[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF55730.1

[Show Plain Result]


## Summary of Sequence Search
    1::441
  111::495     5e-24  30%  512 aa  P20D1_XENTR RecName: Full=Probable carboxypeptidase PM20D1;        
  131::513     3e-23  30%  519 aa  CBPS2_DICDI RecName: Full=Probable carboxypeptidase S-like 2;      
  105::480     4e-20  28%  502 aa  P20D1_HUMAN RecName: Full=Probable carboxypeptidase PM20D1;        
  119::469     4e-16  31%  522 aa  P20D1_DANRE RecName: Full=Probable carboxypeptidase PM20D1;        
   12::380     5e-16  28%  408 aa  ACY1_HUMAN RecName: Full=Aminoacylase-1;       
    8::352     8e-16  24%  407 aa  DAPE_STAAN RecName: Full=Probable succinyl-diaminopimelate
    8::352     8e-16  24%  400 aa  DAPE_STAAM RecName: Full=Probable succinyl-diaminopimelate
  102::439     2e-15  32%  503 aa  P20D1_BOVIN RecName: Full=Probable carboxypeptidase PM20D1;        
   12::380     2e-15  28%  408 aa  ACY1_PONAB RecName: Full=Aminoacylase-1;       
    8::336     3e-15  25%  407 aa  DAPE_STAAR RecName: Full=Probable succinyl-diaminopimelate
    8::352     4e-15  24%  407 aa  DAPE_STAAW RecName: Full=Probable succinyl-diaminopimelate
    8::352     4e-15  24%  407 aa  DAPE_STAAS RecName: Full=Probable succinyl-diaminopimelate
  105::439     5e-15  29%  503 aa  P20D1_MOUSE RecName: Full=Probable carboxypeptidase PM20D1;        
   12::379     1e-14  29%  407 aa  ACY1_PIG RecName: Full=Aminoacylase-1;         EC=3.5.1.14;AltName:
   12::389     2e-14  29%  408 aa  ACY1_MOUSE RecName: Full=Aminoacylase-1;       
   12::380     2e-14  28%  408 aa  ACY1B_RAT RecName: Full=Aminoacylase-1B;       
   50::221     2e-14  34%  397 aa  DAPE_RHIME RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    1::212     4e-14  30%  397 aa  DAPE_RHILO RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   68::221     5e-14  33%  397 aa  DAPE_SINMW RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   49::211     5e-14  36%  397 aa  DAPE_RHIL3 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
  114::492     6e-14  28%  517 aa  P20D1_CHICK RecName: Full=Probable carboxypeptidase PM20D1;        
   68::211     6e-14  36%  397 aa  DAPE_RHILW RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   57::379     6e-14  31%  383 aa  DAPE_GRABC RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   68::211     8e-14  36%  397 aa  DAPE_RHIEC RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   13::385     8e-14  32%  385 aa  DAPE_GLUDA RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    1::205     8e-14  30%  395 aa  DAPE_BRUAB RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    1::205     8e-14  30%  395 aa  DAPE_BRUA2 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    1::205     8e-14  30%  395 aa  DAPE_BRUA1 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   12::380     2e-13  28%  408 aa  ACY1A_RAT RecName: Full=Aminoacylase-1A;       
    1::205     4e-13  30%  395 aa  DAPE_BRUME RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    1::205     4e-13  30%  395 aa  DAPE_BRUMB RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   68::221     7e-13  40%  380 aa  DAPE_RHOSK RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    1::205     7e-13  30%  395 aa  DAPE_BRUSU RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    1::205     7e-13  30%  395 aa  DAPE_BRUSI RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    1::205     7e-13  30%  395 aa  DAPE_BRUO2 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    1::205     7e-13  30%  395 aa  DAPE_BRUC2 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    1::376     9e-13  31%  376 aa  DAPE_ZYMMO RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   13::389     9e-13  29%  395 aa  DAPE_PARL1 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   56::226     9e-13  34%  404 aa  DAPE_AGRVS RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   68::221     1e-12  40%  380 aa  DAPE_RHOS4 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   68::221     1e-12  40%  380 aa  DAPE_RHOS1 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   67::230     1e-12  35%  383 aa  DAPE_BEII9 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   53::396     1e-12  30%  408 aa  ACY1_DICDI RecName: Full=Aminoacylase-1;       
   59::374     3e-12  26%  375 aa  DAPE_CITK8 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   68::211     4e-12  33%  398 aa  DAPE_AGRT5 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   71::225     6e-12  30%  386 aa  DAPE_RHOCS RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   66::312     6e-12  36%  395 aa  DAPE2_SILST RecName: Full=Succinyl-diaminopimelate desuccinylase 2;
   51::221     6e-12  31%  377 aa  DAPE2_SHELP RecName: Full=Succinyl-diaminopimelate desuccinylase 2;
   91::456     6e-12  26%  485 aa  CBPS1_DICDI RecName: Full=Probable carboxypeptidase S-like 1;      
   68::221     7e-12  40%  380 aa  DAPE_RHOS5 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   66::219     1e-11  30%  401 aa  DAPE_WOLTR RecName: Full=Succinyl-diaminopimelate desuccinylase;   
  178::519     2e-11  23%  596 aa  YE48_SCHPO RecName: Full=Uncharacterized carboxypeptidase C24C9.08;
   68::219     2e-11  34%  397 aa  DAPE_AGRRK RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    3::218     3e-11  31%  415 aa  Y1398_METMP RecName: Full=Uncharacterized metallohydrolase MMP1398;
   59::374     3e-11  28%  375 aa  DAPE_YERE8 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   68::227     3e-11  32%  387 aa  DAPE_METPB RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   61::217     3e-11  31%  377 aa  DAPE_LEGPL RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    7::227     4e-11  33%  385 aa  DAPE_METC4 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   61::217     4e-11  31%  377 aa  DAPE_LEGPH RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   61::217     4e-11  30%  377 aa  DAPE_LEGPC RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   61::217     4e-11  31%  377 aa  DAPE_LEGPA RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   70::343     4e-11  30%  387 aa  DAPE_CAUSK RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   57::336     4e-11  29%  381 aa  DAPE1_SILST RecName: Full=Succinyl-diaminopimelate desuccinylase 1;
   51::322     4e-11  31%  383 aa  ARGE_PECCP RecName: Full=Acetylornithine deacetylase;       
   59::374     5e-11  26%  375 aa  DAPE_SERP5 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   11::205     5e-11  29%  395 aa  DAPE_OCHA4 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    7::227     5e-11  33%  385 aa  DAPE_METEP RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    1::210     5e-11  29%  395 aa  DAPE_MESSB RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   74::205     6e-11  35%  390 aa  DAPE_MARMM RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   64::372     8e-11  28%  379 aa  DAPE_MAGSA RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   71::239     8e-11  30%  381 aa  DAPE_GLUOX RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   51::322     8e-11  30%  383 aa  ARGE_ERWCT RecName: Full=Acetylornithine deacetylase;       
   59::374     1e-10  25%  375 aa  DAPE_SALA4 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    6::222     1e-10  36%  387 aa  DAPE_RHOP5 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     1e-10  26%  375 aa  DAPE_ERWT9 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   63::206     1e-10  35%  382 aa  DAPE_ACIF5 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   63::206     1e-10  35%  382 aa  DAPE_ACIF2 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    3::362     2e-10  27%  363 aa  DAPE_CAMC1 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     2e-10  26%  375 aa  DAPE_YERPY RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     2e-10  26%  375 aa  DAPE_YERPS RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     2e-10  26%  375 aa  DAPE_YERPP RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     2e-10  26%  375 aa  DAPE_YERPN RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     2e-10  26%  375 aa  DAPE_YERPG RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     2e-10  26%  375 aa  DAPE_YERPE RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     2e-10  26%  375 aa  DAPE_YERPB RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     2e-10  26%  375 aa  DAPE_YERPA RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   68::204     2e-10  35%  382 aa  DAPE_SACD2 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   70::228     2e-10  38%  388 aa  DAPE_METSB RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     2e-10  26%  375 aa  DAPE_ENT38 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   63::216     3e-10  29%  398 aa  DAPE_WOLPP RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   51::275     3e-10  26%  381 aa  DAPE_RICAH RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   69::231     3e-10  28%  392 aa  DAPE_METRJ RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   61::201     3e-10  36%  381 aa  DAPE_EHRCR RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   61::201     3e-10  36%  380 aa  DAPE_EHRCJ RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     4e-10  26%  375 aa  DAPE_YERP3 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   51::323     4e-10  27%  383 aa  ARGE_EDWI9 RecName: Full=Acetylornithine deacetylase;       
   59::374     5e-10  25%  375 aa  DAPE_SALTI RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   66::264     5e-10  30%  384 aa  DAPE_OLICO RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    3::360     5e-10  26%  377 aa  DAPE_HAEI8 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   29::365     5e-10  28%  366 aa  DAPE_CAMLR RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   80::323     5e-10  31%  383 aa  ARGE_ENT38 RecName: Full=Acetylornithine deacetylase;       
    3::216     7e-10  32%  376 aa  DAPE_THISH RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     7e-10  25%  375 aa  DAPE_SALTY RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     7e-10  25%  375 aa  DAPE_SALSV RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     7e-10  25%  375 aa  DAPE_SALPK RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     7e-10  25%  375 aa  DAPE_SALPC RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     7e-10  25%  375 aa  DAPE_SALPB RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     7e-10  25%  375 aa  DAPE_SALPA RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     7e-10  25%  375 aa  DAPE_SALNS RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     7e-10  25%  375 aa  DAPE_SALHS RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     7e-10  25%  375 aa  DAPE_SALG2 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     7e-10  25%  375 aa  DAPE_SALEP RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     7e-10  25%  375 aa  DAPE_SALDC RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     7e-10  25%  375 aa  DAPE_SALCH RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     7e-10  25%  375 aa  DAPE_SALAR RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   57::374     7e-10  25%  375 aa  DAPE_KLEP3 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    3::360     7e-10  26%  377 aa  DAPE_HAEIN RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     7e-10  25%  375 aa  DAPE_ENTS8 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   61::374     9e-10  27%  375 aa  DAPE_ERWCT RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     9e-10  25%  375 aa  DAPE_ECOSE RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   67::199     9e-10  32%  377 aa  DAPE_ACIBY RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   67::199     9e-10  32%  378 aa  DAPE_ACIBT RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   67::199     9e-10  32%  377 aa  DAPE_ACIBS RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   67::199     9e-10  32%  378 aa  DAPE_ACIBC RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   67::199     9e-10  32%  377 aa  DAPE_ACIB5 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   67::199     9e-10  32%  377 aa  DAPE_ACIB3 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
  110::313     9e-10  27%  581 aa  CBPS2_YEAST RecName: Full=Putative carboxypeptidase YOL153C;       
   59::374     1e-09  25%  375 aa  DAPE_SHISS RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     1e-09  25%  375 aa  DAPE_SHIFL RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     1e-09  25%  375 aa  DAPE_SHIF8 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     1e-09  25%  375 aa  DAPE_SHIBS RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     1e-09  25%  375 aa  DAPE_SHIB3 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   62::368     1e-09  29%  380 aa  DAPE_MAGSM RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     1e-09  25%  375 aa  DAPE_ECOUT RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     1e-09  25%  375 aa  DAPE_ECOSM RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     1e-09  25%  375 aa  DAPE_ECOLU RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     1e-09  25%  375 aa  DAPE_ECOLI RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     1e-09  25%  375 aa  DAPE_ECOLC RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     1e-09  25%  375 aa  DAPE_ECOL6 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     1e-09  25%  375 aa  DAPE_ECOK1 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     1e-09  25%  375 aa  DAPE_ECOHS RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     1e-09  25%  375 aa  DAPE_ECODH RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     1e-09  25%  375 aa  DAPE_ECOBW RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     1e-09  25%  375 aa  DAPE_ECO8A RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     1e-09  25%  375 aa  DAPE_ECO7I RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     1e-09  25%  375 aa  DAPE_ECO5E RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     1e-09  25%  375 aa  DAPE_ECO57 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     1e-09  25%  375 aa  DAPE_ECO55 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     1e-09  25%  375 aa  DAPE_ECO45 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     1e-09  25%  375 aa  DAPE_ECO27 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     1e-09  25%  375 aa  DAPE_ECO24 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    3::376     2e-09  27%  378 aa  DAPE_THICR RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   61::374     2e-09  27%  375 aa  DAPE_TERTT RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   56::335     2e-09  31%  380 aa  DAPE_SILPO RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     2e-09  25%  375 aa  DAPE_SHIDS RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    4::375     2e-09  31%  376 aa  DAPE_SHEWM RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    1::222     2e-09  28%  387 aa  DAPE_RHOPA RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   57::374     2e-09  25%  375 aa  DAPE_KLEP7 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    3::360     2e-09  26%  377 aa  DAPE_HAEIE RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     2e-09  25%  375 aa  DAPE_ESCF3 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::374     2e-09  25%  375 aa  DAPE_ECOL5 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   74::320     2e-09  31%  380 aa  ARGE_MYXXA RecName: Full=Acetylornithine deacetylase;       
   80::322     2e-09  30%  383 aa  ARGE_ERWT9 RecName: Full=Acetylornithine deacetylase;       
    1::206     3e-09  28%  387 aa  DAPE_RHOPT RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   41::365     3e-09  26%  365 aa  DAPE_CAMJ8 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   58::197     3e-09  41%  375 aa  DAPE_STRMK RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   58::374     3e-09  32%  375 aa  DAPE_STRM5 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   69::204     3e-09  32%  390 aa  DAPE_BARQU RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   13::199     3e-09  38%  376 aa  DAPE_AZOC5 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   61::213     3e-09  29%  366 aa  DAPE_ARCB4 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   67::199     3e-09  32%  377 aa  DAPE_ACIAD RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   63::191     4e-09  30%  364 aa  DAPE_WOLSU RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   41::311     4e-09  31%  377 aa  DAPE_SPHAL RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   15::201     4e-09  26%  383 aa  DAPE_RICPR RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   15::201     4e-09  26%  381 aa  DAPE_RICFE RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    5::204     4e-09  37%  382 aa  DAPE_LEPCP RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   61::374     4e-09  27%  375 aa  DAPE_BUCAT RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   61::374     4e-09  27%  375 aa  DAPE_BUCA5 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   61::221     4e-09  28%  376 aa  DAPE1_ALTMD RecName: Full=Succinyl-diaminopimelate desuccinylase 1;
