EKYKVDIVAG-------------SVSNIRNNQIFNTAQLINEYDKVHLVPML--REHEFLTAGEYVAEFQ
AGUB_ARATH      KELGVVIPVSFFEEANT--------AHYNSIAIIDADGTDLGYRKSHIPDGPGYQEKFYFNPGDTFKVFQ
YAG5_STALU      LQYQVDIIAGSVS--------NKHHDHIFNTAFATGKVINQ-YDKMHLVPMLDEPAFLTAGKNVPETFKL
DCAS_AGRSK      AELGIGFNLGY---AELVVEGGVK-RRFNTSILVDKSGKIVGYRKIHAYRPFQHLEKRYFEPGDGFPVYD
DCAS_RHIRD      AELGIGFNLGY---AELVVEGGVK-RRFNTSILVDKSGKIVGYRKIHAYRPFQHLEKRYFEPGDGFPVYD
AGUB_ORYSJ      KELEVVIPVSFFEEANN--------AHYNSVAIIDADGTDLGYRKSHIPDGPGYQEKFYFNPGDTFKAFK
YAFV_ECOLI      ---------------------------VNRFLLVEPGGTVHFYDKRHLFRMAD--EHLHYKAGNARVIVE
YPQQ_PSEFL      XXXXXXXLYGY--PERSVD------GQIYNAVLIDAQGQRLNYRKTHL---FGDLDHSMFSAGDDFPLVE
NADE_XYLFT      AATGIVAVVGWPQSAGSVV--------YNVASVLCDGQVEQTYRKLPNYAVFDERRYFEVDPNGSRCVFK
NADE_XYLFA      AATGIVAVVGWPQSAGSVV--------YNVASVLCDGQVEQTYRKLPNYAVFDERRYFEVDPNGSRCVFK
NRL3_ARATH      DEFRNYHASAIKVPGPEVERLAELAGK-NNVHLVMGAIEKDGYTLYCTALFFSPQKHRKVMPGSTIPVYD
YHCX_BACSU      -----------------------------------------------------------ISAGDQVRVFD
VNN1_MOUSE      KNNSIYVVANMGDPCNTSDSHCPPDGRFNTDVVFDSQG--KLVARYHKQNIFMGEDQFNVPMEPEFVTFD
NADE2_THEMA     RNLGVTVLMG-FIDSDE--------DAYNAAAVVKDGEILGVYRKISLPNYGVFDERRYFKPGEELLVVK
VNN2_HUMAN      KDNSIYVLANLGDKKPCNSRDSTCYFQYNTNVVYNTEGLVARYHKYHLYSEPQFNVPE--KP--ELVTFN
VNN1_BOVIN      KDNSIYIVANIGDKASDPQCPPDGRYQYNTDVVFDSKG--KLVARYHKQNLFLNEDQFNAPKEPEVVTFN
VNN1_CANFA      --------------------------------------------RYHKHNLFMGENQFNVPKKPEIVTFD
AMIE_BURCH      NVWGVFSITG--------ERHEAHPHKVNTLVLIDNRGIVQKYRKIMPWTPI-----EGWYPGDRTYVTD
AMIE_BURCC      NVWGVFSITG--------ERHEAHPHKVNTLVLIDNRGIVQKYRKIMPWTPI-----EGWYPGDRTYVTD
AMIE_BURCA      NVWGVFSITG--------ERHEAHPHKVNTLVLIDNRGIVQKYRKIMPWTPI-----EGWYPGDRTYVTD
BTD_TAKRU       -----------------------------NVVFRSDGLLVARYHKYNLY----FEAAFDAPPEPEIVTFD
AROB_SHESA      --------------------------------------------------------NETVAP---LYLKQ
AMIE_NOCFA      REAGVW---GVFSITGEQHEDHPRKPPYNTLVLIDDHGIVQKYRKILPWCPI-----EGWYPGDTTYVTE
AROB_SHESW      ----------------------------------------------------------------------
AMIE_VARPS      DACRRANVWGVFSLTGERHEAHPDKAPYNTLILMNNQGIVQKYRKIMPWVPI-----EGWYPGDCTYVSD


                         +         .         .         .         .         *         .:210
