[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cglu2:BAF55908.1

[Show Plain Result]


## Summary of Sequence Search
    1::165
    1::163     8e-49  53%  183 aa  DPS_MYCSM RecName: Full=DNA protection during starvation protein;  
    1::163     8e-49  53%  183 aa  DPS_MYCS2 RecName: Full=DNA protection during starvation protein;  
   28::189     2e-37  46%  189 aa  FTPA_HAEDU RecName: Full=Fine tangled pili major subunit;AltName:
   16::166     5e-24  39%  167 aa  DPS_SALTY RecName: Full=DNA protection during starvation protein;  
   16::166     5e-24  39%  167 aa  DPS_SALTI RecName: Full=DNA protection during starvation protein;  
   16::166     5e-24  39%  167 aa  DPS_SALSV RecName: Full=DNA protection during starvation protein;  
   16::166     5e-24  39%  167 aa  DPS_SALPK RecName: Full=DNA protection during starvation protein;  
   16::166     5e-24  39%  167 aa  DPS_SALPC RecName: Full=DNA protection during starvation protein;  
   16::166     5e-24  39%  167 aa  DPS_SALPB RecName: Full=DNA protection during starvation protein;  
   16::166     5e-24  39%  167 aa  DPS_SALPA RecName: Full=DNA protection during starvation protein;  
   16::166     5e-24  39%  167 aa  DPS_SALNS RecName: Full=DNA protection during starvation protein;  
   16::166     5e-24  39%  167 aa  DPS_SALHS RecName: Full=DNA protection during starvation protein;  
   16::166     5e-24  39%  167 aa  DPS_SALG2 RecName: Full=DNA protection during starvation protein;  
   16::166     5e-24  39%  167 aa  DPS_SALEP RecName: Full=DNA protection during starvation protein;  
   16::166     5e-24  39%  167 aa  DPS_SALDC RecName: Full=DNA protection during starvation protein;  
   16::166     5e-24  39%  167 aa  DPS_SALCH RecName: Full=DNA protection during starvation protein;  
   16::166     5e-24  39%  167 aa  DPS_SALA4 RecName: Full=DNA protection during starvation protein;  
   16::166     7e-24  39%  167 aa  DPS_SALAR RecName: Full=DNA protection during starvation protein;  
   16::166     1e-23  40%  167 aa  DPS_ERWT9 RecName: Full=DNA protection during starvation protein;  
   16::166     1e-23  39%  167 aa  DPS_ENTS8 RecName: Full=DNA protection during starvation protein;  
   16::166     1e-23  39%  167 aa  DPS_CITK8 RecName: Full=DNA protection during starvation protein;  
   16::164     3e-23  38%  167 aa  DPS_CITFR RecName: Full=DNA protection during starvation protein;  
   16::166     1e-22  39%  167 aa  DPS_ENTCL RecName: Full=DNA protection during starvation protein;  
   16::166     2e-22  39%  167 aa  DPS_SERP5 RecName: Full=DNA protection during starvation protein;  
   16::166     2e-22  39%  167 aa  DPS_KLEP7 RecName: Full=DNA protection during starvation protein;  
   16::166     2e-22  39%  167 aa  DPS_KLEP3 RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_SHISS RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_SHIFL RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_SHIDS RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_SHIBS RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_SHIB3 RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_PROVU RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_KLUCI RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_ESCF3 RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_ECOUT RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_ECOSM RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_ECOSE RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_ECOLU RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_ECOLI RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_ECOLC RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_ECOL5 RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_ECOHS RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_ECODH RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_ECOBW RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_ECO8A RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_ECO81 RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_ECO7I RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_ECO5E RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_ECO57 RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_ECO55 RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_ECO45 RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_ECO27 RecName: Full=DNA protection during starvation protein;  
   16::166     3e-22  38%  167 aa  DPS_ECO24 RecName: Full=DNA protection during starvation protein;  
   16::166     4e-22  39%  167 aa  DPS_SERMA RecName: Full=DNA protection during starvation protein;  
   16::166     5e-22  39%  167 aa  DPS_KLEPN RecName: Full=DNA protection during starvation protein;  
   16::166     5e-22  38%  167 aa  DPS_ECOL6 RecName: Full=DNA protection during starvation protein;  
   16::166     7e-21  36%  167 aa  DPS_ENT38 RecName: Full=DNA protection during starvation protein;  
   16::166     9e-21  36%  167 aa  DPS_YERPY RecName: Full=DNA protection during starvation protein;  
   16::166     9e-21  36%  167 aa  DPS_YERPS RecName: Full=DNA protection during starvation protein;  
   16::166     9e-21  36%  167 aa  DPS_YERPP RecName: Full=DNA protection during starvation protein;  
   16::166     9e-21  36%  167 aa  DPS_YERPN RecName: Full=DNA protection during starvation protein;  
   16::166     9e-21  36%  167 aa  DPS_YERPG RecName: Full=DNA protection during starvation protein;  
   16::166     9e-21  36%  167 aa  DPS_YERPE RecName: Full=DNA protection during starvation protein;  
   16::166     9e-21  36%  167 aa  DPS_YERPB RecName: Full=DNA protection during starvation protein;  
   16::166     9e-21  36%  167 aa  DPS_YERPA RecName: Full=DNA protection during starvation protein;  
   16::166     9e-21  36%  167 aa  DPS_YERP3 RecName: Full=DNA protection during starvation protein;  
   16::166     1e-20  37%  169 aa  DPS_YERE8 RecName: Full=DNA protection during starvation protein;  
   16::166     6e-20  36%  167 aa  DPS_PECCP RecName: Full=DNA protection during starvation protein;  
   12::158     6e-20  36%  162 aa  DPS_AGRT5 RecName: Full=DNA protection during starvation protein;  
   16::166     1e-19  37%  167 aa  DPS_SODGM RecName: Full=DNA protection during starvation protein;  
   16::166     2e-19  35%  167 aa  DPS_ERWCT RecName: Full=DNA protection during starvation protein;  
   19::162     5e-16  33%  169 aa  DPS_ACIAD RecName: Full=DNA protection during starvation protein;  
    3::144     7e-16  30%  146 aa  DPS2_BACAN RecName: Full=DNA protection during starvation protein
    7::157     3e-15  28%  179 aa  Y458_ANAVA RecName: Full=Uncharacterized low temperature-induced
    7::157     3e-15  28%  179 aa  Y458_ANASP RecName: Full=Uncharacterized low temperature-induced
   53::203     8e-15  30%  207 aa  DPS1_DEIRA RecName: Full=DNA protection during starvation protein