   27::281     4e-09  28%  378 aa  ARGE_VIBSL RecName: Full=Acetylornithine deacetylase;       
   63::353     6e-09  28%  365 aa  DAPE_NAUPA RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    3::360     6e-09  25%  377 aa  DAPE_HAEIG RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   67::219     6e-09  32%  383 aa  DAPE_EHRRW RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   67::219     6e-09  32%  383 aa  DAPE_EHRRG RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   66::216     6e-09  28%  384 aa  DAPE_BRASB RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   45::366     6e-09  32%  371 aa  DAPE_ACICJ RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   47::281     6e-09  29%  378 aa  ARGE_VIBVY RecName: Full=Acetylornithine deacetylase;       
   47::281     6e-09  29%  378 aa  ARGE_VIBVU RecName: Full=Acetylornithine deacetylase;       
   80::322     6e-09  31%  383 aa  ARGE_ESCF3 RecName: Full=Acetylornithine deacetylase;       
   64::343     8e-09  24%  405 aa  DAPE_STAEQ RecName: Full=Probable succinyl-diaminopimelate
   59::364     8e-09  26%  365 aa  DAPE_CAMC5 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   61::374     8e-09  27%  375 aa  DAPE_BUCAI RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    4::205     1e-08  31%  383 aa  DAPE_POLSQ RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   69::369     1e-08  29%  382 aa  DAPE_PARDP RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   80::322     1e-08  31%  385 aa  ARGE_PHOLL RecName: Full=Acetylornithine deacetylase;       
   64::343     1e-08  23%  405 aa  DAPE_STAES RecName: Full=Probable succinyl-diaminopimelate
    7::238     1e-08  27%  392 aa  DAPE_RHOPB RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   57::211     1e-08  28%  364 aa  DAPE_NITSB RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    6::375     1e-08  28%  376 aa  DAPE_MARAV RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   70::231     1e-08  39%  386 aa  DAPE_CAUCR RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   70::231     1e-08  39%  386 aa  DAPE_CAUCN RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   61::204     1e-08  31%  375 aa  DAPE_BUCAP RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    3::216     1e-08  27%  384 aa  DAPE_BRASO RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   63::385     2e-08  28%  388 aa  DAPE_JANSC RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    8::219     2e-08  33%  383 aa  DAPE_HAHCH RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   61::197     2e-08  32%  376 aa  DAPE_BUCCC RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::211     2e-08  30%  365 aa  DAPE_SULDN RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    4::205     2e-08  31%  383 aa  DAPE_POLNS RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   69::206     2e-08  40%  396 aa  DAPE_METS4 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   41::365     2e-08  26%  365 aa  DAPE_CAMJR RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::360     2e-08  27%  376 aa  DAPE_ACTSZ RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    1::221     3e-08  35%  375 aa  DAPE_XANP2 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    4::205     3e-08  30%  376 aa  DAPE_SHESH RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    4::201     3e-08  39%  379 aa  DAPE_BURA4 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   66::220     3e-08  31%  388 aa  DAPE_BRAJA RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   65::313     4e-08  26%  376 aa  DAPE_NITOC RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    4::201     4e-08  39%  379 aa  DAPE_BURS3 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    4::201     4e-08  38%  379 aa  DAPE_BURCM RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   66::198     4e-08  32%  377 aa  DAPE_ACTP7 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   66::198     4e-08  32%  377 aa  DAPE_ACTP2 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   80::322     4e-08  27%  383 aa  ARGE_ECOLU RecName: Full=Acetylornithine deacetylase;       
   58::146     5e-08  36%  377 aa  DAPE_XYLFA RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   71::210     5e-08  31%  382 aa  DAPE_SHEAM RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   64::208     5e-08  32%  386 aa  DAPE_METPP RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   80::322     5e-08  28%  383 aa  ARGE_ECO5E RecName: Full=Acetylornithine deacetylase;       
   80::322     5e-08  28%  383 aa  ARGE_ECO57 RecName: Full=Acetylornithine deacetylase;       
    3::100     6e-08  42%  376 aa  DAPE_XANC5 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   63::216     6e-08  26%  398 aa  DAPE_WOLPM RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   65::204     6e-08  33%  376 aa  DAPE_RUTMC RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   15::201     6e-08  26%  384 aa  DAPE_RICCK RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    4::197     6e-08  33%  376 aa  DAPE_LARHH RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    3::101     6e-08  41%  377 aa  DAPE_DECAR RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::189     6e-08  28%  365 aa  DAPE_CAMFF RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    4::201     6e-08  39%  379 aa  DAPE_BURM1 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    4::201     6e-08  39%  379 aa  DAPE_BURCC RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   65::216     6e-08  31%  375 aa  DAPE_AERS4 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   80::322     6e-08  28%  383 aa  ARGE_SHIB3 RecName: Full=Acetylornithine deacetylase;       
   80::322     6e-08  28%  383 aa  ARGE_ECOSE RecName: Full=Acetylornithine deacetylase;       
   80::322     6e-08  28%  383 aa  ARGE_ECOLI RecName: Full=Acetylornithine deacetylase;       
   80::322     6e-08  28%  383 aa  ARGE_ECOLC RecName: Full=Acetylornithine deacetylase;       
   80::322     6e-08  28%  383 aa  ARGE_ECOHS RecName: Full=Acetylornithine deacetylase;       
   80::322     6e-08  28%  383 aa  ARGE_ECODH RecName: Full=Acetylornithine deacetylase;       
   80::322     6e-08  28%  383 aa  ARGE_ECOBW RecName: Full=Acetylornithine deacetylase;       
   80::322     6e-08  28%  383 aa  ARGE_ECO8A RecName: Full=Acetylornithine deacetylase;       
   80::322     6e-08  28%  383 aa  ARGE_ECO55 RecName: Full=Acetylornithine deacetylase;       
   80::322     6e-08  27%  383 aa  ARGE_ECO27 RecName: Full=Acetylornithine deacetylase;       
   61::374     8e-08  31%  375 aa  DAPE_SODGM RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   67::230     8e-08  29%  389 aa  DAPE_NITHX RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    6::376     8e-08  26%  377 aa  DAPE_MANSM RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   41::365     8e-08  25%  365 aa  DAPE_CAMJE RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   62::225     8e-08  30%  381 aa  DAPE_ANAMM RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   62::225     8e-08  30%  381 aa  DAPE_ANAMF RecName: Full=Succinyl-diaminopimelate desuccinylase;   
  104::205     8e-08  35%  576 aa  CBPS_YEAST RecName: Full=Carboxypeptidase S;       
   80::322     8e-08  29%  383 aa  ARGE_SHIDS RecName: Full=Acetylornithine deacetylase;       
   80::322     8e-08  27%  383 aa  ARGE_ECOL6 RecName: Full=Acetylornithine deacetylase;       
   80::322     8e-08  27%  383 aa  ARGE_ECOL5 RecName: Full=Acetylornithine deacetylase;       
   80::322     8e-08  27%  383 aa  ARGE_ECO81 RecName: Full=Acetylornithine deacetylase;       
   80::322     8e-08  27%  383 aa  ARGE_ECO45 RecName: Full=Acetylornithine deacetylase;       
    3::197     1e-07  28%  376 aa  DAPE_VESOH RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   15::199     1e-07  29%  391 aa  DAPE_RICBR RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   15::199     1e-07  29%  391 aa  DAPE_RICB8 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   69::213     1e-07  40%  396 aa  DAPE_METNO RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   57::338     1e-07  27%  392 aa  DAPE_HELHP RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   68::211     1e-07  32%  382 aa  DAPE_CELJU RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   41::365     1e-07  25%  365 aa  DAPE_CAMJJ RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    4::217     1e-07  31%  376 aa  DAPE1_SHELP RecName: Full=Succinyl-diaminopimelate desuccinylase 1;
   80::322     1e-07  28%  383 aa  ARGE_SHIBS RecName: Full=Acetylornithine deacetylase;       
   47::111     1e-07  38%  382 aa  ARGE_MORAB RecName: Full=Acetylornithine deacetylase;       
   80::322     1e-07  27%  383 aa  ARGE_ECOSM RecName: Full=Acetylornithine deacetylase;       
   60::122     1e-07  41%  402 aa  DAPE_PSYWF RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   67::230     1e-07  28%  389 aa  DAPE_NITWN RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    3::100     1e-07  42%  375 aa  DAPE_JANMA RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   62::198     1e-07  30%  377 aa  DAPE_HAEPS RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    4::201     1e-07  38%  379 aa  DAPE_BURCH RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    4::201     1e-07  38%  379 aa  DAPE_BURCA RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    3::206     1e-07  31%  375 aa  DAPE_AERHH RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   86::328     1e-07  29%  389 aa  ARGE_YERPS RecName: Full=Acetylornithine deacetylase;       
   86::328     1e-07  29%  389 aa  ARGE_YERPE RecName: Full=Acetylornithine deacetylase;       
   86::328     1e-07  29%  389 aa  ARGE_YERP3 RecName: Full=Acetylornithine deacetylase;       
   47::111     1e-07  38%  381 aa  ARGE_MORPR RecName: Full=Acetylornithine deacetylase;       
   80::322     1e-07  28%  383 aa  ARGE_ECO7I RecName: Full=Acetylornithine deacetylase;       
   80::322     1e-07  28%  383 aa  ARGE_ECO24 RecName: Full=Acetylornithine deacetylase;       
   58::100     2e-07  57%  376 aa  DAPE_XANOR RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   58::100     2e-07  57%  376 aa  DAPE_XANOP RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   58::100     2e-07  57%  376 aa  DAPE_XANOM RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   58::199     2e-07  31%  377 aa  DAPE_VIBF1 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   71::212     2e-07  31%  381 aa  DAPE_SHESR RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   71::212     2e-07  31%  381 aa  DAPE_SHESM RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   74::215     2e-07  31%  384 aa  DAPE_SHEON RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   15::201     2e-07  24%  383 aa  DAPE_RICTY RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   61::207     2e-07  30%  375 aa  DAPE_PHOLL RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   55::334     2e-07  32%  379 aa  DAPE_DINSH RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    4::201     2e-07  30%  379 aa  DAPE_BURPP RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   82::322     2e-07  28%  383 aa  ARGE_KLEP3 RecName: Full=Acetylornithine deacetylase;       
   59::101     2e-07  52%  376 aa  DAPE_XANCP RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::101     2e-07  52%  376 aa  DAPE_XANCB RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   59::101     2e-07  52%  376 aa  DAPE_XANC8 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   58::199     2e-07  30%  377 aa  DAPE_VIBFM RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   69::210     2e-07  30%  379 aa  DAPE_SHESW RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   71::212     2e-07  31%  381 aa  DAPE_SHESA RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   69::104     2e-07  57%  381 aa  DAPE_ROSDO RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    1::216     2e-07  34%  388 aa  DAPE_RHOPS RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    1::217     3e-07  26%  410 aa  Y457_METJA RecName: Full=Uncharacterized metallohydrolase MJ0457;  
   58::146     3e-07  34%  377 aa  DAPE_XYLFM RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   69::210     3e-07  30%  379 aa  DAPE_SHEPC RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   66::216     3e-07  29%  376 aa  DAPE_SHEDO RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    3::100     3e-07  43%  375 aa  DAPE_HERAR RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   66::202     3e-07  30%  384 aa  DAPE_BLOFL RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   76::281     3e-07  29%  378 aa  ARGE_VIBHB RecName: Full=Acetylornithine deacetylase;       
   80::322     3e-07  28%  383 aa  ARGE_SHISS RecName: Full=Acetylornithine deacetylase;       
   80::322     3e-07  28%  383 aa  ARGE_SHIFL RecName: Full=Acetylornithine deacetylase;       
   80::322     3e-07  28%  383 aa  ARGE_SHIF8 RecName: Full=Acetylornithine deacetylase;       
   92::224     4e-07  32%  407 aa  DAPE_PSYA2 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   68::205     4e-07  32%  383 aa  DAPE_PSEU2 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    6::101     4e-07  39%  378 aa  DAPE_PASMU RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    4::201     4e-07  38%  379 aa  DAPE_BURCJ RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    1::211     5e-07  24%  367 aa  DAPE_SULNB RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   69::210     5e-07  31%  379 aa  DAPE_SHEB9 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   69::210     5e-07  31%  379 aa  DAPE_SHEB5 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   69::210     5e-07  31%  379 aa  DAPE_SHEB2 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   68::205     5e-07  31%  383 aa  DAPE_PSESM RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   68::205     5e-07  31%  383 aa  DAPE_PSE14 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   62::216     5e-07  31%  388 aa  DAPE_ORITI RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   67::207     5e-07  39%  375 aa  DAPE_NOVAD RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   65::204     5e-07  28%  374 aa  DAPE_COXBU RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   65::204     5e-07  28%  374 aa  DAPE_COXBR RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   65::204     5e-07  28%  374 aa  DAPE_COXBN RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   65::204     5e-07  28%  374 aa  DAPE_COXB2 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   65::204     5e-07  28%  374 aa  DAPE_COXB1 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   58::100     7e-07  52%  377 aa  DAPE_XYLFT RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   58::100     7e-07  52%  377 aa  DAPE_XYLF2 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   58::100     7e-07  55%  376 aa  DAPE_XANAC RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   70::379     7e-07  28%  381 aa  DAPE_SHEHH RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   70::211     7e-07  31%  380 aa  DAPE_SHEB8 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   10::205     7e-07  28%  383 aa  DAPE_PSEPG RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   11::205     7e-07  31%  383 aa  DAPE_PSEA7 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   64::199     7e-07  31%  377 aa  DAPE_ALISL RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    7::199     9e-07  32%  380 aa  DAPE_TOLAT RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   83::224     9e-07  31%  407 aa  DAPE_PSYCK RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   66::203     9e-07  32%  382 aa  DAPE_PSEU5 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   68::205     9e-07  31%  383 aa  DAPE_PSEPW RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   10::205     9e-07  28%  383 aa  DAPE_PSEPK RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   10::205     9e-07  28%  383 aa  DAPE_PSEP1 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   10::205     9e-07  28%  383 aa  DAPE_PSEE4 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   11::205     9e-07  31%  383 aa  DAPE_PSEAE RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   11::205     9e-07  31%  383 aa  DAPE_PSEAB RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   11::205     9e-07  31%  383 aa  DAPE_PSEA8 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   57::100     9e-07  55%  377 aa  DAPE_METCA RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   65::201     9e-07  31%  379 aa  DAPE_BURVG RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    1::221     9e-07  36%  380 aa  DAPE_BORPD RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    6::101     9e-07  40%  377 aa  DAPE_ACTPJ RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   70::103     1e-06  59%  392 aa  DAPE_RHORT RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    4::201     1e-06  30%  379 aa  DAPE_BURXL RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   69::108     2e-06  51%  383 aa  DAPE_RALME RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   68::205     2e-06  31%  383 aa  DAPE_PSEF5 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   69::141     2e-06  36%  390 aa  DAPE_BART1 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   70::221     2e-06  29%  381 aa  DAPE_SHEPW RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   57::207     2e-06  29%  377 aa  DAPE_SHEFN RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   63::200     2e-06  32%  378 aa  DAPE_PSESY RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   66::198     2e-06  32%  376 aa  DAPE_PSEA6 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   60::198     2e-06  32%  376 aa  DAPE_PROMH RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   69::204     2e-06  31%  390 aa  DAPE_BARHE RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   70::221     3e-06  29%  381 aa  DAPE_SHEPA RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   48::218     3e-06  28%  389 aa  DAPE_RHOP2 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    4::205     3e-06  39%  383 aa  DAPE_RALSO RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   69::108     3e-06  51%  383 aa  DAPE_RALEJ RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   69::108     3e-06  51%  383 aa  DAPE_RALEH RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   62::216     3e-06  31%  388 aa  DAPE_ORITB RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   69::108     3e-06  51%  383 aa  DAPE_CUPTR RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   65::224     3e-06  29%  377 aa  DAPE_ALCBS RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   11::111     4e-06  38%  392 aa  DAPE_THIDA RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   68::205     4e-06  31%  383 aa  DAPE_PSEPF RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   46::101     4e-06  44%  376 aa  DAPE_NITEU RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   79::211     4e-06  29%  399 aa  DAPE_COLP3 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   75::137     4e-06  41%  447 aa  ARGE_DICDI RecName: Full=Acetylornithine deacetylase;       