query           VDDIKFGVATCYDIRFPEQFKDLARNDAQVILVPTSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARL
Y480_MYCTU      XXXXXXXXXXCYDIRFPALYTELARRGAQLIAVCASWGSGPGKLEQWTLLARARALDSMSYVAAAGQA--
NIT2_RAT        TPYCRVGLGICYDMRFAELAQIYARRGCQLLVYPGAFNMTTGP-AHWELLQRARAVDNQVYVATASPA--
NIT2_DANRE      TPYCKVGVGICYDIRFAELAQIYAKKGCQLLVYPGAFNMTTGP-AHWELLQRGRAVDNQVYVATASPA--
NIT2_MOUSE      TPYCKVGLGICYDMRFAELAQIYAQRGCQLLVYPGAFNLTTGP-AHWELLQRARAVDNQVYVATASPA--
YAUB_SCHPO      TEYGKFGLGICYDIRFPELAMIAARNGCSVMIYPGAFNLSTGPL-HWELLARARAVDNEMFVACCAPA--
NIT2_BOVIN      TPYCRVGLGICYDIRFAELAQIYAQRGCQLLVYPGAFNLTTGP-AHWELLQRGRAVDNQVYVATASPA--
NIT2_HUMAN      TPYCRVGLGICYDMRFAELAQIYAQRGCQLLVYPGAFNLTTGP-AHWELLQRSRAVDNQVYVATASPA--
NIT2_PONAB      T-YCRVGLGICYDMRFAELAQIYAQRGCQLLVYPGAFNLTTGP-AHWELLQRGRAVDNQVYVATASPA--
NIT2B_XENLA     TPYCKVGVGICYDMRFAELAQIYANKGCQLLVYPGAFNMTTGP-AHWELLQRARALDNQVYVATASPA--
NIT2_XENTR      TPYCKVGVGICYDIRFAELAQLYSKKGCQLLVYPGAFNMTTGP-AHWELLQRARALDNQVYVATASPA--
NIT2A_XENLA     TPYCKVGVGICYDIRFAELAQIYANKGCQLLVYPGAFNMTTGP-AHWELLQRARALDNQVYVATASPA--
NIT2_DICDI      IGYCKIGVAICYDIRFPELAMLYSKMGAKFLIYPGAFNMVTGP-AHWELLQRGRAVDNQVFVAAISPARN
NIT1_DICDI      SPVGKLGLSICYDLRFPELYLSLRRMDAQILLVPSAFMKSTGE-AHWKPLLQARAIENQTYVIAAAQT--
YBEM_ECOLI      VEGMKVGLMTCYDLRFPEXXXXXXXXGAEILVLPAAWVRGPLKEHHWSTLLAARALDTTCYMVAAGEC--
YBEM_ECO57      VEGMKVGLMTCYDLRFPEXXXXXXXXGAEILVLPAAWVRGPLKEHHWSTLLAARALDTTCYMVAAGEC--
Y601_SYNY3      SDSFNLGLSICYDVRFPELYRYLSRQGADVLFVPAAFTAYTGK-DHWQVLLQARAIENTCYVIAPAQTGC
NIT1_MOUSE      TPAGKVGLAICYDMRFPELSLKLAQAGAEILTYSSAFGSVTGPAH-WEVLLRARAIESQCYVIAAAQCGR
NIT3_YEAST      TKYGKFGVGICYDMRFPELAMLSARKGAFAMIYPSAFNTVTGPL-HWHLLARSRAVDNQVYVMLCSPA--
NIT1_BOVIN      TPAGKIGLAICYDMRFPELSLALVQAGAEILTYPSAFGSVTGPAH-WEVLLRARAIETQCYVVAAAQCGR
NIT1_HUMAN      TPAGKIGLAVCYDMRFPELSLALAQAGAEILTYPSAFGSITGP-AHWEVLLRARAIETQCYVVAAAQCGR
NIT1_RAT        TPAGKVGLAICYDMRFPELSLKLAQAGAEILTYPSAFGSVTGPAH-WEVLLRARAIESQCYVIAAAQCGR
NFT1_DROME      VGQI--GLQICYDLRFAEPAVLLRKLGANLLTYPSAFTYATGK-AHWEILLRARAIETQCFVVAAAQIGW
NIT2_YEAST      SPLGKLGSAICYDIRFPEFSLKLRSMGAEILCFPSAFTIKTGE-AHWELLGRARAVDTQCYVLMPGQVGM
NFT1_CAEEL      DTPIRLGLSICYDVRFPELSLWNRKRGAQLLSFPSAFTLNTG-LAHWETLLRARAIENQCYVVAAAQTGA