    7::156     2e-14  32%  159 aa  DPS_PORGI RecName: Full=DNA protection during starvation protein;  
    7::156     1e-13  31%  159 aa  DPS_PORG3 RecName: Full=DNA protection during starvation protein;  
    7::146     3e-13  27%  147 aa  DPS1_BACAN RecName: Full=DNA protection during starvation protein
   29::166     6e-12  30%  172 aa  DPS_STRSU RecName: Full=DNA protection during starvation protein;  
   32::174     6e-12  28%  175 aa  DPS_STRMU RecName: Full=DNA protection during starvation protein;  
    2::144     3e-11  25%  145 aa  G20U_BACSU RecName: Full=General stress protein 20U;       
   15::152     1e-10  26%  153 aa  MRGA_BACSU RecName: Full=Metalloregulation DNA-binding stress
    7::153     6e-10  29%  156 aa  Y1894_SYNY3 RecName: Full=Uncharacterized protein slr1894;
   13::74      7e-10  35%  149 aa  DPS_BREBE RecName: Full=DNA protection during starvation protein;
    7::153     5e-09  28%  160 aa  Y1349_HAEIN RecName: Full=Uncharacterized protein HI1349;
   17::138     1e-08  32%  176 aa  DPS_SYNE7 RecName: Full=DNA protection during starvation protein;  
    4::150     1e-08  27%  156 aa  DPS_LISIN RecName: Full=DNA protection during starvation protein;  
   17::138     1e-08  32%  176 aa  DPSA_SYNP6 RecName: Full=Nutrient stress-induced DNA-binding
    4::150     1e-08  27%  156 aa  DPS_LISMO RecName: Full=DNA protection during starvation protein;  
   66::217     4e-08  25%  241 aa  DPS2_DEIRA RecName: Full=DNA protection during starvation protein
   29::101     3e-07  35%  150 aa  YBP2_STRAU RecName: Full=Uncharacterized protein in bpoA2
   27::135     1e-06  26%  182 aa  DPS_HALSA RecName: Full=DNA protection during starvation protein;  
   17::143     4e-06  25%  144 aa  DPS_HELPY RecName: Full=DNA protection during starvation protein;  
   17::143     4e-06  27%  144 aa  DPS_HELPJ RecName: Full=DNA protection during starvation protein;  
   31::94      7e-06  30%  184 aa  DPSA_ANASP RecName: Full=Nutrient stress-induced DNA-binding
   35::173     9e-06  26%  177 aa  TPF1_TREPA RecName: Full=Antigen TpF1;AltName: Full=Antigen
   35::173     1e-05  26%  177 aa  TYF1_TREPE RecName: Full=Antigen TyF1;
  334::393     5e-04  32%  403 aa  COABC_METJA RecName: Full=Coenzyme A biosynthesis bifunctional
    7::62      6e-04  30%  149 aa  DPS_CAMJE RecName: Full=DNA protection during starvation protein;
  242::370     6e-04  32%  375 aa  DAPE_ERWCT RecName: Full=Succinyl-diaminopimelate desuccinylase;   
    1::165

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MANYTVPGINENDAKQLIDGLQERLTDYNDLHLILKHVHWNVTGPNFIAVHEMLDPQVDLVRGYADEVAE
DPS_MYCSM       MTSFTIPGLSDKKASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGVHEMIDPQVELVRGYADEVAE
DPS_MYCS2       MTSFTIPGLSDKKASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGVHEMIDPQVELVRGYADEVAE
FTPA_HAEDU      -ADHTVPGLTVATGHLIAEALQMRLQGLNELALILKHAHWNVVGPQFIAVHEMLDSQVDEVRDFIDEIAE
DPS_SALTY       ---YTRNDVSESDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALTDHLDTMAE
DPS_SALTI       ---YTRNDVSESDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALTDHLDTMAE
DPS_SALSV       ---YTRNDVSESDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALTDHLDTMAE
DPS_SALPK       ---YTRNDVSESDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALTDHLDTMAE
DPS_SALPC       ---YTRNDVSESDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALTDHLDTMAE
DPS_SALPB       ---YTRNDVSESDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALTDHLDTMAE
DPS_SALPA       ---YTRNDVSESDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALTDHLDTMAE
DPS_SALNS       ---YTRNDVSESDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALTDHLDTMAE
DPS_SALHS       ---YTRNDVSESDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALTDHLDTMAE
DPS_SALG2       ---YTRNDVSESDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALTDHLDTMAE
DPS_SALEP       ---YTRNDVSESDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALTDHLDTMAE
DPS_SALDC       ---YTRNDVSESDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALTDHLDTMAE
DPS_SALCH       ---YTRNDVSESDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALTDHLDTMAE
DPS_SALA4       ---YTRNDVSESDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALTDHLDTMAE
DPS_SALAR       ---YTRNDVSESDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRAALTDHLDTMAE
DPS_ERWT9       ---YTRNDVAEDEKKATIEVLNRLVTELIDLSLITKQAHWNMRGANFIGVHEMLDGFRTAITDHQDTIAE
DPS_ENTS8       ---YTRNDVADSDKKATIELLNRQVVNFIDLSLITKQAHWNMRGANFIGVHEMLDGFRTALTGHMDTIAE
DPS_CITK8       ---YTRNDVSDSDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALTDHLDTMAE
DPS_CITFR       ---YTRNDVSDSEKKATVELLNQQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALTDHLDTMAE
DPS_ENTCL       ---YTRNDVSDSDKKATIELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALVTHLDTMAE
DPS_SERP5       ---YTRNDMDEKTKLDAIKALNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTAIIDHQDTFAE
DPS_KLEP7       ---YTRNDVADSEKKATIELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALTEHLDTMAE
DPS_KLEP3       ---YTRNDVADSEKKATIELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALTEHLDTMAE
DPS_SHISS       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_SHIFL       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_SHIDS       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_SHIBS       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_SHIB3       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_PROVU       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_KLUCI       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_ESCF3       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_ECOUT       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_ECOSM       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_ECOSE       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_ECOLU       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_ECOLI       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_ECOLC       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_ECOL5       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_ECOHS       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_ECODH       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_ECOBW       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_ECO8A       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_ECO81       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_ECO7I       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_ECO5E       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_ECO57       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_ECO55       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_ECO45       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_ECO27       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_ECO24       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_SERMA       ---YTRNDLDEKVKLAAIKALNHQVVQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTAIIEHQDTFAE
DPS_KLEPN       ---YTRNDVADSEKKATIELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALTEHLDTMAE
DPS_ECOL6       ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
DPS_ENT38       ---YTRNDVSDSDKKATIELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALVTHLDTMAE
DPS_YERPY       ---YTRNDVEEHVKVATIKRLNQMVIQFIDLSLITKQAHWNMRGANFVAVHEMLDGFRTALTDHLDTFAE
DPS_YERPS       ---YTRNDVEEHVKVATIKRLNQMVIQFIDLSLITKQAHWNMRGANFVAVHEMLDGFRTALTDHLDTFAE
DPS_YERPP       ---YTRNDVEEHVKVATIKRLNQMVIQFIDLSLITKQAHWNMRGANFVAVHEMLDGFRTALTDHLDTFAE
DPS_YERPN       ---YTRNDVEEHVKVATIKRLNQMVIQFIDLSLITKQAHWNMRGANFVAVHEMLDGFRTALTDHLDTFAE
DPS_YERPG       ---YTRNDVEEHVKVATIKRLNQMVIQFIDLSLITKQAHWNMRGANFVAVHEMLDGFRTALTDHLDTFAE
DPS_YERPE       ---YTRNDVEEHVKVATIKRLNQMVIQFIDLSLITKQAHWNMRGANFVAVHEMLDGFRTALTDHLDTFAE
DPS_YERPB       ---YTRNDVEEHVKVATIKRLNQMVIQFIDLSLITKQAHWNMRGANFVAVHEMLDGFRTALTDHLDTFAE
DPS_YERPA       ---YTRNDVEEHVKVATIKRLNQMVIQFIDLSLITKQAHWNMRGANFVAVHEMLDGFRTALTDHLDTFAE
DPS_YERP3       ---YTRNDVEEHVKVATIKRLNQMVIQFIDLSLITKQAHWNMRGANFVAVHEMLDGFRTALTDHLDTFAE
DPS_YERE8       ---YTRNDVDEHTKTLTIKLLNELVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTTINDHLDTFAE
DPS_PECCP       ---YTRNDLDDSVKTSTIALLNQLVVDFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTSIIDHQDTIAE
DPS_AGRT5       -----------SNAKSTVIGLNESLASVIDLALVTKQAHWNLKGPQFIAVHELLDTFRTQLDNHGDTIAE
DPS_SODGM       ---FTRNDVDEEVKTTTIVTLNRIVIELVDLALITKQAHWNMRGNNFIGVHEMLDGFRTAILEHQDTIAE
DPS_ERWCT       ---YTRNDLDDSVKTSTIALLNQLVVDFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTSIIDHQDTIAE
DPS_ACIAD       ------PAVKESTVKIL----NQILANLIDLSLLTKQAHWNMRGSNFIAVHEMLDTFRTSLITHLDNVAE
DPS2_BACAN      --------------KQVIEVLNKQVADWSVLFTKLHNFHWYVKGPQFFTLHEKFEELYTESATHIDEIAE
Y458_ANAVA      -------GLTDEQRQGVINLLNQDLADSYLLLVKTKKYHWDVVGPQFRSLHQLWEEHYEKLTENIDAIAE
Y458_ANASP      -------GLTDEQRQGVINLLNQDLADSYLLLVKTKKYHWDVVGPQFRSLHQLWEEHYEKLTENIDAIAE
DPS1_DEIRA      --------LEEKEFQTVAETLQRNLATTISLYLKFKKYHWDIRGRFFRDLHLAYDEFIAEIFPSIDEQAE
DPS_PORGI       -----VTGLKEQQVAPVVKGLSGLLADLQVYYSNLRGFHWNIRGAEFFVLHEQYEKMYDDLAGKIDEVAE
DPS_PORG3       -----VTGLKEQQVAPVVKGLSGLLADLQVYYSNLRGFHWNIRGAEFFVLHEQYEKMYDDLAGKIDEVAE
DPS1_BACAN      ----------------VVEVLNKQVANWNVLYVKLHNYHWYVTGPHFFTLHEKFEEFYNEAGTYIDELAE
DPS_STRSU       --------------------LNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLDEMSE
DPS_STRMU       --------------------LNQAVADLSKAASIVHQVHWYMRGSGFLYLHPKMDELMDALNGHLDEISE
G20U_BACSU      -------------SEQLIQAVNKQVANWTVMYVKLHNYHWYVKGKDFFTLHEKFEELYNETATYIDDLAE
MRGA_BACSU      ------------------NSLNTQLSNWFLLYSKLHRFHWYVKGPHFFTLHEKFEELYDHAAETVDTIAE
Y1894_SYNY3     -------GIPEADRIKIAESLKKLLADTYTLYLQTHNFHWNVTGPQFRDLHLMFEEQYNELALAVDDIAE
DPS_BREBE       --------------------LNRQVANWVVLYVKLHNFHWNVNGPNFFTLHEKFEELYTEASGHIDTLAE
Y1349_HAEIN     -------GLDKVQSAELADKLNELLATYQVFYTNVRGYHWNIKGVNFFALHAKFEEIYTNLVARVDEVAE
DPS_SYNE7       -----VLGLETSVTSQICEGLNRALASFQVLYLQYQKHHFTVQGAEFYSLHEFFEDSYGSVKDHVHDLGE
DPS_LISIN       --------INSVDTKEF---LNHQVANLNVFTVKIHQIHWYMRGHNFFTLHEKMDDLYSEFGEQMDEVAE
DPSA_SYNP6      -----VLGLETSVTSQICEGLNRALASFQVLYLQYQKHHFTVQGAEFYSLHEFFEDSYGSVKDHVHDLGE
DPS_LISMO       --------INSVDTKEF---LNHQVANLNVFTVKIHQIHWYMRGHNFFTLHEKMDDLYSEFGEQMDEVAE
DPS2_DEIRA      ----TLPAAGTEDLKKSVXXXXXXXXXXXXXXXXXXXXHWNVSGTLWYTLHELLQDHYEGISKFADDVAE
YBP2_STRAU      -----------HDARQYCQRLNRVLADTQFLYALYKKCHWGMRGPTAYQLHLLFDKHAQEQLELVDALAE