   51::201     5e-06  27%  381 aa  DAPE_RICPU RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   51::201     5e-06  27%  381 aa  DAPE_RICCN RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   51::201     5e-06  27%  381 aa  DAPE_RICAE RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   67::203     5e-06  30%  384 aa  DAPE_BLOPB RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   70::206     5e-06  40%  389 aa  DAPE_ACIAC RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   84::323     5e-06  28%  387 aa  ARGE_PROMH RecName: Full=Acetylornithine deacetylase;       
   59::140     6e-06  34%  376 aa  DAPE_WIGBR RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    4::108     6e-06  39%  391 aa  DAPE_VARPS RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   51::201     6e-06  27%  381 aa  DAPE_RICRS RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   51::201     6e-06  27%  381 aa  DAPE_RICRO RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   62::207     6e-06  28%  377 aa  DAPE_BUCBP RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   69::158     6e-06  32%  390 aa  DAPE_BARBK RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   86::132     6e-06  43%  475 aa  CNDP2_HUMAN RecName: Full=Cytosolic non-specific dipeptidase;      
   98::233     8e-06  34%  436 aa  YODQ_BACSU RecName: Full=Uncharacterized metallohydrolase yodQ;    
    1::208     8e-06  31%  386 aa  DAPE_RALPJ RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   65::101     8e-06  50%  378 aa  DAPE_NITEC RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   57::197     8e-06  31%  377 aa  DAPE_MARMS RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   82::119     1e-05  57%  470 aa  PEPV_LACDL RecName: Full=Beta-Ala-Xaa dipeptidase;       
   51::201     1e-05  27%  381 aa  DAPE_RICM5 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   61::204     1e-05  26%  377 aa  DAPE_HAES2 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   65::104     1e-05  51%  380 aa  DAPE_AZOSB RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   81::232     1e-05  29%  403 aa  YGEY_ECOLI RecName: Full=Uncharacterized protein ygeY;
   81::232     1e-05  29%  403 aa  YGEY_ECOL6 RecName: Full=Uncharacterized protein ygeY;
   81::232     1e-05  29%  403 aa  YGEY_ECO57 RecName: Full=Uncharacterized protein ygeY;
   58::199     1e-05  32%  378 aa  DAPE_VIBPA RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   64::199     1e-05  41%  380 aa  DAPE_PHEZH RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   60::204     1e-05  30%  386 aa  DAPE_DELAS RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    4::100     1e-05  41%  377 aa  DAPE_CHRVO RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   65::201     1e-05  38%  379 aa  DAPE_BURTA RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   65::201     1e-05  38%  379 aa  DAPE_BURPS RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   65::201     1e-05  38%  379 aa  DAPE_BURP6 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   65::201     1e-05  38%  379 aa  DAPE_BURP0 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   82::165     1e-05  32%  507 aa  CNDP1_HUMAN RecName: Full=Beta-Ala-His dipeptidase;       
   82::116     2e-05  54%  463 aa  PEPVL_BACSU RecName: Full=Putative dipeptidase ytjP;       
   67::199     2e-05  31%  378 aa  DAPE_VIBHB RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   61::100     2e-05  46%  375 aa  DAPE_METFK RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   86::132     2e-05  41%  475 aa  CNDP2_RAT RecName: Full=Cytosolic non-specific dipeptidase;        
   86::132     2e-05  43%  475 aa  CNDP2_PONAB RecName: Full=Cytosolic non-specific dipeptidase;      
   86::132     2e-05  41%  475 aa  CNDP2_MOUSE RecName: Full=Cytosolic non-specific dipeptidase;      
   86::132     2e-05  41%  475 aa  CNDP2_BOVIN RecName: Full=Cytosolic non-specific dipeptidase;      
   61::204     2e-05  26%  377 aa  DAPE_HAES1 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   65::201     2e-05  38%  379 aa  DAPE_BURP1 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   65::201     2e-05  38%  379 aa  DAPE_BURMS RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   65::201     2e-05  38%  379 aa  DAPE_BURMA RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   65::201     2e-05  38%  379 aa  DAPE_BURM9 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   65::201     2e-05  38%  379 aa  DAPE_BURM7 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   61::102     2e-05  55%  379 aa  DAPE_BORPE RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   61::102     2e-05  55%  379 aa  DAPE_BORPA RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   61::102     2e-05  55%  379 aa  DAPE_BORBR RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   57::140     2e-05  29%  492 aa  CNDP1_MOUSE RecName: Full=Beta-Ala-His dipeptidase;       
   67::218     3e-05  28%  377 aa  DAPE_VIBCM RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   67::218     3e-05  28%  377 aa  DAPE_VIBCH RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   67::218     3e-05  28%  377 aa  DAPE_VIBC3 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   40::116     3e-05  30%  401 aa  DAPE_VEREI RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   66::101     3e-05  51%  378 aa  DAPE_NITMU RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   63::105     3e-05  48%  384 aa  DAPE_AZOSE RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   67::102     4e-05  51%  381 aa  DAPE_NEIMF RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   67::102     4e-05  51%  381 aa  DAPE_NEIMB RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   67::102     4e-05  51%  381 aa  DAPE_NEIMA RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   67::102     4e-05  51%  381 aa  DAPE_NEIM0 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   67::102     4e-05  51%  381 aa  DAPE_NEIG2 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   67::102     4e-05  51%  381 aa  DAPE_NEIG1 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   76::219     4e-05  28%  378 aa  DAPE_ERYLH RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   65::375     4e-05  26%  375 aa  DAPE_ALHEH RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   70::196     5e-05  42%  377 aa  DAPE_SPHWW RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   77::209     5e-05  41%  391 aa  DAPE_DIAST RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   77::209     5e-05  41%  391 aa  DAPE_ACISJ RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   78::112     5e-05  49%  381 aa  ARGE_BUCAP RecName: Full=Acetylornithine deacetylase;       
   67::102     7e-05  54%  377 aa  DAPE_PHOPR RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   57::101     7e-05  47%  376 aa  DAPE_HAEDU RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   65::104     7e-05  46%  379 aa  DAPE_BURP8 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   79::287     7e-05  28%  382 aa  ARGE_PASMU RecName: Full=Acetylornithine deacetylase;       
   83::129     9e-05  41%  406 aa  DAPE_POLNA RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   68::336     9e-05  28%  383 aa  DAPE_HELPH RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   65::100     9e-05  54%  377 aa  DAPE_BORA1 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   88::140     9e-05  37%  492 aa  CNDP1_RAT RecName: Full=Beta-Ala-His dipeptidase;       
   67::102     1e-04  51%  377 aa  DAPE_PSYIN RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   67::208     1e-04  29%  377 aa  DAPE_VIBVU RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   67::102     1e-04  51%  378 aa  DAPE_VIBSL RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   64::218     1e-04  34%  378 aa  DAPE_HALHL RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   62::136     2e-04  32%  361 aa  LYSK_THET8 RecName: Full=Acetyl-lysine deacetylase;       
   62::136     2e-04  32%  361 aa  LYSK_THET2 RecName: Full=Acetyl-lysine deacetylase;       
   54::178     2e-04  30%  362 aa  LYSK_DEIRA RecName: Full=Acetyl-lysine deacetylase;       
    3::112     2e-04  34%  391 aa  DAPE_RHOFD RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   65::202     2e-04  28%  380 aa  DAPE_PSEMY RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   91::130     2e-04  46%  425 aa  DAPE_POLSJ RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    9::214     2e-04  26%  369 aa  DAPE_CORGL RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   66::192     2e-04  27%  367 aa  DAPE_CAMHC RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   81::156     2e-04  35%  383 aa  ARGE_SALAR RecName: Full=Acetylornithine deacetylase;       
   67::208     3e-04  29%  377 aa  DAPE_VIBVY RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   66::101     3e-04  49%  376 aa  DAPE_IDILO RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   68::227     3e-04  27%  383 aa  DAPE_HELPY RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   73::116     3e-04  48%  388 aa  DAPE_HELPG RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   68::111     3e-04  48%  383 aa  DAPE_HELP2 RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   78::131     3e-04  35%  474 aa  CPGL_SCHPO RecName: Full=Glutamate carboxypeptidase-like protein;
   78::111     4e-04  50%  383 aa  DAPE_HELAH RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   14::208     4e-04  29%  386 aa  DAPE_CHRSD RecName: Full=Succinyl-diaminopimelate desuccinylase;   
   66::101     6e-04  49%  376 aa  DAPE_PSEHT RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    1::204     6e-04  24%  384 aa  DAPE_PELUB RecName: Full=Succinyl-diaminopimelate desuccinylase;   
  367::509     7e-04  30%  589 aa  PESC_MONBE RecName: Full=Pescadillo homolog;
   83::116     0.001  50%  388 aa  DAPE_HELPJ RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    1::441

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTLYDETLTLLQELIRNACVNDLTPDSGQEIRNAESLERFFEGTPNVEITKLEPRPGRTSIIVTVPGSDP
P20D1_XENTR     --------------------------------------------------------GGYSHLFKVQGSDH
CBPS2_DICDI     -----------------------------------------------------------SLVYNWKGLDE
P20D1_HUMAN     -----------------------------------------------------------SHLFTIQGSDP
P20D1_DANRE     --------------------------------------------------------GNYSHLFTIAGTDA
ACY1_HUMAN      ------SVTLFRQYLRIRTVQP-KPDYGAAVA-------FFEETARLGCQKVEVAPGYVVTVLTWPGTNP
DAPE_STAAN      -----EKIQLLADIV------ELQTENNNEIDVCNYLKDLFDKY-DIKSEILKVNEHRANIVAEIGNGSP
DAPE_STAAM      -----EKIQLLADIV------ELQTENNNEIDVCNYLKDLFDKY-DIKSEILKVNEHRANIVAEIGNGSP
P20D1_BOVIN     --------------------------------------------------------GNYSHLFTIKGSDP
ACY1_PONAB      ------SVTLFRQYLRIRTVQP-KPDYGAAVAFFEERARQL----GLGCQKVEVAPGYVVTVLTWPGTNP
DAPE_STAAR      -----EKIQLLADIV------ELQTENNNEIDVCNYLKDLFDKY-DIKSEILKVNEHRANFVAEIGSGSP
DAPE_STAAW      -----EKIQLLADIV------ELQTENNNEIDVCNYLKDLFDKY-DIKSEILKVNEHRANIVAEIGNGSP
DAPE_STAAS      -----EKIQLLADIV------ELQTENNNEIDVCNYLKDLFDKY-DIKSEILKVNEHRANIVAEIGNGSP
P20D1_MOUSE     -----------------------------------------------------------SHLFTIQGSDP
ACY1_PIG        ------SVTLFRQYLRIRTVQP-EPDYGAAVAFLEERARQL----GLGCQKVEVVPGHVVTVLTWPGTNP
ACY1_MOUSE      ------SVTLFRQYLR-ICTVQPNPDYGGAITFLEERARQL----GLSCQKIEVVPGFVITVLTWPGTNP
ACY1B_RAT       ------SVTLFRQYLRIRTVQP-KPDYGAAVA-------FFEETARLGCQKVEVAPGYVVTVLTWPGTNP
DAPE_RHIME      ------------------------------------------GTPDIE--NLYARTG---------GEGP
DAPE_RHILO      MTLPTDPAANLAALIRCASV---TPAEGGALGALETMLKPLGFLVDRPVFSEDGTPDIENLYARRSGNGP
DAPE_SINMW      ----------------------------------------------------------------------
DAPE_RHIL3      -----------------------------------------EGTPDIE--NLYARLGT------------
P20D1_CHICK     --------------------------------------------------------GEYSHLFTVQGSDS
DAPE_RHILW      ----------------------------------------------------------------------
DAPE_GRABC      -----------------------------------------------------------------PRSGP
DAPE_RHIEC      ----------------------------------------------------------------------
DAPE_GLUDA      -------LTLARDLIRAPSV---TPDDGGAIGVLTAALRGL----GFDVTDLPEGPARTNLFARLGRSGP
DAPE_BRUAB      MTLPVNPVDNLAALIRCPSV---TPAEGGALTALEKMLKLMGFSANRPVFSDDNTPDIENLYARKSGNGP
DAPE_BRUA2      MTLPVNPVDNLAALIRCPSV---TPAEGGALTALEKMLKLMGFSANRPVFSDDNTPDIENLYARKSGNGP
DAPE_BRUA1      MTLPVNPVDNLAALIRCPSV---TPAEGGALTALEKMLKLMGFSANRPVFSDDNTPDIENLYARKSGNGP
ACY1A_RAT       ------SVTLFRQYLR-ICTVQPNPDYGSAVTFLEERARQL----GLSCQKIEVAPGYVITVLTWPGTNP
DAPE_BRUME      MTLPVNPVDNLAALIRCPSV---TPAEGGALTALEKMLKLMGFSANRPVFSDDNTPDIENLYARKSGNGP
DAPE_BRUMB      MTLPVNPVDNLAALIRCPSV---TPAEGGALTALEKMLKLMGFSANRPVFSDDNTPDIENLYARKSGNGP
DAPE_RHOSK      ----------------------------------------------------------------------
DAPE_BRUSU      MTLPVNPADNLAALIRCPSV---TPAEGGALTALEKMLKLMGFSANRPVFSDDNTPDIENLYARKSGNGP
DAPE_BRUSI      MTLPVNPADNLAALIRCPSV---TPAEGGALTALEKMLKLMGFSANRPVFSDDNTPDIENLYARKSGNGP
DAPE_BRUO2      MTLPVNPADNLAALIRCPSV---TPAEGGALTALEKMLKLMGFSANRPVFSDDNTPDIENLYARKSGNGP
DAPE_BRUC2      MTLPVNPADNLAALIRCPSV---TPAEGGALTALEKMLKLMGFSANRPVFSDDNTPDIENLYARKSGNGP
DAPE_ZYMMO      MTIAPDPVDLAARLI--ACKSVTPSDDGAMNIMADALKS--AGFTVHLLTKGQAPDGPVTNLIAIRGE--
DAPE_PARL1      -----DPLDIAVELIRCPSV---TPDEGGALGKCERMRFSAEGTPDVD-----------NLYARLGSGHP
DAPE_AGRVS      -----------------------------------------EGTPDVE-----------NLYARLGTEGP
DAPE_RHOS4      ----------------------------------------------------------------------
DAPE_RHOS1      ----------------------------------------------------------------------
DAPE_BEII9      ----------------------------------------------------------------------
ACY1_DICDI      --------------------------------------------------------GTPIVLMKIEGLEP
DAPE_CITK8      ----------------------------------------------------------------------
DAPE_AGRT5      ----------------------------------------------------------------------
DAPE_RHOCS      ----------------------------------------------------------------------
DAPE2_SILST     ------------------------------------------------------------------GEDR
DAPE2_SHELP     --------------------------------------------------------------------DE
CBPS1_DICDI     -----------------------------------------------------------SLLFEWTGSDK
DAPE_RHOS5      ----------------------------------------------------------------------
DAPE_WOLTR      ----------------------------------------------------------------------
YE48_SCHPO      ------------------------------------------------------------LLITLEGSNK
DAPE_AGRRK      ----------------------------------------------------------------------
Y1398_METMP     -SILDETIELSSDLISINSVNPTFGGIGEKEKSIYIKNKLEEYNKNYSIKNCEITEYNT---VDSEGIEP
DAPE_YERE8      ----------------------------------------------------------------------
DAPE_METPB      ----------------------------------------------------------------------
DAPE_LEGPL      ----------------------------------------------------------------------
DAPE_METC4      -------LALAQALIRCPSV---TPEEGGALRAGFSVERFSEGTPDIQ--NLYARIGTAGPV--------
DAPE_LEGPH      ----------------------------------------------------------------------
DAPE_LEGPC      ----------------------------------------------------------------------
DAPE_LEGPA      ----------------------------------------------------------------------
DAPE_CAUSK      ----------------------------------------------------------------------