NIT2_SCHPO      KTPLKVGSAICFDIRFPEQAIKLRNMGAHIITYPSAFTEKTG-AAHWEVLLRARALDSQCYVIAPAQGGK
AGUB_SOLTU      TKYAKIGVAICWDQWFPEAARAMALQGAEVLFYPTAQDDGLDSRDHWRRVMQGHAGANVVPLVASN--RI
AGUB_SOLLC      TKYAKIGVAICWDQWFPEAARAMALQGAEVLFYPTAQDDGLDSRDHWRRVMQGHAGANVVPLVASN--RI
YCU9_SCHPO      TSFGKLGVMICWDTAFPEVARIHALNGADLLVVATNWENPYS--DDWDLVTKARAFENCIPLVAANRVGT
MTNU_BACSU      LDGVKSSGLICYDIRFPEWIRKHTTKGANVLFISAEWP--LPRLDHWKSLLIARAIENQCFVAACN----
YAG5_STAAU      LSDGTYVTQLCYDLRFPELLRYPARSGAKIAFYVAQWP--MSRLQHWHSLLKARAIENNMFVIGTNSTGF
AGUB_ARATH      TKFAKIGVAICWDQWFPEAARAMVLQGAEILFYPTAQDQGLDSRDHWRRVMQGHAGANVVPLVASN--RI
YAG5_STALU      SNGVKVTQMICYDLRFPELLRYPARSGATIAFYVAQWPSA--RLNHWQVLLKARAIENNMYVIGCNGCGY
DCAS_AGRSK      VDAAKMGMFICNDRRWPEAWRVMGLRGAEIICTPTHNPPVPDHLTSFHLSMQAGSYQNGAWSAAAGKVGM
DCAS_RHIRD      VDAAKMGMFICNDRRWPETWRVMGLKGAEIICTPTHNPPVPDHLTSFHLSMQAGSYQNGAWSAAAGKVGM
AGUB_ORYSJ      TKYATIGVGICWDQWFPECARAMVLQGAEILFYPTAIGSEPDSREHWKRVMQGHAGANLVPLVASN--RI
YAFV_ECOLI      WRGWRILPLVCYDLRFPVWSRNL--NDYDLALYVANW-PAPRSL-HWQALLTARAIENQAYVAGCNR---
YPQQ_PSEFL      LDGWKLGFLICYDIEFPENARRLALAGAELILVPTANMIPYDFVADVTI--RARAFENQCYVAYANYCGH
NADE_XYLFT      VKGVPVGVLICEDLWFSEPLADTVCGGAELVLVPNASPYERGKHAQRDALLAERARETGAAIVVGGQDAL
NADE_XYLFA      VKGVPVGVLICEDLWFSEPLADTVCGGAELVLVPNASPYERGKHAQRDALLAERARETGAAIVVGGQDAL
NRL3_ARATH      TPIGKIGAAICWENRMPLYRTALYAKGIEIYCAPTADYS-----LEWQASMIHIAVEGGCFVLSCKRREF
YHCX_BACSU      TDCGKIAIQICYDIEFPELARIAADKGAKIIFTPFCTEDRQGYL-RVRYCSQARAVENQIYTVISGTGNL
VNN1_MOUSE      TPFGKFGVFTCFDILFHDPAVTLVTEQVDTILFPTAWMD---------VLPHLAAIEHSAWAMGMGVNFL
NADE2_THEMA     IGNIKVGVTICEDIWNPEPSASLSLGEGVHLIANLSYHVGKPVLRKDYL--SMKAYDYHVAMAYCNMVGG
VNN2_HUMAN      TAFGRFGIFTCFDIFFYDPGVTLVKDHVDTILFPTAWMN---------VLPLLTAIEHSAWAMGMGVNLL
VNN1_BOVIN      TTFGKFGIFTCFDILFHDPAVTLVRDSVDTILFPTAWMN---------VLPHLSAIEHSAWAMGMRVNFL
VNN1_CANFA      TIFGRFGVFTCFDILFYDPAVTLVKDHVDTIVFPTAWMN---------VLPHLSAIQHSAWAMGMGVNFL
AMIE_BURCH      PKGLKISLIICDDGNYPEIWRDCAMNGAELIVRCQGYM-YPAK-EQQVMVAKAMAWMNNTYVAVA-----
AMIE_BURCC      PKGLKISLIICDDGNYPEIWRDCAMNGAELIVRCQGYM-YPAK-EQQVMVAKAMAWMNNTYVAVA-----
AMIE_BURCA      PKGLKISLIICDDGNYPEIWRDCAMNGAELIVRCQGYM-YPAK-EQQVMVAKAMAWMNNTYVAVA-----
BTD_TAKRU       TPFAKFGLITCFDILFQEPTVILVEKGVRQIIFPAAWMN-------------------------------