DPS_HALSA       -------------AEQCVDALNADLANVYVLYHQLKKHHWNVEGAEFRDLHLFLGXXXXXXXXXXXXXXX
DPS_HELPY       ------------------------------LFMKVHNFHWNVKGTDFFNVHKATEEIYEEFADMFDDLAE
DPS_HELPJ       ------------------------------LFMKVHNFHWNVKGTDFFNVHKATE---EIYEGFADDLAE
DPSA_ANASP      ------------------EGLNVLLASFQALYLQYQKHHFVVEGAEFYSLHEFFNSSYNEVQDHVHEIGE
TPF1_TREPA      ----------------ICEQLRQHVADLGVLYIKLHNYHWHIYGIEFKQVHELLEEYYVSVTEAFDTIAE
TYF1_TREPE      ----------------ICEQLRRHVADLGVLYIKLHNYHWHIYGIEFKQVHELLEEYYVSVTEAFDTIAE
COABC_METJA     ------------DEKELINRAKERLNKYNLNMIIANDLSKHYFGDDYIEVYIITKYEVEKISGSKKEISE
DPS_CAMJE       --------------------LLQMQADAHHLWVKFHNYHWNVKGLQFFSIHEYTEKAYEEMAELFDSCAE
DAPE_ERWCT      -SNNVIPGFNFRFSTELTDVLQQRVAELLDRHQLNYTIDWKLSGQPFLTARELVDAVVNAVKHY-NEVTP


                         .         .         *         .         .         .         .:140
query           RISTLGGAPVGTPEGHVADRTPLQYERNAGNAQAHLTDLNRVYTQVLTGVRESMASAGPVDPVTEDIYIG
DPS_MYCSM       RIATLGKSPKGTPGAIIKDRTWDDYSVERDTVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIA
DPS_MYCS2       RIATLGKSPKGTPGAIIKDRTWDDYSVERDTVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIA
FTPA_HAEDU      RMATLGVAPNGLSGNLVETRQSPEYPLGRATAQDHLKLIDLYYSHNIEAHRVVLEHNGHLDPISEDLLVA
DPS_SALTY       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAVVANDVRKAIGEAKDED--TADIFTA
DPS_SALTI       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAVVANDVRKAIGEAKDED--TADIFTA
DPS_SALSV       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAVVANDVRKAIGEAKDED--TADIFTA
DPS_SALPK       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAVVANDVRKAIGEAKDED--TADIFTA
DPS_SALPC       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAVVANDVRKAIGEAKDED--TADIFTA
DPS_SALPB       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAVVANDVRKAIGEAKDED--TADIFTA
DPS_SALPA       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAVVANDVRKAIGEAKDED--TADIFTA
DPS_SALNS       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAVVANDVRKAIGEAKDED--TADIFTA
DPS_SALHS       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAVVANDVRKAIGEAKDED--TADIFTA
DPS_SALG2       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAVVANDVRKAIGEAKDED--TADIFTA
DPS_SALEP       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAVVANDVRKAIGEAKDED--TADIFTA
DPS_SALDC       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAVVANDVRKAIGEAKDED--TADIFTA
DPS_SALCH       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAVVANDVRKAIGEAKDED--TADIFTA
DPS_SALA4       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAVVANDVRKAIGEAKDED--TADIFTA
DPS_SALAR       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAVVANDVRKAIGEAKDED--TADIFTA
DPS_ERWT9       RVVQLGGVALGTAQ-VVNDRTPLKYPLNIHSVQDHLKALADRYGVVANDMRKAIGEVEDED--TADIFTA
DPS_ENTS8       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHSVQDHLKELADRYAIVANDVRKAISEAQDED--TADIFTA
DPS_CITK8       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHSVQDHLKELADRYSVVANDVRKAISEAKDED--TADIFTA
DPS_CITFR       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELAERYAVVANSVRKAISEAKDED--TADIFTA
DPS_ENTCL       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHTVQDHLKELADRYAIVANDVRKAIGEAKDED--TADIFTA
DPS_SERP5       RIVQLGGVALGTVQ-VVNDKTPLKYPTNIHSVQEHLKALADRYGAVANDIRKAITEVADED--TADMFTA
DPS_KLEP7       RAVQLGGVALGTTQ-VINSKTPLQYPLDIHHVQDHLKALADRYAVVANDVRKAIDEAKDED--TADIFTA