DAPE1_SILST     ------------------------------------------------------------------GDKA
ARGE_PECCP      --------------------------------------------------EVQPVPGTLNKFNMLARIGE
DAPE_SERP5      ----------------------------------------------------------------------
DAPE_OCHA4      ----------LAALIRCASV---TPAEGGALTALEAMLKPMGFSVERPVFHDEDTPDIENLYARKSGNGP
DAPE_METEP      -------LALAQALIRCPSV---TPEEGGALRAGFSVERFSEGTPDIQ--NLYARIGTAGPV--------
DAPE_MESSB      MTLPTDPAQNLASLIR---CRSVTPVEGGALTALEAMLRPLGARVDRPVFSEEGEADVENLYARIGKDGP
DAPE_MARMM      ----------------------------------------------------------------------
DAPE_MAGSA      ----------------------------------------------------------------------
DAPE_GLUOX      ----------------------------------------------------------------------
ARGE_ERWCT      --------------------------------------------------EVQPVPGTLNKFNMLARIGE
DAPE_SALA4      ----------------------------------------------------------------------
DAPE_RHOP5      -----DALSIARDLLR--CPSVTPADAGA----LDVLDRLLRGA-GFEVHRVTSEPGAADIDNLYARIGT
DAPE_ERWT9      ----------------------------------------------------------------------
DAPE_ACIF5      ----------------------------------------------------------------------
DAPE_ACIF2      ----------------------------------------------------------------------
DAPE_CAMC1      -------VSFLKELLN---FRSITPD------DAGSLEFIAKFLPDFEAKFIEKNGTKNLILSKIYG---
DAPE_YERPY      ----------------------------------------------------------------------
DAPE_YERPS      ----------------------------------------------------------------------
DAPE_YERPP      ----------------------------------------------------------------------
DAPE_YERPN      ----------------------------------------------------------------------
DAPE_YERPG      ----------------------------------------------------------------------
DAPE_YERPE      ----------------------------------------------------------------------
DAPE_YERPB      ----------------------------------------------------------------------
DAPE_YERPA      ----------------------------------------------------------------------
DAPE_SACD2      ----------------------------------------------------------------------
DAPE_METSB      ----------------------------------------------------------------------
DAPE_ENT38      ----------------------------------------------------------------------
DAPE_WOLPP      ----------------------------------------------------------------------
DAPE_RICAH      ----------------------------------------------------------TNLYAIFGRNEP
DAPE_METRJ      ----------------------------------------------------------------------
DAPE_EHRCR      ----------------------------------------------------------------------
DAPE_EHRCJ      ----------------------------------------------------------------------
DAPE_YERP3      ----------------------------------------------------------------------
ARGE_EDWI9      --------------------------------------------------EMQPVPNTRNKFNLLANYGE
DAPE_SALTI      ----------------------------------------------------------------------
DAPE_OLICO      ----------------------------------------------------------------------
DAPE_HAEI8      ----EKVVSLAQDLIRRPSISP--NDEGCQQIIAERLEKLIEWMPFNDTLNLWAKHGTSEPVIA------
DAPE_CAMLR      ----------------------------------------------VELSEFEAKEGVKNLLLTKKFSD-
ARGE_ENT38      ----------------------------------------------------------------------
DAPE_THISH      -----DTLDLAQELIRRRSV---TPDAGCQQLIAERLAPLFEDVDNLWLRRGSEGP--------------
DAPE_SALTY      ----------------------------------------------------------------------
DAPE_SALSV      ----------------------------------------------------------------------
DAPE_SALPK      ----------------------------------------------------------------------
DAPE_SALPC      ----------------------------------------------------------------------
DAPE_SALPB      ----------------------------------------------------------------------
DAPE_SALPA      ----------------------------------------------------------------------
DAPE_SALNS      ----------------------------------------------------------------------
DAPE_SALHS      ----------------------------------------------------------------------
DAPE_SALG2      ----------------------------------------------------------------------
DAPE_SALEP      ----------------------------------------------------------------------
DAPE_SALDC      ----------------------------------------------------------------------
DAPE_SALCH      ----------------------------------------------------------------------
DAPE_SALAR      ----------------------------------------------------------------------
DAPE_KLEP3      ----------------------------------------------------------------------
DAPE_HAEIN      ----EKVVSLAQDLIRRPSISP--NDEGCQQIIAERLEKLIEWMPFNDTLNLWAKHGTSEPVIA------
DAPE_ENTS8      ----------------------------------------------------------------------
DAPE_ERWCT      ----------------------------------------------------------------------
DAPE_ECOSE      ----------------------------------------------------------------------
DAPE_ACIBY      ----------------------------------------------------------------------
DAPE_ACIBT      ----------------------------------------------------------------------
DAPE_ACIBS      ----------------------------------------------------------------------
DAPE_ACIBC      ----------------------------------------------------------------------
DAPE_ACIB5      ----------------------------------------------------------------------
DAPE_ACIB3      ----------------------------------------------------------------------
CBPS2_YEAST     --------------------NPLPNDDPEYYSEFFKLHKYFEETPLVHSHLKVEKVNQLGLLYTWEGTDP
DAPE_SHISS      ----------------------------------------------------------------------
DAPE_SHIFL      ----------------------------------------------------------------------
DAPE_SHIF8      ----------------------------------------------------------------------
DAPE_SHIBS      ----------------------------------------------------------------------
DAPE_SHIB3      ----------------------------------------------------------------------
DAPE_MAGSM      ----------------------------------------------------------------------
DAPE_ECOUT      ----------------------------------------------------------------------
DAPE_ECOSM      ----------------------------------------------------------------------
DAPE_ECOLU      ----------------------------------------------------------------------
DAPE_ECOLI      ----------------------------------------------------------------------
DAPE_ECOLC      ----------------------------------------------------------------------
DAPE_ECOL6      ----------------------------------------------------------------------
DAPE_ECOK1      ----------------------------------------------------------------------
DAPE_ECOHS      ----------------------------------------------------------------------
DAPE_ECODH      ----------------------------------------------------------------------
DAPE_ECOBW      ----------------------------------------------------------------------
DAPE_ECO8A      ----------------------------------------------------------------------
DAPE_ECO7I      ----------------------------------------------------------------------
DAPE_ECO5E      ----------------------------------------------------------------------
DAPE_ECO57      ----------------------------------------------------------------------
DAPE_ECO55      ----------------------------------------------------------------------
DAPE_ECO45      ----------------------------------------------------------------------
DAPE_ECO27      ----------------------------------------------------------------------
DAPE_ECO24      ----------------------------------------------------------------------
DAPE_THICR      -----ETIQLAQKLIQTESV---TPDNGCQTLIADYLKPLIEPMPFGEVENLWARAGKDGPVIV------
DAPE_TERTT      ----------------------------------------------------------------------
DAPE_SILPO      ------------------------------------------------------------------GDKG
DAPE_SHIDS      ----------------------------------------------------------------------
DAPE_SHEWM      -----EVLTLAQDLISRPSVTPL--DEGCQTLMAERLAQGFEIESMVDTTNMWARRGKEGPL--------
DAPE_RHOPA      MTSTPTALSIAQDLLR--CPSVTPADAGA----LDVLETLLKGAGFTVHRVTFSEPGTADIDNLYARIGN
DAPE_KLEP7      ----------------------------------------------------------------------
DAPE_HAEIE      ----EKVVSLAQDLIRRPSISP--NDEGCQQIIAEGLEKLIEWMPFNDTLNLWAKHGTSEPVIA------
DAPE_ESCF3      ----------------------------------------------------------------------
DAPE_ECOL5      ----------------------------------------------------------------------
ARGE_MYXXA      ----------------------------------------------------------------------
ARGE_ERWT9      ----------------------------------------------------------------------
DAPE_RHOPT      MTSTPTALSIAQDLLR--CPSVTPADAGA----LDVLETLLKGAGFTVHRVTFSEPGTADIDNLYARIGN
DAPE_CAMJ8      ------------------------------------------------------KEGIKNLLLTKKFND-
DAPE_STRMK      ----------------------------------------------------------------------
DAPE_STRM5      ----------------------------------------------------------------------
DAPE_BARQU      ----------------------------------------------------------------------
DAPE_AZOC5      ----------------------VTPDAGQXXXXXXXVERLVFSTAGVPVDNLYARIGTAS---------P
DAPE_ARCB4      ----------------------------------------------------------------------
DAPE_ACIAD      ----------------------------------------------------------------------
DAPE_WOLSU      ----------------------------------------------------------------------
DAPE_SPHAL      -----------------------------------TVERFIDG--------IEPDGPVENLLAVRRGSGP
DAPE_RICPR      ----------------------VTPNSAGAIEYIDDLLKQHSFKTEIKIFGDSKKEQVTNLYAIFGGNEP
DAPE_RICFE      ----------------------VTPESDGAIEYIDDLLKQHGFKTEIKIFGDSKSEQATNLYAVFGSNEP
DAPE_LEPCP      ------TLSLVEELIARRSV---TPDDAQALIAARLAALGFE----IHALPHGPADARVDNLWAIRRGQG
DAPE_BUCAT      ----------------------------------------------------------------------
DAPE_BUCA5      ----------------------------------------------------------------------
DAPE1_ALTMD     ----------------------------------------------------------------------
ARGE_VIBSL      -------------------------DHGNE-KVIEKMAQWFKDVGSVEVVEVEP--GKHNMVAKMGSGEG
DAPE_NAUPA      ----------------------------------------------------------------------
DAPE_HAEIG      ----EKVVSLAQDLIHRSSISP--NDEGCQKIIAERLEKLIEWMPFNDTLNLWAKHGTSEPVIA------
DAPE_EHRRW      ----------------------------------------------------------------------
DAPE_EHRRG      ----------------------------------------------------------------------
DAPE_BRASB      ----------------------------------------------------------------------
DAPE_ACICJ      ------------------------------------------------------RFGEVSNLVARRGS--
ARGE_VIBVY      ---------------------------------------------DVDVTEVEP--GKYNLLAQKGQGEG
ARGE_VIBVU      ---------------------------------------------DVDVTEVEP--GKYNLLAQKGQGEG
ARGE_ESCF3      ----------------------------------------------------------------------
DAPE_STAEQ      ----------------------------------------------------------------------
DAPE_CAMC5      ----------------------------------------------------------------------
DAPE_BUCAI      ----------------------------------------------------------------------
DAPE_POLSQ      ------TLELTEALI--ACHSVTPADGGCQDLIAKRLESVVSGPENFQVTNLWA--------IKKGKAGD
DAPE_PARDP      ----------------------------------------------------------------------
ARGE_PHOLL      ----------------------------------------------------------------------
DAPE_STAES      ----------------------------------------------------------------------
DAPE_RHOPB      -----DALAIAQDLLR--CPSVTPADAGA----LGVLERLLHAAGFAVHRVTFSEPGTADIDNLYARIGT
DAPE_NITSB      ----------------------------------------------------------------------
DAPE_MARAV      ------TLELAKDLIRRQSV---TPDDAQELMMSRLAPLGFSGE--------NLRFGETDNLWARKGN--
DAPE_CAUCR      ----------------------------------------------------------------------
DAPE_CAUCN      ----------------------------------------------------------------------
DAPE_BUCAP      ----------------------------------------------------------------------
DAPE_BRASO      -----DALTITRDLIRCPSV---TPADAGALGVLEALLKQ-AGFTTHRVTFSEPGTADIDNLYARIGTE-
DAPE_JANSC      ------------------------------------------------------------------GTRG
DAPE_HAHCH      ------TLELAVELIKRPSV---TPDAGQELLSQRLQTIGFEITPFGEVQNFWARRGSQAPLVV------
DAPE_BUCCC      ----------------------------------------------------------------------
DAPE_SULDN      ----------------------------------------------------------------------
DAPE_POLNS      ------TLKLTEALI--ACHSVTPADGGCQDLIAKRLESVVSGPENFQVTNLWA--------IKKGKAGD
DAPE_METS4      ----------------------------------------------------------------------
DAPE_CAMJR      ------------------------------------------------------KEGIKNLLLTKKFKD-
DAPE_ACTSZ      ----------------------------------------------------------------------
DAPE_XANP2      -------MALAAELIRAPSVTPHADDALELVAKGYRVERLTFETGGVPIPNLYARIGTDG---------P
DAPE_SHESH      -----DVLTLAQDLISRESVTPLDEGCQQLMADRLSAKGFIESMVFDDTTNMWARRG-------------
DAPE_BURA4      ------TLALTEQLIARASV---TPDDQQQIMTERLAALGFE-------CETIASHGVTNLWAVKRGADG
DAPE_BRAJA      ----------------------------------------------------------------------
DAPE_NITOC      ----------------------------------------------------------------------
DAPE_BURS3      ------TLALTEQLIARASV---TPDDQQQIMTERLTALGFE-------CETIASHGVTNLWAVKRGTDG
DAPE_BURCM      ------TLALTEQLIARASV---TPDDQQQLMTERLAALGFE-------CETIASHGVTNLWAVKRGADG
DAPE_ACTP7      ----------------------------------------------------------------------
DAPE_ACTP2      ----------------------------------------------------------------------
ARGE_ECOLU      ----------------------------------------------------------------------
DAPE_XYLFA      ----------------------------------------------------------------------
DAPE_SHEAM      ----------------------------------------------------------------------
DAPE_METPP      ------------------------------------------------------------------GRSA
ARGE_ECO5E      ----------------------------------------------------------------------
ARGE_ECO57      ----------------------------------------------------------------------
DAPE_XANC5      -----DVLELTCDLIARASV---TPDAGCQAAIAQRLRAAGFGCEHLRLGEVEN-------LWATHGS--
DAPE_WOLPM      ----------------------------------------------------------------------
DAPE_RUTMC      ----------------------------------------------------------------------
DAPE_RICCK      ----------------------VTPESNLAIEYIDDLLKKHGFKTEIKIFGDSKSEQVTNLYAVYGNGKP
DAPE_LARHH      ------TLELACELIRR---NSTTPDDAQELMIAR-LER-------IGFTVERMRFGEVDNFWARRGSD-
DAPE_DECAR      ----DTTLELAKRII--ACASVTPEDAGCMIERLKPLGFSIEFINRNGVTNLWARRGTTAPL--------
DAPE_CAMFF      ----------------------------------------------------------------------
DAPE_BURM1      ------TLALTEQLIARASV---TPDDQQQIMTERLAALGFD-------CETVASHGVTNLWAVKRGTDG
DAPE_BURCC      ------TLALTEQLIARASV---TPDDQQQIMTERLAALGFE-------CETIASHGVTNLWAVKRGTDG
DAPE_AERS4      ----------------------------------------------------------------------
ARGE_SHIB3      ----------------------------------------------------------------------
ARGE_ECOSE      ----------------------------------------------------------------------
ARGE_ECOLI      ----------------------------------------------------------------------
ARGE_ECOLC      ----------------------------------------------------------------------
ARGE_ECOHS      ----------------------------------------------------------------------
ARGE_ECODH      ----------------------------------------------------------------------
ARGE_ECOBW      ----------------------------------------------------------------------
ARGE_ECO8A      ----------------------------------------------------------------------
ARGE_ECO55      ----------------------------------------------------------------------
ARGE_ECO27      ----------------------------------------------------------------------
DAPE_SODGM      ----------------------------------------------------------------------
DAPE_NITHX      ----------------------------------------------------------------------
DAPE_MANSM      -------INLAQDLIRRPSISP--DDQGCQQVIAERLTKLIEWMSFNDTINLWAKHGTTSPVVA------
DAPE_CAMJE      ------------------------------------------------------KEGIKNLLLTKKFKD-
DAPE_ANAMM      ----------------------------------------------------------------------
DAPE_ANAMF      ----------------------------------------------------------------------
CBPS_YEAST      -------------------VQDKNPNPADDYKHFYELHDYFEKTPNIHKHLKLEKVNELGLLYTWEGSDP
ARGE_SHIDS      ----------------------------------------------------------------------
ARGE_ECOL6      ----------------------------------------------------------------------
ARGE_ECOL5      ----------------------------------------------------------------------
ARGE_ECO81      ----------------------------------------------------------------------
ARGE_ECO45      ----------------------------------------------------------------------
DAPE_VESOH      -----KTLTLAKKLVS---IDSITPQD----KGCQSIMISHLNDLNFEITDL--KFGEVDNFWAIRGQQ-
DAPE_RICBR      ----------------------LTPQSNGAIEYIDDLLKEHGFKTEVKIF------GETEQVTNLYAVYG
DAPE_RICB8      ----------------------LTPQSNGAIEYIDDLLKEHGFKTEVKIF------GETEQVTNLYAVYG
DAPE_METNO      ----------------------------------------------------------------------