AROB_SHESA      IQDTSFGEVTSVILPDGEQFKDLTHLDS---IFTALLQRNYGRDSVLVALGGGVIGDMTGFAAACYQRQI
AMIE_NOCFA      PKGLKISLIVCDDGNYPEIWRDCAMKGAELIV--------------------------------------
AROB_SHESW      ---VSFGEVESVILPDGEQFKDLAHLDA---IFTALLQRNYGRDSVLVALGGGVIGDMTGFAAACYQRQI
AMIE_VARPS      PKGMKMSLIICDDGNYPEIWRDCAMRGAELIIRCQGYM-YPAK-EQQILVSKAMAFMNNTYVAVANAA--


                         .         .         .         +         .         .         .:280
query           PEELRDKRNGPTGIGHSMVANPHGQVIVSAGYEPEMLIVDIDVSDLSKIREALPVL
Y480_MYCTU      --DPGDARTGPTGVGGSLVASPLGEVVVSAGTQPQLL-------------------
NIT2_RAT        ----RDEKASYVAWGHSTVVDPWGQVLTKAGTEETILYSDIDLKKLSEIRQQIPIL
NIT2_DANRE      ----RDETASYVAWGHSSVINPWGEVISKAGSEESVVYADIDLQYLADVRQQIPI-
NIT2_MOUSE      ----RDDKASYVAWGHSTVVDPWGQVLTKAGTEETILYSDIDLKKLAEIRQQIPIL
YAUB_SCHPO      ----RDMNADYHSWGHSTVVDPFGKVIATTDEKPSIVYADIDPSVMSTARNSVPI-
NIT2_BOVIN      ----RDEKASYVAWGHSTVVNPWGEVLAKAGTEETIVYADIDLKKLAEIRQQIPI-
NIT2_HUMAN      ----RDDKASYVAWGHSTVVNPWGEVLAKAGTEEAIVYSDIDLKKLAEIRQQIPV-
NIT2_PONAB      ----RDDKASYVAWGHSTVVNPWGEVLAKAGTEEAIVYSDIDLKKLAEIRQQIPV-
NIT2B_XENLA     ----RDEKASYVAWGHSTVVSPWGEVIAKAGFEETVISADIDLQYLA---------
NIT2_XENTR      ----RDEKASYVAWGHSTIVSPWGEVIAKAGSEETVISADIDLEYLA---------
NIT2A_XENLA     ----RDEKASYVAWGHSTIVSPWGEVVAKAGSEETVLSAEIDLQYLA---------
NIT2_DICDI      PSSTYQ------AWGHSTIVNSWGTILATTDEHQSIIYSDIDLNTLNETRSSIPI-
NIT1_DICDI      ----GDHHSKRSSYGHSMIIDPWGKVLHDLPDNNDIAFVDIDLDYISTCRENIPV-
YBEM_ECOLI      ---------GNKNIGQSRIIDPFGVTIAAASEMPALIMAEVTPERVRQVRAQLPVL
YBEM_ECO57      ---------GNKNIGQSRIIDPFGVTIAAASEMPALIMAEVTPERVRQVRAQLPVL
Y601_SYNY3      HYERRHTH------GHAMIIDPWGVILADAGEKPGLAIAEINPDRLKQVRQQMPSL
NIT1_MOUSE      HHETR------ASYGHSMVVDPWGTVVARCSEGPGLCLARIDLHFLQQMRQHLPV-
NIT3_YEAST      ----RNLQSSYHAYGHSIVVDPRXXXXXXXXXXXXXXXXXLDPEVIESFRQAVPL-
NIT1_BOVIN      HHEKR------ASYGHSMVVDPWGTVVARCSEGPGLCLARIDLNYLQQLRKQLPV-
NIT1_HUMAN      HHEKR------ASYGHSMVVDPWGTVVARCSEGPGLCLARIDLNYLRQLRRHLPV-
NIT1_RAT        HHETR------ASYGHSMVVDPWGTVVASCSEGPGLCLARIDLHFLQQMRQHLPV-
NFT1_DROME      HNQKRQ------SWGHSMIVSPWGNVLADCSQELDIGTAEVDLSVLQSLYQTMP--
NIT2_YEAST      PESALEKSSRRESWGHSMVIDPWGKIIAHADVGPQLILADLDRELLQEIRNKMPL-