DAPE_HELHP      -------------------------------------------------------------LIAPKGADK
DAPE_CELJU      ----------------------------------------------------------------------
DAPE_CAMJJ      ------------------------------------------------------KEGIKNLLLTKKFKD-
DAPE1_SHELP     -----DVLTLAQDLIARASVTPL--DEGCQPLMAKRLAKGFNIEPMVDTTNMWARRGDQGPL--------
ARGE_SHIBS      ----------------------------------------------------------------------
ARGE_MORAB      ---------------------------------------------SINITSVPETNGKFNLVATYGQGDG
ARGE_ECOSM      ----------------------------------------------------------------------
DAPE_PSYWF      ----------------------------------------------------EQASGRDAQVKNLWARRG
DAPE_NITWN      ----------------------------------------------------------------------
DAPE_JANMA      -----KTLALTEELI---ALSSVTPDKGCQSRLIELLEPLGFVCETIEVTNLWARKGTTQPL--------
DAPE_HAEPS      ----------------------------------------------------------------------
DAPE_BURCH      ------TLALTEQLIARASV---TPDDQQQIMTERLAALGFE-------CETIASHGVTNLWAVKRGTDG
DAPE_BURCA      ------TLALTEQLIARASV---TPDDQQQIMTERLAALGFE-------CETIASHGVTNLWAVKRGTDG
DAPE_AERHH      -----DVIALAKDLIRRPSVTPL--DEGCQTLMAERLAKLFVIEPMVDTTNLWARRGSEGPL--------
ARGE_YERPS      ----------------------------------------------------------------------
ARGE_YERPE      ----------------------------------------------------------------------
ARGE_YERP3      ----------------------------------------------------------------------
ARGE_MORPR      ---------------------------------------------SINITSVPETNGKFNLVATYGQGDG
ARGE_ECO7I      ----------------------------------------------------------------------
ARGE_ECO24      ----------------------------------------------------------------------
DAPE_XANOR      ----------------------------------------------------------------------
DAPE_XANOP      ----------------------------------------------------------------------
DAPE_XANOM      ----------------------------------------------------------------------
DAPE_VIBF1      ----------------------------------------------------------------------
DAPE_SHESR      ----------------------------------------------------------------------
DAPE_SHESM      ----------------------------------------------------------------------
DAPE_SHEON      ----------------------------------------------------------------------
DAPE_RICTY      ----------------------VTPNSAGAVEYIDGLLKQHGFKTEIKIFGDSKNERVTNLYGVFGSNEP
DAPE_PHOLL      ----------------------------------------------------------------------
DAPE_DINSH      ------------------------------------------------------------------GEKG
DAPE_BURPP      ------TLALTEQLIARASV---TPDDQHCQRLL--IERL--AALGFEHETIESN-GVTNLWAVKRGVDG
ARGE_KLEP3      ----------------------------------------------------------------------
DAPE_XANCP      ----------------------------------------------------------------------
DAPE_XANCB      ----------------------------------------------------------------------
DAPE_XANC8      ----------------------------------------------------------------------
DAPE_VIBFM      ----------------------------------------------------------------------
DAPE_SHESW      ----------------------------------------------------------------------
DAPE_SHESA      ----------------------------------------------------------------------
DAPE_ROSDO      ----------------------------------------------------------------------
DAPE_RHOPS      MTSSRDALSIAQALLRCPSV---TPADAGALGVLETLLKDAGFTAH-RVTFSEP--GAADIDNLYARIGD
Y457_METJA      MDLIEEAIKLESDLIRINSVNPSFGGKGEKEKAEYVKKKLMEYVESYNIENYTLKEERPNIVFKIDGRD-
DAPE_XYLFM      ----------------------------------------------------------------------
DAPE_SHEPC      ----------------------------------------------------------------------
DAPE_SHEDO      ----------------------------------------------------------------------
DAPE_HERAR      -----KTLALTEELI---ALSSVTPDKGCQSRLIELLSPLGFVCETIEVTNLWARKG-------------
DAPE_BLOFL      ----------------------------------------------------------------------
ARGE_VIBHB      ----------------------------------------------------------------------
ARGE_SHISS      ----------------------------------------------------------------------
ARGE_SHIFL      ----------------------------------------------------------------------
ARGE_SHIF8      ----------------------------------------------------------------------
DAPE_PSYA2      ----------------------------------------------------------------------
DAPE_PSEU2      ----------------------------------------------------------------------
DAPE_PASMU      -------IELARELIRRPSISP--DDQGCQQIIAERLERLIEWLPFNDTLNLWAKHGSGSPVIA------
DAPE_BURCJ      ------TLALTEQLIARASV---TPDDQQQIMTERLAALGFE-------CETIASHGVTNLWAVKRGTDG
DAPE_SULNB      -------MNVVDLLMKLLSFKSVTPDDAGSLAFIESYLKGYEAT-------YVNKEGVKNLFLTKKFSE-
DAPE_SHEB9      ----------------------------------------------------------------------
DAPE_SHEB5      ----------------------------------------------------------------------
DAPE_SHEB2      ----------------------------------------------------------------------
DAPE_PSESM      ----------------------------------------------------------------------
DAPE_PSE14      ----------------------------------------------------------------------
DAPE_ORITI      ----------------------------------------------------------------------
DAPE_NOVAD      ----------------------------------------------------------------------
DAPE_COXBU      ----------------------------------------------------------------------
DAPE_COXBR      ----------------------------------------------------------------------
DAPE_COXBN      ----------------------------------------------------------------------
DAPE_COXB2      ----------------------------------------------------------------------
DAPE_COXB1      ----------------------------------------------------------------------
DAPE_XYLFT      ----------------------------------------------------------------------
DAPE_XYLF2      ----------------------------------------------------------------------
DAPE_XANAC      ----------------------------------------------------------------------
DAPE_SHEHH      ----------------------------------------------------------------------
DAPE_SHEB8      ----------------------------------------------------------------------
DAPE_PSEPG      ------TLQLACDLIRRPSVTPVDADCQAQMMNRLGAVGF----------ELEPMRIEDVDNFWATHGSQ
DAPE_PSEA7      ------TLELACELIRRPSVTPVDADQALMMRRLEAAGFALEPMRIEEVDNFWARRG---------GDGP
DAPE_ALISL      ----------------------------------------------------------------------
DAPE_TOLAT      -------LSLAKDLIARPSVTPI--DEGCQKMMAEFLAPLFEIEPMVDTTNLWARRGTTGPV--------
DAPE_PSYCK      ----------------------------------------------------------------------
DAPE_PSEU5      ----------------------------------------------------------------------
DAPE_PSEPW      ----------------------------------------------------------------------
DAPE_PSEPK      ------TLQLACDLIRRPSVTPVDADCQAQMMNRLGAVGF----------QLEPMRIEDVDNFWATHGSQ
DAPE_PSEP1      ------TLQLACDLIRRPSVTPVDADCQAQMMNRLGAVGF----------QLEPMRIEDVDNFWATHGSQ
DAPE_PSEE4      ------TLQLACDLIRRPSVTPVDADCQTQMMNRLGAVGF----------QLEPMRFEDVDNFWATHGTQ
DAPE_PSEAE      ------TLELACELIRRPSVTPLDADQALMMRRLEAAGFALEPMRIEEVDNFWARRG---------GDGP
DAPE_PSEAB      ------TLELACELIRRPSVTPLDADQALMMRRLEAAGFALEPMRIEEVDNFWARRG---------GDGP
DAPE_PSEA8      ------TLELACELIRRPSVTPLDADQALMMRRLEAAGFALEPMRIEEVDNFWARRG---------GDGP
DAPE_METCA      ----------------------------------------------------------------------
DAPE_BURVG      ----------------------------------------------------------------------
DAPE_BORPD      MTADSAVLALVRELIARPSV---TPDDVDQLLLAQRLEHACETIARGDVTNLWARRG-------------
DAPE_ACTPJ      -------INLAQDLIRRPSISPA--DQGCQQVIAERLAQLLEWLPFGDTLNLWAKHGSGSPVVA------
DAPE_RHORT      ----------------------------------------------------------------------
DAPE_BURXL      ------TLALTEQLIARASV---TPDDQHCQRLL--IERL--AALGFEHETIESN-GVTNLWAVKRGVDG
DAPE_RALME      ----------------------------------------------------------------------
DAPE_PSEF5      ----------------------------------------------------------------------
DAPE_BART1      ----------------------------------------------------------------------
DAPE_SHEPW      ----------------------------------------------------------------------
DAPE_SHEFN      ----------------------------------------------------------------------
DAPE_PSESY      ----------------------------------------------------------------------
DAPE_PSEA6      ----------------------------------------------------------------------
DAPE_PROMH      ----------------------------------------------------------------------
DAPE_BARHE      ----------------------------------------------------------------------
DAPE_SHEPA      ----------------------------------------------------------------------
DAPE_RHOP2      -------------------------------------------------------PGTADIDNLYARIGD
DAPE_RALSO      ------TLALTEDLIRRRSV---TPDKGCQDVLIERLETVVSGPDHFRVTNLAVKRGRA-------GTD-
DAPE_RALEJ      ----------------------------------------------------------------------
DAPE_RALEH      ----------------------------------------------------------------------
DAPE_ORITB      ----------------------------------------------------------------------
DAPE_CUPTR      ----------------------------------------------------------------------
DAPE_ALCBS      ----------------------------------------------------------------------
DAPE_THIDA      --LASETLALAVELLKRRSV---TPDDAGIAARLQALGFHIERHRHNDVDNLWARRGTASPVVC------
DAPE_PSEPF      ----------------------------------------------------------------------
DAPE_NITEU      --------------------------------------------------------GEVENLWTRKGSD-
DAPE_COLP3      ----------------------------------------------------------------------
ARGE_DICDI      -------------------------------------------------------PKRGNIIIEYPGSKG
DAPE_RICPU      ----------------------------------------------------------TNLYAVFGSNEP
DAPE_RICCN      ----------------------------------------------------------TNLYAVFGSNEP
DAPE_RICAE      ----------------------------------------------------------TNLYAVFGSNEP
DAPE_BLOPB      ----------------------------------------------------------------------
DAPE_ACIAC      ----------------------------------------------------------------------
ARGE_PROMH      ----------------------------------------------------------------------
DAPE_WIGBR      ----------------------------------------------------------------------
DAPE_VARPS      ------TLQLAEQLISRPSV---TPDDAQQIRLGFTLETIESGPADFRVTNLWA--------VRRPAGTA
DAPE_RICRS      ----------------------------------------------------------TNLYAVFGSNEP
DAPE_RICRO      ----------------------------------------------------------TNLYAVFGSNEP
DAPE_BUCBP      ----------------------------------------------------------------------
DAPE_BARBK      ----------------------------------------------------------------------
CNDP2_HUMAN     ------------------------------------------------------------------GSDP
YODQ_BACSU      ----------------------------------------------------------------------
DAPE_RALPJ      MSHIQPTLALTEDLIRRRSV---TPDKGCQDVLIERLETVISGPDHFRVTNLAVKRGRA-------GTD-
DAPE_NITEC      ----------------------------------------------------------------------
DAPE_MARMS      -------------------------------------------------------------------SGP
PEPV_LACDL      ----------------------------------------------------------------------
DAPE_RICM5      ----------------------------------------------------------TNLYAVFGSNEP
DAPE_HAES2      ----------------------------------------------------------------------
DAPE_AZOSB      ----------------------------------------------------------------------
YGEY_ECOLI      ----------------------------------------------------------------------
YGEY_ECOL6      ----------------------------------------------------------------------
YGEY_ECO57      ----------------------------------------------------------------------
DAPE_VIBPA      ----------------------------------------------------------------------
DAPE_PHEZH      ----------------------------------------------------------------------
DAPE_DELAS      ------------------------------------------------------------------GTGA
DAPE_CHRVO      ------TLDLARELIRR---DSVTPDEGCQALMIERLEAI-----GFKVEKM--RHGDVDNFWARRG---
DAPE_BURTA      ----------------------------------------------------------------------
DAPE_BURPS      ----------------------------------------------------------------------
DAPE_BURP6      ----------------------------------------------------------------------
DAPE_BURP0      ----------------------------------------------------------------------
CNDP1_HUMAN     ---------------------------------ADTLQRLGARVASVDMGPQQLPDGQSPVILAELGSDP
PEPVL_BACSU     ----------------------------------------------------------------------
DAPE_VIBHB      ----------------------------------------------------------------------
DAPE_METFK      ----------------------------------------------------------------------
CNDP2_RAT       ------------------------------------------------------------------GSDP
CNDP2_PONAB     ------------------------------------------------------------------GSDP
CNDP2_MOUSE     ------------------------------------------------------------------GSDP
CNDP2_BOVIN     ------------------------------------------------------------------GSDP
DAPE_HAES1      ----------------------------------------------------------------------
DAPE_BURP1      ----------------------------------------------------------------------
DAPE_BURMS      ----------------------------------------------------------------------
DAPE_BURMA      ----------------------------------------------------------------------
DAPE_BURM9      ----------------------------------------------------------------------
DAPE_BURM7      ----------------------------------------------------------------------
DAPE_BORPE      ----------------------------------------------------------------------
DAPE_BORPA      ----------------------------------------------------------------------
DAPE_BORBR      ----------------------------------------------------------------------
CNDP1_MOUSE     ---------------------------------ADKLRNLGAGVESIDLGSQQMPDGQSPILLAELGSDP
DAPE_VIBCM      ----------------------------------------------------------------------
DAPE_VIBCH      ----------------------------------------------------------------------
DAPE_VIBC3      ----------------------------------------------------------------------
DAPE_VEREI      -------------------------------------ERMDSGPARQRVSNLWAKRPVAQVPDAHDASKT
DAPE_NITMU      ----------------------------------------------------------------------
DAPE_AZOSE      ----------------------------------------------------------------------
DAPE_NEIMF      ----------------------------------------------------------------------
DAPE_NEIMB      ----------------------------------------------------------------------
DAPE_NEIMA      ----------------------------------------------------------------------
DAPE_NEIM0      ----------------------------------------------------------------------
DAPE_NEIG2      ----------------------------------------------------------------------
DAPE_NEIG1      ----------------------------------------------------------------------
DAPE_ERYLH      ----------------------------------------------------------------------
DAPE_ALHEH      ----------------------------------------------------------------------
DAPE_SPHWW      ----------------------------------------------------------------------
DAPE_DIAST      ----------------------------------------------------------------------
DAPE_ACISJ      ----------------------------------------------------------------------
ARGE_BUCAP      ----------------------------------------------------------------------
DAPE_PHOPR      ----------------------------------------------------------------------
DAPE_HAEDU      ----------------------------------------------------------------------
DAPE_BURP8      ----------------------------------------------------------------------
ARGE_PASMU      ----------------------------------------------------------------------
DAPE_POLNA      -------------------------------------------------------------------SQA
DAPE_HELPH      ----------------------------------------------------------------------
DAPE_BORA1      ----------------------------------------------------------------------
CNDP1_RAT       ------------------------------------------------------------IILAELGNDP
DAPE_PSYIN      ----------------------------------------------------------------------
DAPE_VIBVU      ----------------------------------------------------------------------
DAPE_VIBSL      ----------------------------------------------------------------------
DAPE_HALHL      ----------------------------------------------------------------------
LYSK_THET8      ----------------------------------------------------------------------
LYSK_THET2      ----------------------------------------------------------------------
LYSK_DEIRA      --------------------------------------------------------------VGVRGSGP
DAPE_RHOFD      -----KTLHLAEQLIARP---SLTPDAGCQQIIAERLETITSGPADFRVTNLWAKRAAAP----VKSAQH
DAPE_PSEMY      ----------------------------------------------------------------------
DAPE_POLSJ      ----------------------------------------------------------------------
DAPE_CORGL      LDLLGDPIVLTQRLV------DIPSPSGQEKQIADEIEDALRNLPGVEVFRFNNN-------VLARTNRG
DAPE_CAMHC      ----------------------------------------------------------------------
ARGE_SALAR      ----------------------------------------------------------------------
DAPE_VIBVY      ----------------------------------------------------------------------
DAPE_IDILO      ----------------------------------------------------------------------
DAPE_HELPY      ----------------------------------------------------------------------
DAPE_HELPG      ----------------------------------------------------------------------
DAPE_HELP2      ----------------------------------------------------------------------
CPGL_SCHPO      ------------------------------------------------------------IVLGQYGNDP
DAPE_HELAH      ----------------------------------------------------------------------
DAPE_CHRSD      ------TLALAFDLLRR---HSVTPDAGCQALMIERLERL-----GFQVERL--RIGEVDNFWATRGE--
DAPE_PSEHT      ----------------------------------------------------------------------
DAPE_PELUB      MPTYNE-ITLAKELIRFPSITPI--DAGVMKFLAKKLTTIGFKCKILEFKDKNSKPVK-NLYARLGNTQP
PESC_MONBE      ----------------------------------------------------------------------
DAPE_HELPJ      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           NAEPLTLLGHTDVVPVDLPKWTKDPFGAEISDGQIWGRGSVDMLFIXXXXXXXXXXXXXEGGLRGTLTFV
P20D1_XENTR     NLLPYMLLAHIDVVPAPPESWEVPPFSGEERDGYIYGRGTLDDKNCVIGILQSLEFLLKRGHKPRRSFYI
CBPS2_DICDI     SLKPILLAGHIDVVPLFLDKWTHPPFSGHIDDTYIWGRGTMDDKGSVMAILESVEDLLSQGKPQRSIYFA
P20D1_HUMAN     SLQPYLLMAHFDVVPAPEEGWEVPPFSGLERDGVIYGRGTLDDKNSVMXXXXXXXXXXIRKYIPRRSFFI
P20D1_DANRE     DLEPYMLLAHIDVVPAEADGWDAPPFSAQEINGFIYGRGTIDNKQSVMGILQALEYLLEKGYTPRRTFYI
ACY1_HUMAN      TLSSILLNSHTDVVPVFKEHWSHDPFEAKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGRFPRTIHMT
DAPE_STAAN      I---LALSGHMDVVDANQDNWTYPPFQLTEKAGKLYGRGTTDMKGGLMALVITLIELKEQNQLQGTIRLL
DAPE_STAAM      I---LALSGHMDVVDANQDNWTYPPFQLTEKAGKLYGRGTTDMKGGLMALVITLIELKEQNQLQGTIRLL
P20D1_BOVIN     SMQPYILLAHIDVVPAPDKGWDVPPFSGLERDGFIYGRGTLDNKNYXXXXXXXXXXXXXRNYIPRRSFFI
ACY1_PONAB      TLSSILLNSHTDVVPVFKEHWSHDPFEAKDSEGYIYARGAQDMKCISIQYLEAVRRLKVEGRFPRTIHMT
DAPE_STAAR      I---LALSGHMDVVDANQDNWTYPPFQLTEKDDKLYGRGTTDMKGGLMALVIALIELKEQNQLQGTIRLL
DAPE_STAAW      I---LALSGHMDVVDANQDNWTYPPFQLTEKAGKLYGRGTTDMKGGLMALVITLIELKEQNQLQGTIRLL
DAPE_STAAS      I---LALSGHMDVVDANQDNWTYPPFQLTEKAGKLYGRGTTDMKGGLMALVITLIELKEQNQLQGTIRLL
P20D1_MOUSE     SLQPYMLMAHIDVVPAPEEGWEVPPFSGLERNGFIYGRGALDNKNSVMAILHALELLLIRNYSPKRSFFI
ACY1_PIG        TLSSILLNSHTDVVPVFKEHWSHDPFGFKDADGYIYGRGAQDMKCVSIQYLEAVRRLKVEGHFPRTIHMT
ACY1_MOUSE      SLPSILLNSHTDVVPVFKEHWHHDPFEAKDSEGYIYARGSQDMKSVSIQYLEAVRRLKSEGRFPRTIHMT
ACY1B_RAT       TLSSILLNSHTDVVPVFKEHWSHDPFEAKDSEGYIYTRGAQDMKCVSIQYLEAVKRLKVEGRFPRTIHMT
DAPE_RHIME      H---LMFAGHTDVVPVDEAAWSRPPFSAAIAEGEMYGRGAVDMKGIACFVAAVARHIEKHGAPKGSISFL
DAPE_RHILO      H---LMFAGHTDVVPVDEAAWTHPPFAAEIANGEMYGRGAVDMKGIACFVAAIARHVENNGGPKGSVSLL
DAPE_SINMW      ----LMFAGHTDVVPVDEIAWSHPPFSAAIAEGEMYGRGAVDMKGIACFVAAVARHIEKHGAPKGSISFL
DAPE_RHIL3      DGPHLMFAGHTDVVPVDEAAWTHPPFAAEISKGELFGRGAVDMKGIACFVAAVARHIEKSGQPKGSISFL
P20D1_CHICK     EMMPYMLLAHMDVVPAPPEGWDFPPFSAAEHEGFIYGRGTLDNKNSAIGILQALEFLLRRNYRPRRSFYV
DAPE_RHILW      ----LMFAGHTDVVPVDEADWTHPPFAAEISKGELFGRGAVDMKGIACFIAAVARHIEKNGPPKGSISFL
DAPE_GRABC      H---LCFAGHTDVVPPGDAPWSVDAFAGEVHDGVLIGRGACDM---KGAIASFVAACAARPDHPGTISLL
DAPE_RHIEC      ----LMFAGHTDVVPVDEAAWTHPPFAAEISNGELFGRGAVDMKGIACFVAAVARHIEKSGPPAGSISFL
DAPE_GLUDA      H---LCFAGHTDVVPPGDGGWTSGPFEAALRDGCLYGRGACDMKGGIAAFVGAVARILESGTLRGSVSLL
DAPE_BRUAB      H---LMFAGHTDVVPPDEKDWKHPPFAAEIEDGVMYGRGAVDMKGIACFVAAVARHIEKHGNIKGSISFL
DAPE_BRUA2      H---LMFAGHTDVVPPDEKDWKHPPFAAEIEDGVMYGRGAVDMKGIACFVAAVARHIEKHGNIKGSISFL
DAPE_BRUA1      H---LMFAGHTDVVPPDEKDWKHPPFAAEIEDGVMYGRGAVDMKGIACFVAAVARHIEKHGNIKGSISFL
ACY1A_RAT       LLHSILLNSHTDVVPVFKEHWHHDPFEAKDSEGYIYARGAQDMKSVSIQYLEAVRRLKSEGRFPRTIHMT
DAPE_BRUME      H---LMFAGHTDVVPPDEKDWKHPPFAAAIEDGVMYGRGAVDMKGIACFVAAVARHIEKHGNIKGSISFL
DAPE_BRUMB      H---LMFAGHTDVVPPDEKDWKHPPFAAAIEDGVMYGRGAVDMKGIACFVAAVARHIEKHGNIKGSISFL
DAPE_RHOSK      --------GHTDVVPVDAAAWTRDPFGGEIADGWLWGRGATDMKSGXXXXXXXXXXXXQETPPDGAVVLT
DAPE_BRUSU      H---LMFAGHTDVVPPDEKDWKHPPFAAAIEDGVMYGRGAVDMKGIACFVAAVARHIEKHGNIKGSISFL
DAPE_BRUSI      H---LMFAGHTDVVPPDEKDWKHPPFAAAIEDGVMYGRGAVDMKGIACFVAAVARHIEKHGNIKGSISFL
DAPE_BRUO2      H---LMFAGHTDVVPPDEKDWKHPPFAAAIEDGVMYGRGAVDMKGIACFVAAVARHIEKHGNIKGSISFL
DAPE_BRUC2      H---LMFAGHTDVVPPDEKDWKHPPFAAAIEDGVMYGRGAVDMKGIACFVAAVARHIEKHGNIKGSISFL
DAPE_ZYMMO      GYPHLAYAGHSDVVPAG-QGWSSDPFTPTIKDGYLVGRGAVDMKSSVAAFIAAASRYTEH---KGTLSLL
DAPE_PARL1      H---FCFAGHTDVVPVQADAWSVDPFAADIKDGRLYGRGAADMKSAVASFVAAAERISRE-GFQGSISLL
DAPE_AGRVS      H---LMFAGHTDVVPVNEADWTYPPFSAEIAGGELYGRGAVDMKGIACFVAAIARHIESQGAPKGSISFL
DAPE_RHOS4      --------GHTDVVPVDAAAWTRDPFGGEIADGWLWGRGATDMKSGXXXXXXXXXXXXQETPPDGAVVLT
DAPE_RHOS1      --------GHTDVVPVDAAAWTRDPFGGEIADGWLWGRGATDMKSGXXXXXXXXXXXXQETPPDGAVVLT
DAPE_BEII9      ----LVFAGHTDVVPVGTATWRFDPFAAKVEDGQLWGRGAADMKXXXXXXXXXXXXXEQHKDFKGSIAFL
ACY1_DICDI      NLKTVLLNSHVDVVPAVHDSWKVDPFSAKDESGNIFGRGTQDMKCVCMQFLEVARRIVQSGKLKRTLHLS
DAPE_CITK8      --ETLAFAGHTDVVPADVDRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPDHQGRLAFL
DAPE_AGRT5      ----LMFAGHTDVVPVDEAAWSHPPFSADIAGGEMYGRGAVDMKGIACFVAAIARHIGKHGKPQGSVSFL
DAPE_RHOCS      --------GHTDVVPADAAAWTVDPFGGEIIDGRLYGRGAADMKGVAAFIAAVGSFLERNGPPAGSISLL
DAPE2_SILST     NGRTFGFNGHTDVVPIGDPKWTVDPFGAEIRDGILYGRGSTDMKSGVXXXXXXXIEFVNETPPDGRVIIA
DAPE2_SHELP     RPAQLALAGHTDVVPPDLSRWQTPPFAATLVDGMLIGRGAVDMKSLAVMLAAVEDHIACYGLPKANWQFI
CBPS1_DICDI     TLKPLLLNSHYDVVPVTESEWTFNPWG-EIRNDNIYGRGSIDNKVIVMATMESIEAILANNYTQPIRTYL
DAPE_RHOS5      --------GHTDVVPVDAAAWTRDPFGGEIADGWLWGRGATDMKSGXXXXXXXXXXXXQETPPDGAVILT
DAPE_WOLTR      ----LCFAGHVDVVPPQLKDWISDPFSPEVRDGLLYGRGATDMAFITAMVDLVAEKFRFNGSISALITSA
YE48_SCHPO      DLKPLVLMGHQDVVPVNLDRWYFPPFSATYHNGHVYSRGAADVAILEALEILAISDYKPEQTVIASFGF-
DAPE_AGRRK      ----LMFAGHTDVVPVDAASWSHPPFAADIAGGELFGRGAVDMKGIACFAAAVARHIEKHGPPAGSISFL
Y1398_METMP     NIDTLTIISHMDIVPEDLGLWNSDPFKAEIKDGIIYGRGSEDHKGIVSSFLLLKMIFEEKIDPKYNLNLI
DAPE_YERE8      --ETLAFAGHTDVVPTDESHWCSPPFEPTIRDGMLYGRGAADMKSLAAMVVAAERFVAAHPNHKGRLAFM
DAPE_METPB      ----LVFAGHTDVVPPEAASWTHGPFSGEITDGFLYGRGAVDMKGGIACMLAATLSFLDRHGFGGSIAFL
DAPE_LEGPL      ----LVFAGHTDVVPVEVSKWDTDPFSLEEKNGMLYGRGVADMKSLACMLHMARRFIKTYPSFPGRLGFL
DAPE_METC4      ----LVFAGHTDVVPPETEAWTHGPFSGEVADGFLYGRGAVDMKIACMLAATLAFLDRHRPDFGGSIAFL
DAPE_LEGPH      ----LVFAGHTDVVPVEVSKWDTDPFSLEEKSGVLYGRGVADMKSLACMLHMARRFIKTYPSFPGRLGFL
DAPE_LEGPC      ----LVFAGHTDVVPVEVSKWDTDPFSLEEKNGVLYGRGVADMKSLACMLHMARRFIKTYPSFPGRLGFL
DAPE_LEGPA      ----LVFAGHTDVVPVEVSKWDTDPFSLEEKSGVLYGRGVADMKSLACMLHMARRFIKTYPSFPGRLGFL
DAPE_CAUSK      ----LCFAGHTDVVPVDSAAWTQGPFEAEIQDGMLYGRGAVDMKSAIAAFVAAVSNLPRD--LPGSLSFL
DAPE1_SILST     HARTFGFNGHTDVVPIDEAAWTHDPFGAEIVEGVMYGRGTTDMKSGVXXXXXXXIDFVQDTPPDGAVVLT
ARGE_PECCP      GKGGLLLAGHTDTVPFDDGRWTRDPFTLTEHDNKLYGLGTADMKGFFAFILDALRDIDPT-KLTKPLYVL
DAPE_SERP5      --QTLAFAGHTDVVPTDEKRWDNPPFEPTIRDGMLYGRGAADMKSLAAMVVAAERFVAANPHHQGRLAFL
DAPE_OCHA4      H---LMFAGHTDVVPPNEGDWKHPPFSAAIEDGVMYGRGAVDMKGVACFVAAVARHIEKHGSIKGSVSFL
DAPE_METEP      ----LVFAGHTDVVPPEVGSWTHGPFSGEVAEGFLYGRGAVDMKGGIACMLAATLAFLDRHGFGGSIAFL
DAPE_MESSB      H---LMFAGHTDVVPPDEDAWTHPPFAAEIAGGEMFGRGAVDMKGIACFVAALARHLEVSGTPKGSVSFL
DAPE_MARMM      --------GHTDVVPPDDDAWRKPPFGAEAEDGVLWGRGAADMKGAIAAMVASVQRFLDTGEPKGSIAFL
DAPE_MAGSA      -APNLCFAGHTDVVPPG-KGWTVEPFAAGIDQGRLFGRGSADMKGAIACFVAAVARLLEDGAPKGSLSLL
DAPE_GLUOX      ----LCFAGHTDVVPPG-EGWAHDPFAAVIEGDRLYGRGIADMKGGVACFVAAVARRLEQGPLKGSVSLL
ARGE_ERWCT      GKGGLLLAGHTDTVPFDDGRWTRDPFTLTEHDNKLYGLGTADMKGFFAFILDALRDIDPT-KLTKPLYVL
DAPE_SALA4      --ETLAFAGHTDVVPADVDRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPHHRGRLAFL
DAPE_RHOP5      GAPHLMFAGHTDVVPPDVSAWSHGAFAGEVADGQLYGRGAVDMKGIXXXXXXXXXXXXXXGGQKGSISFL
DAPE_ERWT9      --ETLAFAGHTDVVPTDVTRWNNPPFEPTIRDGMLYGRGAADMKSLAAMVVAAERFVANYPQHEGRLAFL
DAPE_ACIF5      ----LCFAGHTDVVPSGLAEWQNDPFQPIIRDGMLYGRGAADMKSLAAMVVAAERFVALHPAHSGRLAFL
DAPE_ACIF2      ----LCFAGHTDVVPSGLAEWQNDPFQPIIRDGMLYGRGAADMKSLAAMVVAAERFVALHPAHSGRLAFL
DAPE_CAMC1      DGEHLAFAGHVDVVPPG-DGWDSEPFTPLEKDGYIYARGSQDM----KSGVAAFVCAAKEAKFEGKLSLI
DAPE_YERPY      --ETLAFAGHTDVVPTDESHWHSPPFEPTIRDGMLYGRGAADMKSLAAMIVAAERFVAAHPDHKGRLAFM
DAPE_YERPS      --ETLAFAGHTDVVPTDESHWHSPPFEPTIRDGMLYGRGAADMKSLAAMIVAAERFVAAHPDHKGRLAFM
DAPE_YERPP      --ETLAFAGHTDVVPTDESHWHSPPFEPTIRDGMLYGRGAADMKSLAAMIVAAERFVAAHPDHKGRLAFM
DAPE_YERPN      --ETLAFAGHTDVVPTDESHWHSPPFEPTIRDGMLYGRGAADMKSLAAMIVAAERFVAAHPDHKGRLAFM
DAPE_YERPG      --ETLAFAGHTDVVPTDESHWHSPPFEPTIRDGMLYGRGAADMKSLAAMIVAAERFVAAHPDHKGRLAFM
DAPE_YERPE      --ETLAFAGHTDVVPTDESHWHSPPFEPTIRDGMLYGRGAADMKSLAAMIVAAERFVAAHPDHKGRLAFM
DAPE_YERPB      --ETLAFAGHTDVVPTDESHWHSPPFEPTIRDGMLYGRGAADMKSLAAMIVAAERFVAAHPDHKGRLAFM
DAPE_YERPA      --ETLAFAGHTDVVPTDESHWHSPPFEPTIRDGMLYGRGAADMKSLAAMIVAAERFVAAHPDHKGRLAFM
DAPE_SACD2      ----LAFAGHTDVVPTDLGKWATDPFTPTIKDGMLYGRGAADMKSLAAMITACESFIAAHPNHTGRIAFL
DAPE_METSB      ----LVFAGHTDVVPPDSASWRFDPFGGEMEGGLIFGRGAVDMXXXXXXXXXXXXXXXXXXXQKGSISFL
DAPE_ENT38      --ETLAFAGHTDVVPADADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHKNRLAFL
DAPE_WOLPP      ----LCFAGHVDVVPPELKDWISDPFKPEIRDGMLYGRGAADMAFIAAIVDSVAGKFRFSGSISALITSA
DAPE_RICAH      N---ICFVGHVDVVPVDNHAWNSSPFKASKQDGKIYGRGAVDMKAIACFLAASLDFIKNNAGFKGSISFL
DAPE_METRJ      NGPCLVFAGHTDVVPEGEGAWRHDPFAGAVADGMLYGRGAADMKGGVACMLAATLAFLDRRGFGGSIAFL
DAPE_EHRCR      NGHPLCFAGHTDVVPTDLEKWKFDPFSGHIEDNILYGRGAVDMKSAICAFIAAVSRIDF-NQVNGAISLM
DAPE_EHRCJ      NGSPLCFAGHTDVVPTDSEKWKFDPFSGKIEDNILYGRGVVDMKSAICAFVAAVSRIDF-NQINGSISFL
DAPE_YERP3      --ETLAFAGHTDVVPTDESHWHSPPFEPTIRDGMLYGRGAADMKSLAAMIVAAERFVAAHPDHKGRLAFM
ARGE_EDWI9      GAGGLMLAGHTDTVPFDEGRWTRDPFTLSEQDNRLYGLGTADMKGLFAFIIDTLRDIELH-KLNKPLYIL
DAPE_SALTI      --ETLAFAGHTDVVPADVDRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPHHRGRLAFL
DAPE_OLICO      ----ITFAGHTDVVPPDNAAWSHDAFAATVDGGVLYGRGAVDMKAIACAAAAVLDYLEANGGKKGSISFL
DAPE_HAEI8      ------FAGHTDVVPTDENQWSSPPFSAEIIDGMLYGRGAADMKSLAAMIVAAEEYVKANPNHKGTIALL
DAPE_CAMLR      DGEHLAFGGHVDVVPAG-EGWSNDPFEPLDKDGFIYARGAQDM---KSGVAAFMCAVKEVENFKGRISLI
ARGE_ENT38      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDVDVK-TLKKPLYIL
DAPE_THISH      ---VLAFAGHTDVVPTGVEKWSSDPFQPQIRNGQLYGRGAADMSSIAAFVIACEAFLKDHPDHKGSIALL
DAPE_SALTY      --ETLAFAGHTDVVPADVDRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPHHRGRLAFL
DAPE_SALSV      --ETLAFAGHTDVVPADVDRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPHHRGRLAFL
DAPE_SALPK      --ETLAFAGHTDVVPADVDRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPHHRGRLAFL
DAPE_SALPC      --ETLAFAGHTDVVPADVDRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPHHRGRLAFL
DAPE_SALPB      --ETLAFAGHTDVVPADVDRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPHHRGRLAFL
DAPE_SALPA      --ETLAFAGHTDVVPADVDRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPHHRGRLAFL
DAPE_SALNS      --ETLAFAGHTDVVPADVDRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPHHRGRLAFL
DAPE_SALHS      --ETLAFAGHTDVVPADVDRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPHHRGRLAFL
DAPE_SALG2      --ETLAFAGHTDVVPADVDRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPHHRGRLAFL
DAPE_SALEP      --ETLAFAGHTDVVPADVDRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPHHRGRLAFL
DAPE_SALDC      --ETLAFAGHTDVVPADVDRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPHHRGRLAFL
DAPE_SALCH      --ETLAFAGHTDVVPADVDRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPHHRGRLAFL
DAPE_SALAR      --ETLAFAGHTDVVPADVDRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPHHRGRLAFL
DAPE_KLEP3      HGETLAFAGHTDVVPADADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQYPNHRGRLAFL
DAPE_HAEIN      ------FAGHTDVVPTDENQWSSPPFSAEIIDGMLYGRGAADMKSLAAMIVAAEEYVKANPNHKGTIALL
DAPE_ENTS8      --ETLAFAGHTDVVPADVERWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPHHRGRLAFL
DAPE_ERWCT      ----LAFAGHTDVVPSDESHWQHPPFEPIIRDGMLYGRGAADMKSLAAMVIAAERFVAAHPNHQGRLAFL
DAPE_ECOSE      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHTGRLAFL
DAPE_ACIBY      --------GHTDVVPTGLDAWNSDPFAPEIRDGKLYGRGSADMTALAAMVVASERFVAKHPNHKGSIAFL
DAPE_ACIBT      --------GHTDVVPTGLDAWNSDPFAPEIRDGKLYGRGSADMTALAAMVVASERFVAKHPNHKGSIAFL
DAPE_ACIBS      --------GHTDVVPTGLDAWNSDPFAPEIRDGKLYGRGSADMTALAAMVVASERFVAKHPNHKGSIAFL
DAPE_ACIBC      --------GHTDVVPTGLDAWNSDPFAPEIRDGKLYGRGSADMTALAAMVVASERFIAKHPNHKGSIAFL
DAPE_ACIB5      --------GHTDVVPTGLDAWNSDPFAPEIRDGKLYGRGSADMTALAAMVVASERFVAKHPNHKGSIAFL
DAPE_ACIB3      --------GHTDVVPTGLDAWNSDPFAPEIRDGKLYGRGSADMTALAAMVVASERFVAKHPNHKGSIAFL
CBPS2_YEAST     SLKPILFMAHQDVVPVNWDSWQYPPLSGHYDQDYVWGRGSNDCKNLMLAELEGIEQLLADGYQTERTVIL
DAPE_SHISS      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHTGRLAFL
DAPE_SHIFL      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHTGRLAFL
DAPE_SHIF8      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHTGRLAFL
DAPE_SHIBS      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHTGRLAFL
DAPE_SHIB3      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHTGRLAFL
DAPE_MAGSM      -----TFAGHTDVVGADTSRWSSDPFAATLEEGYITGRGAVDMLACMVAATARFLAARPHFAQQHSLSFL
DAPE_ECOUT      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHTGRLAFL
DAPE_ECOSM      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHTGRLAFL
DAPE_ECOLU      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHAGRLAFL
DAPE_ECOLI      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHTGRLAFL
DAPE_ECOLC      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHTGRLAFL
DAPE_ECOL6      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHTGRLAFL
DAPE_ECOK1      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHTGRLAFL
DAPE_ECOHS      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHTGRLAFL
DAPE_ECODH      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHTGRLAFL
DAPE_ECOBW      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHTGRLAFL
DAPE_ECO8A      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHTGRLAFL
DAPE_ECO7I      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHAGRLAFL
DAPE_ECO5E      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHTGRLAFL
DAPE_ECO57      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHTGRLAFL
DAPE_ECO55      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHTGRLAFL
DAPE_ECO45      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHTGRLAFL
DAPE_ECO27      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHTGRLAFL
DAPE_ECO24      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHTGRLAFL
DAPE_THICR      ------FAGHTDVVPTGPEKWTHPPFSAHIADGIMYGRGTADMSSIACFMVATKQFIKQYPDFKGSIAFL
DAPE_TERTT      ----LCFAGHTDVVPEGDPKWQSPPYEPTITDGLLYGRGAADMKSLAAMVTACEAFVAEHPNHTGRIAFL
DAPE_SILPO      HARSFGFNGHTDVVPVDAAAWTVAPFGAEEKDGFLYGRGATDMKSGXXXXXXXXXDLVTTTPPEGAVIVT
DAPE_SHIDS      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHTGRLAFL
DAPE_SHEWM      ----FCFAGHTDVVPVDLNRWHTPPFDPVVIDGYLHGRGAADMKSLAAMVVATERFVEKHPDHNGSIAFL
DAPE_RHOPA      TSPHLCFAGHTDVVPPDASAWTHGAFAGDVADGLLYGRGAVDMKGIACAVAATLDYLAANGGQKGSISFL
DAPE_KLEP7      HGETLAFAGHTDVVPADADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQYPNHRGRLAFL
DAPE_HAEIE      ------FVGHTDVVPTDENQWSSPPFSAEIIDGILYGRGAADMKSLAAMIVAAEEYVKANPNHKGTIALL
DAPE_ESCF3      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHTGRLAFL
DAPE_ECOL5      --ETLAFAGHTDVVPPDADRWINPPFEPTIRDGMLFGRGAADMKSLAAMVVAAERFVAQHPNHTGRLAFL
ARGE_MYXXA      ----LALVGHSDCVPYDAA-WT-DALRLTEKDGRLYARGACDTKFIACALHAALNAEQLKAPLMVVLT--
ARGE_ERWT9      ---------HTDTVPFDDGRWTRDPFTLTEHDNKLYGLGTADMKGFFAFILDTLRDVEL-STLKKPLYIL
DAPE_RHOPT      TSPHLCFAGHTDVVPPDASAWTHGAFAGDVADGLLYGRGAVDMKGIACAVAATLDYLAANGGQKGSISFL
DAPE_CAMJ8      EGEHLAFGGHVDVVPAG-EGWKNDPFEPLEEEGFIYARGAQDMKSGVAAFIDAVKDVSFKG---RRLSLI
DAPE_STRMK      -APVLVLLGHTDVVPTGRESWTSDPFTPHIRDGVLYGRGAADMKSXXXXXXXXXXXXXDHPDHPGTLAVL
DAPE_STRM5      -APVLVLLGHTDVVPPGPREWASDPFTPQIREGVLYGRGTADMKSXXXXXXXXXXXXXXHPDHTGTLAVL
DAPE_BARQU      ----LMFAGHTDVVPPGLEDWTYPPFEGVIDQGKLYGRGAVDMKGGIACFVAALARILEKRSIKGMVSLL
DAPE_AZOC5      N---LCFAGHVDVVPPDAASWRHGPFSGAVEDGVLYGRGAVDMK--GXXXXXXXXXXXXXXXXQGSLSFL
DAPE_ARCB4      ----LCFAGHIDVVPVG-NGWEVDPFAAEVIDGVITARGAQDM---KSGDAAFLYACKNAKNFDGTLSIL
DAPE_ACIAD      --------GHTDVVPTNLDNWNSDPFAPEVRDGILYGRGAADMTALAAMVVASERFVEKHPNHKGSIAFL
DAPE_WOLSU      ------LAGHIDVVPPG-EGWSVDPFGAELKEGYLYGRGAQDM---KSGVAAMISALAKIDHFPGTLSLL
DAPE_SPHAL      --KHFGFAGHLDVVPPGVG-WTSDAFAPEIRGELLYGRGAVDMKGXXXXXXXXXXXTPVDA---GTISLI
DAPE_RICPR      N---ICFVGHVDVVPANYEFWNSNPFKFHEQDGKIYGRGTVDMKAIACFLAASLNFIKNNTDFKGSISFL
DAPE_RICFE      N---ICFVGHVDVVPAGNHEWNASPFKASHQDGKIYGRGAVDMKAIACFLAASLDFIKNNTGFKGSISFL
DAPE_LEPCP      DGPTLVLAGHTDVVPTGLERWHSDPFVPSHRAGLLYGRGAADMTSLXXXXXXXXXXXXXXXXXRGSVAFL
DAPE_BUCAT      ----LTFAGHTDVVPIGQDKWQTDPFQPVIRSGYLFGRGSADMKALAAMITAAERFVNKFPNHKGRLSFL
DAPE_BUCA5      ----LTFAGHTDVVPIGQDKWQTDPFQPVIRSGYLFGRGSADMKALAAMITAAERFVNKFPNHKGRLSFL
DAPE1_ALTMD     --------GHTDVVPPGLEKWKSPPFSPVVSQNKLYGRGAADMTGISAMLAATERAIASLDEREVTYWWL
ARGE_VIBSL      G---LLLAGHSDTVPFDEGRWNFDPHALTEHNNRFYGLGTADMKGFFAFVYEAAKKMDWSKQTK-PLYVL
DAPE_NAUPA      --------GHIDVVPPG-EGWNTDPFTPTEKEGFIYARGAQDM---KSGLAAFLWAMKNAKNFKGTLSAL
DAPE_HAEIG      ------FAGHTDVVPTDENQWSSPPFSAEIIDGMLYGRGAADMKSLAAMIVAAEEYVKANPNHKGIIALL
DAPE_EHRRW      ----LCFAGHTDVVKTDLTKWKFDPFSGHIEDDILYGRGAVDMKSAICAFIAAVSRINF-NEVPGSISFL
DAPE_EHRRG      ----LCFAGHTDVVKTDLTKWKFDPFSGHIEDDILYGRGAVDMKSAICAFIAAVSRINF-NEVPGSISFL
DAPE_BRASB      ----ITFAGHTDVVPPDEAAWSLPAFSGEVRDGYIYGRGAVDMKIACSVAAALDYLRDHDGQPKGSISFL