NFT1_CAEEL      HNPKRQS------YGHSMVVDPWGAVVAQCSERVDMCFAEIDLSYVDTLREMQPV-
NIT2_SCHPO      HNEKR------ASYGHSMIVDPWGTVIASDISSPNGLIADLDLNLVDHVRTYIPLL
AGUB_SOLTU      GKEIIETEHGNSEIGYSFIAGPTGELVAAAGDKEEAVLV--AQFDLDKIK------
AGUB_SOLLC      GKEIIETEHGNSEIGYSFIAGPTGELVAAAGDKEEAVLV--AQFDLDKIK------
YCU9_SCHPO      DEKL-------SFFGHSKIIGPTGKVIKALDEEKEGVIYTVDLDDAKPLRK-----
MTNU_BACSU      ---CTGSNPDNEFAGHSLIIDPWGRVLAEGGREEGIVRAEIDLQESAEVRESIPV-
YAG5_STAAU      --------DGNTEYGHSIVINPNGDLVGELNESADILTVDLNLNEVEQQRENIPV-
AGUB_ARATH      GKEIIETEHGPSQIGTSFIAGPTGEIVAEADDKSEAVLVDLDM-------------
YAG5_STALU      --------DGKTQYGHSVAINPNGEIIQELSTTEKELTVTIDIDAVEQQRKAIPV-
DCAS_AGRSK      EENC-------MLLGHSCIVAPTGEIVLTTTLEDEVITAAVDLDRCRELRE-----
DCAS_RHIRD      EE-------GCMLLGHSCIVAPTGEIVLTTTLEDEVITAAVDLDRCRELRE-----
AGUB_ORYSJ      GRETVETEHGESTIGNSFIAGPTGEIVKLANDKDEVLVAEFDLDEIKSTR------
YAFV_ECOLI      ---VGSDGNGCHYRGDSRVINPQGEIIATAAHQATRIDAELSMAALREYREKFP--
YPQQ_PSEFL      EEQIR-------YCGQSSIAAPDGSRIALAGLDEALIIGTLD--------------
NADE_XYLFT      VFD-----------GASVVVDGHGRVPAAAAFSDQWLVVD----------------
NADE_XYLFA      VFD-----------GASVVVDGHGRVPAAAAFSDQWLVVD----------------
NRL3_ARATH      PEHVDTKEHDPTSGGGSVIISPLGKVLAGPNYESEGLVADLDLGDIARAK------
YHCX_BACSU      PQENMDIQYAQSGIAPSDFEFARDGIVGETNPNIEMVVIDVDLEILRRQRQ-----
VNN1_MOUSE      AANLHNPSRRMTGSG-----------------------------------------
NADE2_THEMA     QDEL-------VFDGGSMVVDASGEVIYGKLFEEEIITVDLDLDE-----------
VNN2_HUMAN      VANTHHVSLNMTGSG---IYAPNGPKVYHYDMKTELLLSEVDSHPLSSL-------
VNN1_BOVIN      ASNLHYPLKKMTGSGIYAPDSPRAFHYDMKTEEGKLLLAQLD--------------
VNN1_CANFA      ASNIHHPSKRMTGSG-----------------------------------------
AMIE_BURCH      ------NATGWDGVGHSAIVGFDGRTLGECG-EEEMGVQYAELS-LGMIRDA----
AMIE_BURCC      ------NATGWDGVGHSAIVGFDGRTLGECG-EEEMGVQYAELS-LGMIRDA----
AMIE_BURCA      ------NATGWDGVGHSAIVGFDGRTLGECG-EEEMGVQYAELS-LGMIRDA----
BTD_TAKRU       --------------------------------------------------------
AROB_SHESA      PTTLLSQVDSSVG-GKTAVNHPLGKNMIGAFYQPQIVIIDTECLQTLPARE-----
AMIE_NOCFA      --------------------------------------------------------
AROB_SHESW      PTTLLSQVDSSVG-GKTAVNHPLGKNMIGAFYQPQLVLID----------------
AMIE_VARPS      ---------GFDGVGHSAIIGFDGRTLGECG-EEEMGINYAELS-MGLIRDA----