DAPE_ACICJ      GSPHFGFAGHTDVVPPG-EGWRHDPFAAVIEDGLLFGRGAVDMK--GXXXXXXXXXXXXXXNHAGTISLL
ARGE_VIBVY      G---LLLAGHSDTVPFDQGRWSFDPHQLTEKDNKFYGLGTADMKGFFAFIYEAAKRMDWKGQNK-PLYVL
ARGE_VIBVU      G---LLLAGHSDTVPFDQGRWSFDPHQLTEKDNKFYGLGTADMKGFFAFIYEAAKRMDWKGQNK-PLYVL
ARGE_ESCF3      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDTLRDVDVT-KLKKPLYIL
DAPE_STAEQ      -APVLAISGHMDVVDADHDDWTFPPFELTDKDGKLFGRGTTDMKGGLMAMVIAMIELKQSNALKGTIRLL
DAPE_CAMC5      ----LAFAGHVDVVPPG-EGWQSEPFTPLMKDGFIYARGAQDM---KSGVAAFVCACRDAKNFNGRLTLI
DAPE_BUCAI      ----LTFAGHTDVVPIGQDKWQTDPFQPVIRSGYLFGRGSADMKALAAMITAAERFVNKFPNHKGRLSFL
DAPE_POLSQ      QGKVLMFAGHTDVVPTGLEKWTSDPFTPTIRDGMLYGRGAADMTSLAAFVVATEEFVTMHPDHQGAIAFL
DAPE_PARDP      --------GHTDVVPPGDPSWTHPPFSGHEAEGWIWGRGATDMKSVXXXXXXXIGFVTQTPPPDGAVILA
ARGE_PHOLL      ---------HTDTVPFDEGLWTKDPFTLTERDNKLYGLGTADMKGFFAFIIDALRDIDVSKITR-PLYIL
DAPE_STAES      -APVLAISGHMDVVDADHDDWTFPPFELTDKDGKLFGRGTTDMKGGLMAMVIAMIELKQSNALKGTIRLL
DAPE_RHOPB      TAPHICFAGHTDVVPPDEAAWSHDAFAGEVHDGLLYGRGAVDMKGIACSVAAVLQHLATHGGQQGSISFL
DAPE_NITSB      --EHLCFAGHVDVVPPG-DGWESDPFEPLEKDGFIYARGAQDM---KSGVAAFVQAVKEAKVFHGTLSLL
DAPE_MARAV      NGPVLAFAGHTDVVPTGPEKWAHPPFDPIIKDGYLHGRGAADMKSLAAFITACERFVANHPNHRGSIALL
DAPE_CAUCR      ----LCFAGHTDVVPVDDAAWTAGPFEAEIKEGVLYGRGAVDMKSXXXXXXXXXXXXPDH---PGSISFL
DAPE_CAUCN      ----LCFAGHTDVVPVDDAAWTAGPFEAEIKEGVLYGRGAVDMKSXXXXXXXXXXXXPDH---PGSISFL
DAPE_BUCAP      ----LTFAGHTDVVPPDYKYWNDDPFNPVIKNGLLFGRGSSDMKALASMLIASERFIKKNPNYEGRLSFL
DAPE_BRASO      -GPHITFAGHTDVVPPDEASWSLPAFSGEVKDGYIYGRGAVDMKGGIACSVAAALDYLRDHGSKGSISFL
DAPE_JANSC      NGKAFGFNGHTDVVPVDEAAWTHPPFGAEVDGDWMYGRGATDMKSGVXXXXXXXIDFVRDTPPDGAIVLA
DAPE_HAHCH      ------FAGHTDVVPTGPEKWEHPPFAAEVKDGVLHGRGAADMKSLAAFMTACERFVKKHPNHRGSIGWL
DAPE_BUCCC      ----VTFLGHTDVVPASTRKWKTSPFVATIKDGKLFGRGSADMKSIAAMLIAVENFIKKFPNHKGRISFL
DAPE_SULDN      ----LCFAGHVDVVPAG-DGWDSDPYIATERDGYIYGRGAQDM---KSGVAAFVQAIKDTKHFNGTLSLL
DAPE_POLNS      QGKVLMFAGHTDVVPTGLEKWTSDPFTPTIRDGMLYGRGAADMTSLASFVVATEEFVTTHPDHQGSIAFL
DAPE_METS4      ----LLLAGHTDVVPPGEPAWRHDPFAGVVEGGELHGRGAVDMKGGIXXXXXXXXXXXXERGFGGSIAFL
DAPE_CAMJR      EGEHLAFGGHVDVVPAG-EGWSSDAFVPMEKEGFIYARGAQDMKSGVAAFVDAVKNADFKG---ARLSLI
DAPE_ACTSZ      -APVIAFAGHTDVVPTDKSQWVYPPFEAEIVDDMLYGRGAADMKSLAAMVVAAEEYVKANPNHAGTIAFL
DAPE_XANP2      N---LCFAGHVDVVPEDATQWHHAPFAGTVEDGVLHGRGAVDMKGXXXXXXXXXXXXGRP--QRGSLSFL
DAPE_SHESH      NSGPLCFAGHTDVVPVDLNRWHTPPFDPVVIDGYLHGRGAADMKSLAAMLVATERFVEKHPDHNGSIAFL
DAPE_BURA4      DGKLLAFAGHTDVVPTGLEQWTSPPFVPAHRDGKLYGRGAADMTSLXXXXXXXXXXXXXHPGHRGAIAFL
DAPE_BRAJA      ----ITFAGHTDVVPADESAWSVGAFSGEVKDGFLHGRGAVDMKGIACSVAAVLEHLAANGGKTGSISFL
DAPE_NITOC      --------GHTDVVPPGPPKWLTDPFTPEVRNGLLYGRGAADMKSLAAMVTACEHFINVHSDHAGSIAFL
DAPE_BURS3      DGKLLAFAGHTDVVPTGLEQWSSPPFIPAHRDGKLYGRGAADMTSLXXXXXXXXXXXXXHPGHRGTIAFL
DAPE_BURCM      DGKLLAFAGHTDVVPTGLEQWTSPPFVPTHRDGKLYGRGAADMTSLXXXXXXXXXXXXXHPGHRGAIAFL
DAPE_ACTP7      --------GHTDVVPVDETQWQYPPFSAEIVDGTLYGRGAADMKSLAALVIAAETFVKNNPNHKGKIALL
DAPE_ACTP2      --------GHTDVVPVDETQWQYPPFSAEIVDGTLYGRGAADMKSLAALVIAAETFVKNNPNHKGKIALL
ARGE_ECOLU      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDVDVT-KLKKPLYIL
DAPE_XYLFA      -APVLVLLGHTDVVPPGIEAWTSDPFIPQRREGKLYGRGAADMKSVAAFVIAAERFLVAHAGHPGTLAIL
DAPE_SHEAM      --------GHTDVVPVDLNRWHTPPFDPVVIDGYIHGRGAADMKSLAAMVVAAERFVAEHPDHQGSIAFL
DAPE_METPP      DGFTLVFAGHTDVVPTGLERWTSDPFVPSHRDGRLYGRGAADMTSIACMVVAIEEFVAAYPRHAGSIALL
ARGE_ECO5E      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDVDVT-KLKKPLYIL
ARGE_ECO57      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDVDVT-KLKKPLYIL
DAPE_XANC5      GAPVLVLLGHTDVVPPGPREWTSDPFDPQIRDGVLYGRGAADM---------------------------
DAPE_WOLPM      ----LCFAGHVDVVPPQLKDWAFGPFKPEVRDGMLYGRGAADMAFIAAMVNLIAEKFQFNGSISALITSA
DAPE_RUTMC      --------GHTDVVPVDELKWHISPFSAQVQDGMLHGRGTADMKSLAAMLSATDRFVKDYPNHKGSIGYL
DAPE_RICCK      N---ICFVGHVDVVPADYHLWHNSPFKANEQDGKIYGRGVVDMKAIACFLTAALDLIKNNPDFKGSISFL
DAPE_LARHH      -SPTLCFAGHTDVVPTGLTAWHSDPFEPVERDGHLFGRGAADMASLAAFVTAIEDFVAGHPDHKGSIALL
DAPE_DECAR      ----FVFAGHTDVVPTGLDKWTSPPFAPEIRDGVLYGRGTADM---------------------------
DAPE_CAMFF      ----LCFAGHIDVVPAG-DGWDSDPFEPELKDGFVYARGAQDM---KSGVAAFLCACKDATKFNGTLSII
DAPE_BURM1      DGKLLAFAGHTDVVPTGLEQWTSPPFVPAHRDGKLYGRGAADMTSLXXXXXXXXXXXXXHPDHRGAIAFL
DAPE_BURCC      DGKLLAFAGHTDVVPTGLEQWTSPPFIPAHRDGKLYGRGAADMTSLXXXXXXXXXXXXXHPDHRGTIAFL
DAPE_AERS4      --------GHTDVVPAGLEKWHTPPFEPTIQDGVLYGRGAADMKSLAAMVVAVERFVAEHPDHKGSIAFL
ARGE_SHIB3      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDVDVT-KLKKPLYIL
ARGE_ECOSE      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDVDVT-KLKKPLYIL
ARGE_ECOLI      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDVDVT-KLKKPLYIL
ARGE_ECOLC      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDVDVT-KLKKPLYIL
ARGE_ECOHS      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDVDVT-KLKKPLYIL
ARGE_ECODH      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDVDVT-KLKKPLYIL
ARGE_ECOBW      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDVDVT-KLKKPLYIL
ARGE_ECO8A      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDVDVT-KLKKPLYIL
ARGE_ECO55      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDVDVT-KLKKPLYIL
ARGE_ECO27      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDVDVT-KLAKPLYIL
DAPE_SODGM      ----LAFAGHTDVVPADLQLWDNPPFEPTLCDGMLYGRGAADMKSLAAMVVAAERFVAQHPQHEGRLAFL
DAPE_NITHX      ----IAFAGHTDVVPPDESAWTHGAFSGEVKDGFLYGRGTVDMKGIACSAAATLEYLEAHGGRNGSISFL
DAPE_MANSM      ------FAGHTDVVPTDENQWNYPPFSAQIVDDMLYGRGAADMKSLAAMIVAAEEYVKANPNHAGTIALL
DAPE_CAMJE      EGEHLAFGGHVDVVPAG-EGWSNNAFAPVEKEGFIYARGAQDMKSGVAAFVDAAKNADFKG---ARLSLI
DAPE_ANAMM      NGHPLCFAGHTDVVPPG-GTWRTDPFSPQVKDGMLYGRGASDM---KAAICAYISAVARLDSVPGCLSFL
DAPE_ANAMF      NGHPLCFAGHTDVVPPG-GTWRTDPFSPQVKDGMLYGRGASDM---KAAICAYISAVARLDSVPGCLSFL
CBPS_YEAST      DLKPLLLMAHQDVVPVNLSSWKFPPFSGHYDPETVWGRGSND----------------------------
ARGE_SHIDS      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDVDVT-KLKKPLYIL
ARGE_ECOL6      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDVDVT-KLAKPLYIL
ARGE_ECOL5      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDVDVT-KLAKPLYIL
ARGE_ECO81      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDVDVT-KLAKPLYIL
ARGE_ECO45      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDVDVT-KLAKPLYIL
DAPE_VESOH      -SPVFVFAGHTDVVPVNESEWHMPPFSAQVKNGMLYGRGTSDMKSLAAMLSATDRFVKDHSNHKGSIGYL
DAPE_RICBR      NSKPICFVGHVDVVPAGDPNWNSNPFKAHEQEGKIYGRGTVDMKSIACFLAASLDFIKNNTDFVGSISFL
DAPE_RICB8      NSKPICFVGHVDVVPAGDPNWNSNPFKAHEQEGKIYGRGTVDMKSIACFLAASLDFIKNNTDFVGSISFL
DAPE_METNO      ----LLLAGHTDVVPPDLAAWRHDPFXXXXXXXXXHGRGAVDMKGGXXXXXXXXXXXXXERGFGGSIAFL
DAPE_HELHP      NLHHFCFAGHIDVVPTG-EGWEFEPFCGTQDEKYIYGRGTQDMISAFICAVCNILESHNTSSLPIMLSIL
DAPE_CELJU      ----LAFAGHTDVVPTGPETWNNPPFEPTIIDGMLHGRGAADMKSLASMVVACENFVARHPNHKGRIAFL
DAPE_CAMJJ      EGEHLAFGGHVDVVPAG-EGWSNNAFAPVEKEGFIYARGAQDMKSGVAAFVDAVKNADFKG---ARLSLI
DAPE1_SHELP     ----FCFAGHTDVVPVDLNRWHTPPFEPVVIDGYLHGRGAADMKSLAAMVVATERFVDKHPDHKGSIAFL
ARGE_SHIBS      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDIDVT-KLKKPLYIL
ARGE_MORAB      G---LLLAGHTDTVPFDDDLWTKDPFKLTEKDDKWYGLGTIDM---------------------------
ARGE_ECOSM      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDVDVT-KLAKPLYIL
DAPE_PSYWF      NQDPVVCFGHTDVVPTGNPNWRIAPFDAKVHDGYLWGRGAADM---------------------------
DAPE_NITWN      ----IAFAGHTDVVPPDEAAWTRGAFSGDVVDGFLYGRGAVDMKGVACGVAAALDYLAAHGGRSGSISFL
DAPE_JANMA      ----LVFAGHTDVVPTGLEQWTSPPFVPTQREGKLYGRGAADM---------------------------
DAPE_HAEPS      ----LAFAGHTDVVPEDESQWTYPPFSAEIVDDMLYGRGAADMKSLAAMVIACETFVKNNPNHQGKIALL
DAPE_BURCH      DGKLLAFAGHTDVVPTGLEQWTSPPFVPAHRDGKLYGRGAADMTSLXXXXXXXXXXXXXHPDHRGAIAFL
DAPE_BURCA      DGKLLAFAGHTDVVPTGLEQWTSPPFVPAHRDGKLYGRGAADMTSLXXXXXXXXXXXXXHPDHRGAIAFL
DAPE_AERHH      ----FCFAGHTDVVPAGLDKWHTPPFEPTIQDGVLYGRGAADMKSLAAMVVAVERFVAEHPDHSGSIAFL
ARGE_YERPS      ----------TDTVPYDEGRWTRDPFTLTEHDHKLYGLGTADMKGF-FAFILDAVRDIDASKLTKPLYIL
ARGE_YERPE      ----------TDTVPYDEGRWTRDPFTLTEHDHKLYGLGTADMKGF-FAFILDAVRDIDASKLTKPLYIL
ARGE_YERP3      ----------TDTVPYDEGRWTRDPFTLTEHDHKLYGLGTADMKGF-FAFILDAVRDIDASKLTKPLYIL
ARGE_MORPR      G---LLLAGHTDTVPFDDGLWTKDPFQLTEKDDKWYGLGTIDM---------------------------
ARGE_ECO7I      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDVDVT-KLAKPLYIL
ARGE_ECO24      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDVDVT-KLKKPLYIL
DAPE_XANOR      -APVLVLLGHTDVVPPGPREWTSDPFDPQIRDGVLYGRGVADM---------------------------
DAPE_XANOP      -APVLVLLGHTDVVPPGPREWTSDPFDPQIRDGVLYGRGVADM---------------------------
DAPE_XANOM      -APVLVLLGHTDVVPPGPREWTSDPFDPQIRDGVLYGRGVADM---------------------------
DAPE_VIBF1      NKAPLTFAGHTDVVPTDLTHWNTNPFEPTIIDGMLYARGAADMKSLACMVVAVERFVAEHPNHKGSISFL
DAPE_SHESR      --------GHTDVVPADLSRWHTPPFEPTIIDGYLYGRGAADMKSLAAMIVATERFVAKHPNHPGSIAFL
DAPE_SHESM      --------GHTDVVPADLSRWHTPPFEPTIIDGYLYGRGAADMKSLAAMIVATERFVAKHPNHPGSIAFL
DAPE_SHEON      --------GHTDVVPTDLSRWHTPPFEPTIIDGYLYGRGAADMKSLAAMVVATERFVAKHPNHPGSIAFL
DAPE_RICTY      N---ICFVGHVDVVPAGNHEFNSNPFKFHEQDGKIYGRGAVDMKAIACFLAASLNFIKNNMDFKGSISFL
DAPE_PHOLL      ----LAFAGHTDVVPADESQWEYPPFEPTIRNGMLYGRGAADMKSLAAMIVAAERFVAAHPNHNGRLAFL
DAPE_DINSH      HARSFGFNGHTDVVPVGAADWRFDPFGAQVEGDWMYGRGXXXXXXXXXXXXXXXXXXXXXTPPDGAVILA
DAPE_BURPP      TAKLLAFAGHTDVVPTGLEQWRSAPFEPTHRDGKLYGRGAADMASIAGFVVASEEFVAAHPAHRGTIAFL
ARGE_KLEP3      -----------DTVPFDDGRWTRDPFTLTEHDNKLYGLGTADMKGFFAFILDALRDVDVT-TLKKPLYIL
DAPE_XANCP      -APVLVLLGHTDVVPPGASDWASDPFAPQVRDGVLYGRGAADM---------------------------
DAPE_XANCB      -APVLVLLGHTDVVPPGASDWASDPFAPQVRDGVLYGRGAADM---------------------------
DAPE_XANC8      -APVLVLLGHTDVVPPGASDWASDPFAPQVRDGVLYGRGAADM---------------------------
DAPE_VIBFM      NEAPLTFAGHTDVVPTDLTHWNTNPFEPTIIDGMLYARGAADMKSLACMVVAVERFVGEHPNHKGSISFL
DAPE_SHESW      --------GHTDVVPTDISRWHTPPFEPTIIDGYLYGRGAADMKSLAAMIVATERFVTKHPDHQGSIAFL
DAPE_SHESA      --------GHTDVVPADLSRWHTPPFEPTIIDGYLYGRGAADMKSLAAMIVATERFVAKHPNHPGSIAFL
DAPE_ROSDO      --------GHTDVVPINADDWSMPPFGAEVKDGIMYGRGTTDM---------------------------
DAPE_RHOPS      GAPHLCFAGHTDVVPPDADAWSHGAFSGDVEGGLLYGRGAVDMKGIXXXXXXXXXXXXXXGGRKGSISFL
Y457_METJA      --KTLHIISHLDTVPEDISLWGTNPYEPVIKDGKIYGRGSEDHKGIVSSLLLLKMIFENNIEPKYNLSLI
DAPE_XYLFM      -APVLVLLGHTDVVPPGIEAWTSNPFIPQRREGKLYGRGAADMKSVAAFVIAAERFLVAHPGHPGTLAIL
DAPE_SHEPC      --------GHTDVVPTDISRWHTPPFEPTIIDGYLYGRGAADMKSLAAMIVATERFVTKHPDHQGSIAFL
DAPE_SHEDO      --------GHTDVVPIDLARWHTPPFEPTIIDGYLHGRGAADMKSLAAMLVATERFVAKHPHHNGSIAYL
DAPE_HERAR      TAQPLLVFGHTDVVPTGLDQWTSPPFVPTQRDGKLYGRGAADM---------------------------
DAPE_BLOFL      ----LLFAGHTDVVPPDIHNWQYPPFSGTVHNNIIYGRGSSDMKALAAMLVATKSFIQKYPKHKNRIAFI
ARGE_VIBHB      ---------HSDTVPFDEGRWSFDPHKLTEKDNRFYGLGTADMKGFFAFIYEAVKKIDWSKQTK-PLYVL
ARGE_SHISS      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDTLRDVDVT-KLKKPLYIL
ARGE_SHIFL      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDVDVT-KLKKPLYIL
ARGE_SHIF8      ---------HTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILDALRDVDVT-KLKKPLYIL
DAPE_PSYA2      --------GHTDVVPTDEKNWTYPPFTPTIADGYLWARGAADMTGIAAFTIAAERFVANHPQHNGSIAFL
DAPE_PSEU2      ----LCFAGHTDVVPTPLQNWQNDPFDALIDEGMLCGRGAADMKSLAAMLVAAERFVADHPDHKGSVAFL
DAPE_PASMU      ------FAGHTDVVPVDTTQWQYPPFSAQLVDNVLYGRGAADM---------------------------
DAPE_BURCJ      DGKLLAFAGHTDVVPTGLEQWTSPPFIPAHRDGKLYGRGAADMTSLXXXXXXXXXXXXXHPDHRGAIAFL
DAPE_SULNB      -GPHLCFAGHVDVVPAG-DGWHTNPFVPVIKEGKIYARGTQDM---KSGVAAFVQAVKECEDFSGRLSIL
DAPE_SHEB9      --------GHTDVVPTDVSRWHTPPFVPTIIDGYLYGRGAADMKSLAAMIIATERFVAKHPDHHGSIAFL
DAPE_SHEB5      --------GHTDVVPTDVSRWHTPPFVPTIIDGYLYGRGAADMKSLAAMVIATECFVAKHPDHNGSIAFL
DAPE_SHEB2      --------GHTDVVPTDVSRWHTPPFVPTIIDGYLYGRGAADMKSLAAMVIATERFVAKHPDHNGSIAFL
DAPE_PSESM      ----LCFAGHTDVVPTPVQDWQNDPFDALIDEGMLCGRGAADMKSLAAMLVAAERFVADHPDHKGSVAFL
DAPE_PSE14      ----LCFAGHTDVVPTPVENWQNDPFDALIDEGMLCGRGAADMKSLAAMLVAAERFVADHPNHKGSVAFL
DAPE_ORITI      NGQPICFAGHIDVVPAGIEQWKYPPFCATQYKDKIYGRGVVDMKAISAMLSAVFCFIDNNNDFNGTISFL
DAPE_NOVAD      -ARHFAFAGHLDVVPPG-EGWTSGPFKAERRGELLYGRGAVDM---KGSXXXXXXXXXXXXXXXGTLSFI
DAPE_COXBU      --------GHTDVVPPDETQWHSPPFTPTEKNGYIYGRGAADMKSLAAMVVAAENFVKQNPDHNGTIGFI
DAPE_COXBR      --------GHTDVVPPDETQWHSPPFTPTEKNGYIYGRGAADMKSLAAMVVAAENFVKQNPDHNGTIGFI
DAPE_COXBN      --------GHTDVVPPDETQWHSPPFTPTEKNGYIYGRGAADMKSLAAMVVAAENFVKQNPDHNGTIGFI
DAPE_COXB2      --------GHTDVVPPDETQWHSPPFTPTEKNGYIYGRGAADMKSLAAMVVAAENFVKQNPDHNGTIGFI
DAPE_COXB1      --------GHTDVVPPDETQWHSPPFTPTEKNGYIYGRGAADMKSLAAMVVAAENFVKQNPDHNGTIGFI
DAPE_XYLFT      -APVLVLLGHTDVVPPGVEAWTSDPFMPDMRNGILYGRGAADM---------------------------
DAPE_XYLF2      -APVLVLLGHTDVVPPGVEAWTSDPFMPDMRNGILYGRGAADM---------------------------
DAPE_XANAC      -APVLVLLGHTDVVPPGPREWTSAPFDPQIRDGVLYGRGAADM---------------------------
DAPE_SHEHH      --------GHTDVVPVDLNRWHTPPFEPVVIDDYLHGRGAADMKSLAAMLVATERFIKKFPDHQGSIAFL
DAPE_SHEB8      --------GHTDVVPTDVSRWHTPPFVPTIIDGYLYGRGAADMKSLAAMVIATERFVAKHPDHNGSIAFL
DAPE_PSEPG      DGPVLCFAGHTDVVPTPVQQWQHEPFEALIADGMLCGRGAADMKSLASMVIASERFVQDYPNHRGKVAFL
DAPE_PSEA7      ---VLCFAGHTDVVPTPVQAWQHQPFDALIDEGMLCGRGAADMKSLASMIVAVERFVADHPGHKGAIAFL
DAPE_ALISL      -----TFAGHTDVVPTSLTQWNTDPFEPTIIDGMLYARGAADMKSLACMIVAVERFISEHPEHKGSLSFL
DAPE_TOLAT      ----FCFAGHTDVVPSGAEKWHTPPFEPTIIDGMLYGRGAADMKSIASMMAAVQRFTTDYPAHQGSIAFL
DAPE_PSYCK      NTNPICFAGHTDVVPTDEKNWTYPPFTPTIADGYLWARGAADMTGIAAFTVAAERFVANHPEHNGSIAFL
DAPE_PSEU5      ----LCFAGHTDVVPTPLQAWQNPPFSARIDEGMLHGRGAADMKSLAAMVVAVERFTADHPDHKGQIAFL
DAPE_PSEPW      ----LCFAGHTDVVPTPVQQWQHEPFEALIADGMLCGRGAADMKSLASMVVASERFVQDYPNHRGRVAFL
DAPE_PSEPK      DGPVLCFAGHTDVVPTPVQQWQHEPFEALIADGMLCGRGAADMKSLASMVIASERFVQDYPNHRGKVAFL
DAPE_PSEP1      DGPVLCFAGHTDVVPTPVQQWQHEPFEALIADGMLCGRGAADMKSLASMVIASERFVQDYPNHRGKVAFL
DAPE_PSEE4      DGPVLCFAGHTDVVPTPVQQWQHEPFEALIADGMLCGRGAADMKSLASMVVASERFVQDYPNHRGKVAFL
DAPE_PSEAE      ---VLCFAGHTDVVPTPLQAWQHQPFDALIDDGMLCGRGAADMKSLASMIVAVERFVADHPEHKGAIAFL
DAPE_PSEAB      ---VLCFAGHTDVVPTPLQAWQHQPFDALIDDGMLCGRGAADMKSLASMIVAVERFVADHPKHKGAIAFL
DAPE_PSEA8      ---VLCFAGHTDVVPTPLQAWQHQPFDALIDDGMLCGRGAADMKSLASMIVAVERFVADHPEHKGAIAFL
DAPE_METCA      -AAPLVFLGHTDVVPPGLEDWSSPPFAPEIREGRLYGRGAADM---------------------------
DAPE_BURVG      ----LAFAGHTDVVPTGLEQWTSPPFIPAHRDGKLYGRGAADMTSLAAFIVASEEFVAAHPDHRGAIAFL
DAPE_BORPD      NAGPLVVFGHTDVVPPGRDKWDSDPFVPTERDGYLYGRGAADMSSIXXXXXXXXXXXXXHPGHDGSIALL
DAPE_ACTPJ      ------FAGHTDVVPVDETQWTYPPFEARIVDNMLYGRGAADM---------------------------
DAPE_RHORT      --------GHTDVVPAG-DGWSRPPFGAEVVDGALVGRGAADM---------------------------
DAPE_BURXL      TAKLLAFAGHTDVVPTGLEQWHSAPFEPTHRDGKLYGRGAADMASIAGFVVASEEFVAAHPAHRGSIAFL
DAPE_RALME      ----LAFAGHTDVVPTGLDQWSSDPFEPSHRDGKLYGRGAADM---------------------------
DAPE_PSEF5      ----LCFAGHTDVVPTPVQAWQNDPFDALIDEGMLCGRGAADMKSLAAMLVAAERFVTDYPDHKGSVAFL
DAPE_BART1      ----LMFAGHTDVVPPGLEDWTYPPFEAVIDQGKLYGRGAVDMKGGIACFIAALARVLEKRSIKGRVSLL
DAPE_SHEPW      --------GHTDVVPVDLNRWHTPPFEPVVIDDYLHGRGAADMKSLAAMVVATERFVKKHPDHKGSIAFL
DAPE_SHEFN      NCDPVCFAGHTDVVPTDLNRWHTPPFEPTIIDNYLHGRGAADMKSLAAMIIATERFVAKHPDHNGSIAYL
DAPE_PSESY      ----LCFAGHTDVVPTPLQAWNIPPFDAFIDDGMLHGRGAADMKSLAAMLVAAERFVVDYPDHRGSVAFL
DAPE_PSEA6      --------GHTDVVPSGAEKWTFPPFTATQHEGQLYGRGAADMKSLAAMLVATKAFVTKHPEHSGSIAFL
DAPE_PROMH      --ETLAFAGHTDVVPPGANAWDNPPFEPSIRDGMLYGRGAADMKSLAAMVVAAERFVHAYPQHRGRLAFL
DAPE_BARHE      ----LMFAGHTDVVPPDLENWKYPPFEGVIDQGKLYGRGAVDMKGGIACFVAAFARVLEKRTIKGRVSLL
DAPE_SHEPA      --------GHTDVVPVDLNRWHTPPFEPVVIDDYLHGRGAADMKSLAAMLVATERFVNKHPDHQGSIAFL
DAPE_RHOP2      GAPHLCFAGHTDVVPPEETAWSHGAFAGDVEGGLLYGRGAVDMKGIACAVAATLDYLAANGGQKGSISFL
DAPE_RALSO      -GKLLVFAGHTDVVPTGVEQWRSDPFEPTHRDGKLYGRGAADMTSIXXXXXXXXXXXXXHPDHAGSIGFL
DAPE_RALEJ      ----LAFAGHTDVVPTGLEQWNSDPFEPTHRDGRLYGRGAADM---------------------------
DAPE_RALEH      ----LVFAGHTDVVPTGLEQWHSDPFAPTHRDGKLYGRGAADM---------------------------
DAPE_ORITB      NGQPICFAGHIDVVPAGIEQWKYPPFCATQYKDKIYGRGVVDMKAISAMLSSVFCFIDNNHDFNGTISFL
DAPE_CUPTR      ----LVFAGHTDVVPTGLEQWHSDPFAPTHRDGKLYGRGAADM---------------------------
DAPE_ALCBS      --------GHTDVVPTDVTAWKYDPFTPTEEGDLLYGRGAADMKSIAAMIVAMEDFIAAHPDHNGSLAFL
DAPE_THIDA      ------FAGHTDVVPPGLEQWLSDPFEPTLRDGKLYARGAADM---------------------------
DAPE_PSEPF      ----LCFAGHTDVVPTPVTAWQIDPFNAVIDEGMLCGRGAADMKSLASMTVAAERFVADYPDHKGKVAFL
DAPE_NITEU      -APLVCFAGHTDVVPTGVTQWDSDPFTPVVRDGFLYGRGAADM---------------------------
DAPE_COLP3      --------GHTDVVPANLELWNTPPFEPTIIDGMLYGRGAADMKSLAAMIVATERFVQDHPDHHGSITYL
ARGE_DICDI      TSSPKTISSHLDVVPADKTAWDRNPFQLIIEGDKLYGRGTTDCL--------------------------
DAPE_RICPU      N---ICFVGHVDVVLAGNHEWNASPFKVSQQDGKIYGRGAVDMKAIACFLAASLDFIKNNTDFKGSISFL
DAPE_RICCN      N---ICFVGHVDVVLAGNHEWNASPFKVSQQDGKIYGRGAVDMKAIACFLAASLDFIKNNTDFKGSISFL
DAPE_RICAE      N---ICFVGHVDVVLAGNHEWNASPFKVSQQDGKIYGRGAVDMKAIACFLAASLDFIKNNTDFKGSISFL
DAPE_BLOPB      ----LLFIGHTDVVPGDPQFWDYPPFSGLVHNNMLHGRGAIDMKALAAMLVATANFIDQYPNYQGRIAFL
DAPE_ACIAC      ----LVFAGHTDVVPTGPPEWSSPPFTPSHRDGRLYGRGASDMIXXXXXXXXXXXXXTPEPAI--ALAFL
ARGE_PROMH      -------------VPFDEGRWTQDPFTLTEKEGKLYGLGTADMKGFFAFIIDALRDIDTSQ-LTHPLYIL
DAPE_WIGBR      ----LLFAGHTDVVHANVKNWKYPPFSSKLKDGILYGRGSADMKALAAMLIAAKKFFKSYKEPKGRLAFL
DAPE_VARPS      PTKTLVFAGHTDVVPTGVEQWTSHPFTPTHRGGKLYGRGACDM---------------------------
DAPE_RICRS      N---ICFVGHVDVVEGNHELWNASPFKVSQQDGKIYGRGAVDMKAIACFLAASLDFIKNNTDFKGSISFL
DAPE_RICRO      N---ICFVGHVDVVEGNHELWNASPFKVSQQDGKIYGRGAVDMKAIACFLAASLDFIKNNTDFKGSISFL
DAPE_BUCBP      ----LAFSGHTDVVPINKILWNSPPFSPTVDKGVLFGRGSADMKALAAMVIAVERFVKKQPDHHGRIAFL
DAPE_BARBK      ----LMFAGHSDVVPPELDNWMYPPFEGIINQGKIYGRGAVDMKGAIACFIAALARVLEKQPIKGAVSLL
CNDP2_HUMAN     QKKTVCIYGHLDVQPAALEDWDSEPFTLVERDGKLYGRGSTD----------------------------
YODQ_BACSU      ----LILNGHIDVVPEGSVKWKYEPYQAVEENGKIYGRGSTDMKGNTALLFALEALHACDVKLKGDVLFQ
DAPE_RALPJ      -GKLLVFAGHTDVVPTGVEQWHSDPFEPTHRDGKLYARGAADMTSIAGFVVASEEFVAKHPDHAGSIGFL
DAPE_NITEC      -------VGHTDVVPTGVAQWDSDPFTPTVRDGFLYGRGAADM---------------------------
DAPE_MARMS      N---LCFAGHTDVVPTGPEEWKIPPFAPEIVDGVLYGRGAADMKSLAAMVTAVENFVAKHPNHSGQISFL
PEPV_LACDL      ----LGIIGHMDVVPAG-EGWTRDPFKMEIEEGRIYGRGSAD----------------------------
DAPE_RICM5      N---ICFVGHVDVVLAGNHEWNASPFKASQQDDKIYGRGAVDMKAIACFLAASLDFIKNNTDFKGSISFL
DAPE_HAES2      ----IAFAGHTDVVPINESQWTYPPFEARIVENMLYGRGAADMKALAAMVIAAETFVKHLPNHQGKIALL
DAPE_AZOSB      ----LCFAGHTDVVPTGLDAWQSPPFEPTIRDGHLYGRGAADM---------------------------
YGEY_ECOLI      ---------HIDTVGINIKNWDFDPYEGMETDELIGGRGTSDQ----------------EGGMASMIKDL
YGEY_ECOL6      ---------HIDTVGINIKNWDFDPYEGMETDELIGGRGTSDQ----------------EGGMASMIKDL
YGEY_ECO57      ---------HIDTVGINIKNWDFDPYEGMETDELIGGRGTSDQ----------------EGGMASMIKDL
DAPE_VIBPA      NEAPLAFAGHTDVVPAGLEQWDTPPFEPTIIDGYLHGRGAADMKSLAAMVVAVERFIAEHPDHKGSIGFL
DAPE_PHEZH      ----LCFAGHTDVVPVXXXXXXXXXXXXXVVDGVLIGRGAVDMKSXXXXXXXXXXXXXXXGRVTGSVSFL
DAPE_DELAS      DRPVLVFAGHTDVVPTGLEQWSSPPFVPTHRDGKLYGRGASDMKTSIAAFVVALEEFLAETPAPSDIALL
DAPE_CHRVO      DAGPLCFAGHTDVVPTGLDKWDSPPFEPTVRNGLLYGRGAADM---------------------------
DAPE_BURTA      ----LAFAGHTDVVPTGLEQWSSPPFVPTHRDGKLYGRGAADMASLAGXXXXXXXXXXXHPQHRGSIGFL
DAPE_BURPS      ----LAFAGHTDVVPTGLEQWSSPPFVPTHRDGKLYGRGAADMTSLAGXXXXXXXXXXXHPQHRGSIGFL
DAPE_BURP6      ----LAFAGHTDVVPTGLEQWSSPPFVPTHRDGKLYGRGAADMTSLAGXXXXXXXXXXXHPQHRGSIGFL
DAPE_BURP0      ----LAFAGHTDVVPTGLEQWSSPPFVPTHRDGKLYGRGAADMTSLAGXXXXXXXXXXXHPQHRGSIGFL
CNDP1_HUMAN     TKGTVCFYGHLDVQPADRGDWLTDPYVLTEVDGKLYGRGATD----------------------------
PEPVL_BACSU     ------VLCHVDVVPPG-DGWTSDPFSAEIRNGRIYARGAID----------------------------
DAPE_VIBHB      --------GHTDVVPAGLEQWDTHPFEPTIIDGYLHGRGAADMKGSLACMVVAVERFIAENDHKGSIGFL
DAPE_METFK      ----LVFAGHTDVVPTGVAQWHTPPFTPTVKDGMLYGRGAADM---------------------------
CNDP2_RAT       QKKTVCIYGHLDVQPAALEDWDSEPFTLVEREGKLYGRGSTD----------------------------
CNDP2_PONAB     QKKTVCIYGHLDVQPAALEDWDSEPFTLVERDGKLHGRGSTD----------------------------
CNDP2_MOUSE     QKKTVCIYGHLDVQPAALEDWDSEPFTLVEREGKLYGRGSTD----------------------------
CNDP2_BOVIN     QKKTVCIYGHLDVQPAALEDWDSEPFTLVERDGKLFGRGATD----------------------------
DAPE_HAES1      ----IAFAGHTDVVPINESQWTYLPFEARIVENMLYGRGAADMKALAAMVIAAETFVKHLPNHQGKIALL
DAPE_BURP1      ----LAFAGHTDVVPTGLEQWRSPPFVPTHRDGKLYGRGAADMTSLAGXXXXXXXXXXXHPQHRGSIGFL
DAPE_BURMS      ----LAFAGHTDVVPTGLEQWRSPPFVPTHRDGKLYGRGAADMTSLAGXXXXXXXXXXXHPQHRGSIGFL
DAPE_BURMA      ----LAFAGHTDVVPTGLEQWRSPPFVPTHRDGKLYGRGAADMTSLAGXXXXXXXXXXXHPQHRGSIGFL
DAPE_BURM9      ----LAFAGHTDVVPTGLEQWRSPPFVPTHRDGKLYGRGAADMTSLAGXXXXXXXXXXXHPQHRGSIGFL
DAPE_BURM7      ----LAFAGHTDVVPTGLEQWRSPPFVPTHRDGKLYGRGAADMTSLAGXXXXXXXXXXXHPQHRGSIGFL
DAPE_BORPE      ---PLTVFGHTDVVPPGRDKWDSDPFVPTERDGFLYGRGAADM---------------------------
DAPE_BORPA      ---PLTVFGHTDVVPPGRDKWDSDPFVPTERDGFLYGRGAADM---------------------------
DAPE_BORBR      ---PLTVFGHTDVVPPGRDKWDSDPFVPTERDGFLYGRGAADM---------------------------
CNDP1_MOUSE     EKPTVCFYGHLDVQPAQKDDWLTDPYTLTEVDGKLYGRGATD----------------------------
DAPE_VIBCM      --------GHTDVVPAGLSQWHTPPFEPTVIDGFLHGRGAADMKSLACMIVAVERFIAEHPDHQGSIGFL
DAPE_VIBCH      --------GHTDVVPAGLSQWHTPPFEPTVIDGFLHGRGAADMKSLACMIVAVERFIAEHPDHQGSIGFL
DAPE_VIBC3      --------GHTDVVPAGLSQWHTPPFEPTVIDGFLHGRGAADMKSLACMIVAVERFIAEHPDHQGSIGFL
DAPE_VEREI      AVKTIVFAGHTDVVPTGLEQWSSNPFLPTRRDGRLYGRGASDM---------------------------
DAPE_NITMU      --------GHTDVVPTGLEKWESSPFDPVTRNGRLYGRGAADM---------------------------
DAPE_AZOSE      -APVLCFAGHTDVVPAGLDGWDSPPFEPTVRGGQLFGRGAADM---------------------------
DAPE_NEIMF      --------GHTDVVPTGVEKWDSPPFEPAERDGRLYGRGAADM---------------------------
DAPE_NEIMB      --------GHTDVVPTGVEKWDSPPFEPAERDGRLYGRGAADM---------------------------
DAPE_NEIMA      --------GHTDVVPTGVEKWDSPPFEPTERDGRLYGRGAADM---------------------------
DAPE_NEIM0      --------GHTDVVPTGVEKWDSPPFEPTERDGRLYGRGAADM---------------------------
DAPE_NEIG2      --------GHTDVVPTGVEKWDSPPFEPTERDGRLYGRGAADM---------------------------
DAPE_NEIG1      --------GHTDVVPTGVEKWDSPPFEPTERDGRLYGRGAADM---------------------------
DAPE_ERYLH      --------GHLDVVPPG-EGWTSAPFEPEERGELLYGRGAVDMKGAIACMVDAVANVPQEA---GTISFI
DAPE_ALHEH      --------GHTDVVPPGPEQWRHPPFQPVVEQGLLYGRGAADMKGSVAAFVTALERYLAGGHRRGSLALL
DAPE_SPHWW      --------GHSDVVPPG-DGWTSDPFVPEIRGELLHGRGAVDM---KGXXXXXXXXXXRLGDHPGTISLI
DAPE_DIAST      --------GHTDVVPTGVEQWSSPPFTPTHRDGRLYGRGASDMASIXXXXXXXXXXXXXTPDPRLDIALL
DAPE_ACISJ      --------GHTDVVPTGVEQWSSPPFTPTHRDGRLYGRGASDMASIXXXXXXXXXXXXXTPDPRLDIALL
ARGE_BUCAP      --------GHTDTVDFDEHLWTKDPFKLTEKNNKLYGLGTVDM---------------------------
DAPE_PHOPR      --------GHTDVVPASLEQWHTPPFEPTIIDGYLHGRGAADM---------------------------
DAPE_HAEDU      NGDPIVFAGHTDIVPTGDPQWQYPPFSAIIVDEMLHGRGAADM---------------------------
DAPE_BURP8      ----LAFAGHTDVVPTGAEQWSSAPFEPTHRDGKLYGRGAADM---------------------------
ARGE_PASMU      ---------HTDTVPFDEGRWQFDPFKLTEKDGKFYGLGTADMKGFFAFVIDAVSQLDLT-RLTKPLRIL
DAPE_POLNA      KVKTLVFAGHTDVVPTGLAQWHSHPFTPSHRAGKLYGRGTADM---------------------------
DAPE_HELPH      NVKPLSFAGHIDVVPPG-DHWQNDPFKPVIKEGFLYGRGAQDMK--GGVGAFLSASLNFNPKTPFLLSIL
DAPE_BORA1      --------GHTDVVPPGREKWDSDPFVPTERDGYLYGRGASDM---------------------------
CNDP1_RAT       KKPSVCFYGHLDVQPAQKEDWLTDPYTLTEVDGKLYGRGATD----------------------------
DAPE_PSYIN      --------GHTDVVPTGPEEWTYPPFEPTVVDGFLFGRGAADM---------------------------
DAPE_VIBVU      --------GHTDVVPAGLEHWHTPPFEPTEKEGYLYGRGAADMKSLAAMIVATERFIAEHPDHQGSIGFL
DAPE_VIBSL      --------GHTDVVPAGIEQWNTKPFEPTIIDGFLHGRGAADM---------------------------
DAPE_HALHL      -------LGHTDVVPSGPESWQHPPFQPIVENGCLYGRGAADMKSXXXXXXXXXXXXXXHPDHAGAIAVL
LYSK_THET8      ----VVLLGHIDTVPGQIP--------VRLEGGRLFGRGAVDAKGPFVAMIFAAAGLSEEARRRLTVHLV
LYSK_THET2      ----VVLLGHIDTVPGQIP--------VRLEGGRLFGRGAVDAKGPFVAMIFAAAGLSEEARKRLTVHLV
LYSK_DEIRA      LT--VALLGHMDTVPGDIPVRVDEA-------GVLHGRGSVDAKGSLCTFIAAVSALPPEALSAARFVCI
DAPE_RHOFD      TTKLVVFAGHTDIVPSGVQQWRCHPFTPTQFDGKLYGRGAADM---------------------------
DAPE_PSEMY      ----LCFAGHTDVVPTPLDAWQYQPFDVRVEEGMLCGRGAADMKSLASMIVAVERFVADYPNHRGAISFL
DAPE_POLSJ      ----LVFAGHTDVVPTGLEQWHSHPFTPSHRNGVLYGRGAADM---------------------------
DAPE_CORGL      LASRVMLAGHIDTVPI------ADNLPSRVEDGIMYGCGTVDMKSGLAVYLHTFATLATSTELKHDLTLI
DAPE_CAMHC      --------GHIDVVKPGIG-WDSDPFDPLQKDGFIYARGAQDM---KSAVASMICAVSGVQNFNGTISLL
ARGE_SALAR      ----------TDTVPFDDGRWTRDPFTLTEHDNKLYGLGTADMKFFAFILDALRAVDVTQ--LKKPLYIL
DAPE_VIBVY      --------GHTDVVPAGLEHWHTPPFEPTEKEGYLYGRGAADMKSLAAMIVATERFIAEHPDHQGSIGFL
DAPE_IDILO      --------GHTDVVPPDINDWQFPPFEPTTHEGYLYGRGAADM---------------------------
DAPE_HELPY      NTKPLCFAGHIDVVPPG-NHWQSDPFKPVIKEGFLYGRGAQDMK--GGVGAFLSASLNFNPKTPFLLSIL
DAPE_HELPG      NVKPLCFAGHIDVVPPG-DNWQSDPFKPIIKEGFLYGRGAQDM---------------------------
DAPE_HELP2      NVKPLCFAGHIDVVPPG-DNWQSDPFKPIIKEGFLYGRGAQDM---------------------------
CPGL_SCHPO      SKKTVLIYNHFDVQPASLEDWSTDPFTLTVDNGRMFGRGATD----------------------------
DAPE_HELAH      --------GHIDVVPAG-NHWQSDPFKPTIKEGFLYGRGAQDM---------------------------
DAPE_CHRSD      TGPLLVFAGHTDVVPTGPESWQYPPFTPRIADGMLCGRGAADMKSLAAMVTAVETFIEAHPDHHGRLGFL
DAPE_PSEHT      --------GHTDVVPTGPEKWQYPPFSGLVENGLLHGRGAADM---------------------------
DAPE_PELUB      N---FMFAGHLDVVPPNIQDWTIKPFSPTIKKNHLIGRGANDMSAIASWVVAVNNYVLTNKKINGSISLL
PESC_MONBE      ----------------------------------------------------------------------
DAPE_HELPJ      --------GHIDVVPPG-NNWQSDPFKPIIKEGFLYGRGAQDM---------------------------


                         +         .         .         .         .         *         .:210
query           GVADEEARGGLGAKWLSEEHQNLFSWKNCLSESGGSHLPVHDGSDAVVINVGEKGAAQRRIHVNGDAGHG
P20D1_XENTR     GLGDEEISGHKGAQKIVEKLQSQGVKLAFVLDEG---LAVLDGQPVALVGTTEKGSVTLDLTVNRLPGHS
CBPS2_DICDI     FGHDEELGGNNGAFNINKDTNEIGPFEFILDEGLPILLPVFPGLSKPIASVGEKGAIDIKLSVTIVGGHS
P20D1_HUMAN     SLGHDEESSGTGAQRISALLQSRGVQLAFIVDEGGFILDPNFKKPIALIAVSEKGSMNLMLQVNMTSGHS
P20D1_DANRE     GLGDEEVNGLHGAKLLKSRGVKLL---YVLDEG----LAVLDGGPAALIGISEKGQTTVKLSVSTSPGHS
ACY1_HUMAN      FVPDEEVGGHQGMELFVQRPE-----FHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHA
DAPE_STAAN      ATAGEEK---------EQEGAKLLADKGYLDDVDGLIIAEPTGSG---IYYAHKGSMSCKVTATGKAVHS
DAPE_STAAM      ATAGEEK---------EQEGAKLLADKGYLDDVDGLIIAEPTGSG---IYYAHKGSMSCKVTATGKAVHS
P20D1_BOVIN     ALGDEEISGINGAQKISALLQARGVQLAFVVDEGSFIL---DGKPFAMVSVSEKGAINLMLQVNTTTGHS
ACY1_PONAB      FVPDEEVGGHQGMELFVQRPE-----FHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHA
DAPE_STAAR      ATAGEEKEQE-GAKLLAD--------KGYLDDVDGLMIAEPTGSG---IYYAHKGSMSCKVTATGKAVHS
DAPE_STAAW      ATAGEEK---------EQEGAKLLADKGYLDDVDGLIIAEPTGSG---IYYAHKGSMSCKVTATGKAVHS
DAPE_STAAS      ATAGEEK---------EQEGAKLLADKGYLDDVDGLIIAEPTGSG---IYYAHKGSMSCKVTATGKAVHS
P20D1_MOUSE     ALGDEEVSGEKGAQKISALLQARGVQLAFLVDEGSFILEPNLEKPVAMISVTEKGALDLMLQVNMTPGHS
ACY1_PIG        FVPDEEVGGHQGME-LFVKRPEFQALRAGFALDEGLASP----TDAFTVFYSERSPWWLRVTSTGKPGHG
ACY1_MOUSE      FVPDEEVGGHKGMELFVKRPEFQALRAGFALDEG-----LANPTDAFTVFYSERSPWWVRVTSTGKPGHA
ACY1B_RAT       FVPDEEVGGHQGMELFVQRHE-----FHALRAGFALDEGLANPTDAFTVFYSERSPWWVRVTSTGRPGHA
DAPE_RHIME      ITGDEEGPAINGTEWAAARGER---WDACLVGE-----PTNPDCIGDMIKIGRRGSLSGRITVHGVQGHA
DAPE_RHILO      ITGDEEGPAINGT-------VKLLEWAASRGEKWDASIPTNPDTLGDMIKIGRRGSLSGSITVNGRQGHA
DAPE_SINMW      ITGDEEGPAINGTEWAAAKGER---WDACLVGE-----PTNPGGIGEMIKIGRRGSLSGRITVQGVQGHA
DAPE_RHIL3      ITGDEEGPAINGTQWAAERGER---WDACLVGE-----PTNPDRLGDMIKIGRRGSLSGKITVHGVQGHA
P20D1_CHICK     GIGDEEVFGQKGALKIAALLESRGVKLSFLLDEGSAIL---DGKPVALIAVTEKGLMTLNFTVEKEPGHS
DAPE_RHILW      ITGDEEGPAINGTRWAAERGER---WDACLVGE-----PTNPDRLGDMIKIGRRGSLSGKITVHGVQGHA
DAPE_GRABC      ITGDEEGVATDGT-------VRVLDWMRQAGEIPDFCVPTNPGRLGEVIKIGRRGSLNATLTVRGRQGHV
DAPE_RHIEC      VTGDEEGPAINGTQWAAERGER---WDACLVGE-----PTNPDRLGDMIKIGRRGSLSGKITVHGVQGHA
DAPE_GLUDA      ITGDEEGPATFGTEWMAAHGQ-----VPDFCVVGEPTNPDHLGD---VIKIGRRGSLNARIVVPGIQGHV
DAPE_BRUAB      ITGDEEGPAVNGT-------VKLLEWAKQRGESWDASIPTNPNALGDMIKIGRRGSLSGTITVHGVQGHA
DAPE_BRUA2      ITGDEEGPAVNGT-------VKLLEWAKQRGESWDASIPTNPNALGDMIKIGRRGSLSGTITVHGVQGHA
DAPE_BRUA1      ITGDEEGPAVNGT-------VKLLEWAKQRGESWDASIPTNPNALGDMIKIGRRGSLSGTITVHGVQGHA
ACY1A_RAT       FVPDEEVGGHKGMELFVKRPEFQALRAGFALDEG-----LANPTDAFTVFYSERSPWWIRVTSTGKPGHA
DAPE_BRUME      ITGDEEGPAVNGT-------VKLLEWAKQRGESWDASIPTNPNALGDMIKIGRRGSLSGTITVHGVQGHA
DAPE_BRUMB      ITGDEEGPAVNGT-------VKLLEWAKQRGESWDASIPTNPNALGDMIKIGRRGSLSGTITVHGVQGHA
DAPE_RHOSK      ITGDEEGDAADGTDWMAAEGE---AMSVCL--VGEPTCPERLGE---MMKIGRRGSMTAFFTARGVQGHS
DAPE_BRUSU      ITGDEEGPAVNGT-------VKLLEWAKQRGESWDASIPTNPNALGDMIKIGRRGSLSGTITVHGVQGHA
DAPE_BRUSI      ITGDEEGPAVNGT-------VKLLEWAKQRGESWDASIPTNPNALGDMIKIGRRGSLSGTITVHGVQGHA
DAPE_BRUO2      ITGDEEGPAVNGT-------VKLLEWAKQRGESWDASIPTNPNALGDMIKIGRRGSLSGTITVHGVQGHA
DAPE_BRUC2      ITGDEEGPAVNGT-------VKLLEWAKQRGESWDASIPTNPNALGDMIKIGRRGSLSGTITVHGVQGHA
DAPE_ZYMMO      ITGDEEGPATFGTEWLNEQS---IKPDYCLV---GEPTSVERLGDTV--KNGRRGSVNMWIEVEGIQGHV
DAPE_PARL1      ITGDEEGPSINGTKMLEKLAARNETIDHCIVGEPTSVEKLGD-----MIKVGRRGSINGWLTVQGTQGHV
DAPE_AGRVS      ITGDEEGPSINGTEWAAAKGER---WDACLVGE-----PTNPDQLGDMIKIGRRGSLSGEIIVKGVQGHA
DAPE_RHOS4      ITGDEEGDSTDGTDWMAAEGE---AMSVCL--VGEPTCPERLGE---MMKIGRRGSMTAFFTARGVQGHS
DAPE_RHOS1      ITGDEEGDATDGTDWMAAEGE---AMSVCL--VGEPTCPERLGE---MMKIGRRGSMTAFFTARGVQGHS
DAPE_BEII9      ITGDEEGPSINGTKWAAEQGEH---FDHCIVGE-----PTNPQVLGDMIKIGRRGSLNGILSITGKQGHV
ACY1_DICDI      FVPDEEI-GGSGEKFVYTEKFRQLNIGLCLDE--GLASPTND----FTVFYGERAPWWVHITAVGNAGHG
DAPE_CITK8      ITSDEEASAKNGVETLMARNERL---DYCLVGEPSSTEIVGD-----VVKNGRRGSLTCNLTIHGVQGHV
DAPE_AGRT5      ITGDEEGPSINGTEWAAAKGE---TWDACVVGE-----PTNPDQLGDMIKIGRRGSLSGRITVQGVQGHA
DAPE_RHOCS      ITGDEEGPAVNGTR-------KVLDWMAAAGERIDACLPTNPRALGDMIKVGRRGSLTATLTALGAQGHT
DAPE2_SILST     ITGAEETGSPDGTR-------AIVQWMEA-NDIRADHFPTSLKSIGDAIKIGRRGTITVFLTVTGVQGHS
DAPE2_SHELP     VTSDEEGEAEHGTRTLVEKAQSRLP-KYCVVAE-----PTADKQAGDVIKIGRRGAISARLTLKGKQGHV
CBPS1_DICDI     CFGHDEELGGLNGHRMIARHENLVRAEAIFDEGASNFVP---GFHDIIAGVGEKGYLFYKLTSKVNSTHS
DAPE_RHOS5      ITGDEEGDSVDGTDWMATEGE---AMTVCL--VGEPTCPERLGE---MMKIGRRGSMTAFFTARGVQGHS
DAPE_WOLTR      EESTEEYGTKAVLKWMESKHKKI---DYCVVAEPTSSEKLGD-----TIKIGRRGSATFELICHGKQGHV
YE48_SCHPO      ---DEEVSGYRGALPLAHKLYERYGKDGLILDEGGFTINLF-GTLFATVCVAEKGYMDVHLKLKTPGGHA
DAPE_AGRRK      ITGDEEGPAINGTQWAAERGE---QWDASLVGE-----PTNPDQLGDMIKIGRRGSISGFITVHGVQGHA
Y1398_METMP     FVADEEDGSKYGLSYLVNNFEDIFSSKDLII------VPDFGMPEGEFIEIAEKNILWLKFKITGKQCHG
DAPE_YERE8      ITSDEEAKAINGVNALMARHERL---DYCLVGEPSSTDRVGD-----VVKNGRRGSITANLHIHGIQGHV
DAPE_METPB      ITGDEEGPAVNGT-------VKLLDWAKARGERFDHCLPTNPDSLGEMIKIGRRGSLTGRITVHGRQGHV
DAPE_LEGPL      ITSGEEGEFNLGTPYAMQKEQQGIVIDYCIVGEPSSSLKTGD-----VIKIGRRGSLSAKIHLSGKQGHV
DAPE_METC4      VTGDEEGPAVNGT-------VKLLDWAKARGERFDHCLPTNPDTLGEMIKIGRRGSLTGRITVHGRQGHV
DAPE_LEGPH      ITSGEEGEFNLGTPYVMQKEQQGIVIDYCIVGEPSSSLKAGD-----VIKIGRRGSLSAKIHLSGKQGHV
DAPE_LEGPC      ITSGEEGEFNLGTPYVMQKEQQGIVIDYCIVGEPSSSLKAGD-----IIKIGRRGSLSAKIHLSGKQGHV
DAPE_LEGPA      ITSGEEGEFNLGTPYVMQKEQQGIVIDYCIVGEPSSSLKAGD-----VIKIGRRGSLSAKIHLSGKQGHV
DAPE_CAUSK      ITGDEEGVAEDGVQALAAEGEVI---DHCIVGEPTSANLLGD-----MVKIGRRGSINAWIAVDGRQGHV
DAPE1_SILST     ITGDEEGDAVDGTTALL-DYMDAAGEKMSVCLVGEPTCPNHMGE---MIKIGRRGSMTAWFTVTGVQGHS
ARGE_PECCP      ATADEETTMA-GAKYFSESTQ---IRPDCAIIGEPTSLPVR----------AHKGHMSNAIRIQGQSGHS
DAPE_SERP5      ITSDEEASATHGVEALMARNERL---DYCLVGEPSSTERVGD-----VVKNGRRGSITANLHIHGIQGHV
DAPE_OCHA4      ITGDEEGPAINGT-------VKLLDWAKQRGESWDASIPSNPNALGDAIKIGRRGSLSGTITVHGVQGHA
DAPE_METEP      VTGDEEGPAVNGT-------VKLLDWAKARGERFDHCLPTNPDTLGEMIKIGRRGSLTGRITVHGRQGHV
DAPE_MESSB      ITGDEEGPSVNGS-------VKLLEWAAARGERWDAALPTNVETLGDMVKIGRRGSLSGRITLFGRQGHV
DAPE_MARMM      ITGDEEGPAIHGTKALADEGE---TFDHCLVGE-----PTNPNVLGDTIKSGRRGSLNCTLTVTGRQGHV
DAPE_MAGSA      ITGDEEGPAVDGTDWLAARGERI---DCCIVGE-----PTNPRKLGDMMKIGRRGSLNCRLTVFGTQGHS
DAPE_GLUOX      ITGDEEGPAHFGTKWLAERGE--------LPDFCVLGEPTNPQALGDVIKIGRRGSMNAVVTVHGTQGHV
ARGE_ERWCT      ATADEETTMA-GAKYFSESTQ---IRPDCAIIGEPTSLPVR----------AHKGHMSNAIRIQGQSGHS
DAPE_SALA4      ITSDEEASAKNGVEALMARHERL---DYCLVGEPSSTEIVGD-----VVKNGRRGSLTCNLTIHGVQGHV
DAPE_RHOP5      ITGDEEDIAVNGTQWADARGEN---FDHCIV---GEPSNVEELGDC--IKIGRRGSLSGTLIVDGVQGHV
DAPE_ERWT9      ITSDEEASATNGVEALMARHERL---DYCLVGEPSSTEVVGD-----VAKNGRRGSITANLTIHGVQGHV
DAPE_ACIF5      ITSDEEGIATHGTRWL-REHGETIDW--CVVGEPSSEKVLGD-----VIKNGRRGSLNGRLTVHGIQGHV
DAPE_ACIF2      ITSDEEGIATHGTRWL-REHGETIDW--CVVGEPSSEKVLGD-----VIKNGRRGSLNGRLTVHGIQGHV
DAPE_CAMC1      LTSDEEGDGTYGTPLALEYLREIRDLKFCVVAE-----PTCDKKFGDSIKVGRRGSINGKIVIKGVQGHV
DAPE_YERPY      ITSDEEAKATNGVEALMARHERL---DYCLVGEPSSTDRVGD-----IVKNGRRGSITANLRIHGVQGHV
DAPE_YERPS      ITSDEEAKATNGVEALMARHERL---DYCLVGEPSSTDRVGD-----IVKNGRRGSITANLRIHGVQGHV
DAPE_YERPP      ITSDEEAKATNGVEALMARHERL---DYCLVGEPSSTDRVGD-----IVKNGRRGSITANLRIHGVQGHV
DAPE_YERPN      ITSDEEAKATNGVEALMARHERL---DYCLVGEPSSTDRVGD-----IVKNGRRGSITANLRIHGVQGHV
DAPE_YERPG      ITSDEEAKATNGVEALMARHERL---DYCLVGEPSSTDRVGD-----IVKNGRRGSITANLRIHGVQGHV
DAPE_YERPE      ITSDEEAKATNGVEALMARHERL---DYCLVGEPSSTDRVGD-----IVKNGRRGSITANLRIHGVQGHV
DAPE_YERPB      ITSDEEAKATNGVEALMARHERL---DYCLVGEPSSTDRVGD-----IVKNGRRGSITANLRIHGVQGHV
DAPE_YERPA      ITSDEEAKATNGVEALMARHERL---DYCLVGEPSSTDRVGD-----IVKNGRRGSITANLRIHGVQGHV
DAPE_SACD2      ITSDEEGPAINGVEWLEARNEKI---KWCLVGEPSSTTLVGD-----VIKNGRRGSLGAELIVKGVQGHV
DAPE_METSB      ITGDEEGPAINGTKLLRWAHQRGERFDHCILGE-----PTNQQALGDMIKIGRRGSLNGTLTVKGVQGHV
DAPE_ENT38      ITSDEEASAKNGVETLMERHERL---DYCLVGEPSSTEVVGD-----VVKNGRRGSLTCNLTIHGVQGHV
DAPE_WOLPP      EESTEEHGTKAVLEWMKSKQKKI---DFCIVGEPTSSEKLGD-----TIKIGRRGSATFKLICHGKQGHV
DAPE_RICAH      LTSDEEGKAKHGTK---EMLQYIYGYKVDFAIVGE---PTCEKEIGDTIKIGRRGSVNFKLNIDGLAGHV
DAPE_METRJ      ITGDEEGPAVNGVKLLDWARRRGERFDHCVLGE-----PTNPGRLGEMIKIGRRGSLTGKLTVLGRQGHV
DAPE_EHRCR      ISGDEEGKYGTPAKWLTDNNKKI---DYCLVGEPTSKSSVGD-----TIKIGRRGSINFKIVCNGVQGHV
DAPE_EHRCJ      ISGDEEGKYGTPAKWLTDNNKKI---DFCLVGEPTSQSSVGD-----TIKIGRRGSINFKIVCNGVQGHV
DAPE_YERP3      ITSDEEAKAINGVEALMARHERL---DYCLVGEPSSTDRVGD-----IVKNGRRGSITANLRIHGVQGHV
ARGE_EDWI9      ATADEET-SMAGARYFAA--STALRPDCCIIGEPTSLKPIR----------AHKGHLSEAIRITGQSGHS
DAPE_SALTI      ITSDEEASAKNGVEALMARNERL---DYCLVGEPSSTEIVGD-----VVKNGRRGSLTCNLTIHGVQGHV
DAPE_OLICO      ITGDEEGPAVNGVKLLDWAAKRGEKFDHCLLGE-----PSNVNALGDCIKAGRRGSLSGTLIVEGKQGHA
DAPE_HAEI8      ITSDEEAAAKDGVETLMARDEKI---TYCMVGEPSSAKNLGD-----VVKNGRRGSITGNLYIKGIQGHV
DAPE_CAMLR      LTSDEEGE----AKFGTLEVLKFMKEKDILPDFAVVAEPTCDKKFGDSIKVGRRGSINAKLLIKGKQGHV
ARGE_ENT38      ATADEET-SMAGARYFSE---NTAIRPDCAIIGEPTSLPIR----------AHKGHISTAVRVLGQSGHS
DAPE_THISH      ITSDEEGPSVNGVEWLEARGEKI-TWALVGEPSSTERL-------GDVIKNGRRGSLSGVLRVRGQQGHV
DAPE_SALTY      ITSDEEASAKNGVEALMARNERL---DYCLVGEPSSTEIVGD-----VVKNGRRGSLTCNLTIHGVQGHV
DAPE_SALSV      ITSDEEASAKNGVEALMARNERL---DYCLVGEPSSTEIVGD-----VVKNGRRGSLTCNLTIHGVQGHV
DAPE_SALPK      ITSDEEASAKNGVEALMARNERL---DYCLVGEPSSTEIVGD-----VVKNGRRGSLTCNLTIHGVQGHV
DAPE_SALPC      ITSDEEASAKNGVEALMARNERL---DYCLVGEPSSTEIVGD-----VVKNGRRGSLTCNLTIHGVQGHV
DAPE_SALPB      ITSDEEASAKNGVEALMARNERL---DYCLVGEPSSTEIVGD-----VVKNGRRGSLTCNLTIHGVQGHV
DAPE_SALPA      I