DPS_KLEP3       RAVQLGGVALGTTQ-VINSKTPLQYPLDIHHVQDHLKALADRYAVVANDVRKAIDEAKDED--TADIFTA
DPS_SHISS       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_SHIFL       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_SHIDS       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_SHIBS       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_SHIB3       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_PROVU       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_KLUCI       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_ESCF3       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_ECOUT       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_ECOSM       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_ECOSE       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_ECOLU       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_ECOLI       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_ECOLC       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_ECOL5       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_ECOHS       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_ECODH       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_ECOBW       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_ECO8A       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_ECO81       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_ECO7I       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_ECO5E       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_ECO57       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_ECO55       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_ECO45       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_ECO27       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_ECO24       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIGEA--KDDDTADILTA
DPS_SERMA       RVVQLGGVALGTVQ-VVNDRTPLKYPTNIHSVQEHLKALADRYGAVANDIRKAITEVEDED--TADMFTA
DPS_KLEPN       RAVQLGGVALGTTQ-VINSKTPLQYPLDIHHVQDHLKALADRYAVVANDVRKAIDEAKDED--TADIFTA
DPS_ECOL6       RAVQLGGVALGTTQ-VINSKTPLKYPLDIHNVQDHLKELADRYAIVANDVRKAIDEA--KDDDTADILTA
DPS_ENT38       RAVQLGGVALGTTQVINSKTALKSYPLDIHSVQDHLKELADRYAIVANDVRKAIGEAKDED--TADILTA
DPS_YERPY       RAVQLGGVALGTAQ-VINDKTPLKYPTNIHSVQEHLKALAERYAIVANDIRKAITEV--EDENSADMFTA
DPS_YERPS       RAVQLGGVALGTAQ-VINDKTPLKYPTNIHSVQEHLKALAERYAIVANDIRKAITEV--EDENSADMFTA
DPS_YERPP       RAVQLGGVALGTAQ-VINDKTPLKYPTNIHSVQEHLKALAERYAIVANDIRKAITEV--EDENSADMFTA
DPS_YERPN       RAVQLGGVALGTAQ-VINDKTPLKYPTNIHSVQEHLKALAERYAIVANDIRKAITEV--EDENSADMFTA
DPS_YERPG       RAVQLGGVALGTAQ-VINDKTPLKYPTNIHSVQEHLKALAERYAIVANDIRKAITEV--EDENSADMFTA
DPS_YERPE       RAVQLGGVALGTAQ-VINDKTPLKYPTNIHSVQEHLKALAERYAIVANDIRKAITEV--EDENSADMFTA
DPS_YERPB       RAVQLGGVALGTAQ-VINDKTPLKYPTNIHSVQEHLKALAERYAIVANDIRKAITEV--EDENSADMFTA
DPS_YERPA       RAVQLGGVALGTAQ-VINDKTPLKYPTNIHSVQEHLKALAERYAIVANDIRKAITEV--EDENSADMFTA
DPS_YERP3       RAVQLGGVALGTAQ-VINDKTPLKYPTNIHSVQEHLKALAERYAIVANDIRKAITEV--EDENSADMFTA
DPS_YERE8       RAVQLGGIALGTAQ-LVTEKTPLEYPTRIHSVQDHLKELADRYGVVANFVRKAITEVKDED--SADMFTA
DPS_PECCP       RVVQIGGVALGTVQ-IVGKQTSLKYPTNIHSVQDHLKALAERYAIVANNVRKAIGKT--EDEASADILTA
DPS_AGRT5       RVVQLGGTALGSLQA-VSSTTKLKYPTDIYKIHDHLDALIERYGEVANMIRKAIDDSDEADPTTADIFTA
DPS_SODGM       RVVQLGGVALGTVQ-VTNDKTPLKYPTNIHTVQDHLKALADRYGIVANDVRKAITEV--EDDDTADIFTA
DPS_ERWCT       RVVQIGGVALGTVQ-IVGKQTSLKYPTTIHSVQDHLKALAERYAIVANNVRQAIGKT--EDEASADILTA
DPS_ACIAD       RAVQIGXXXXXXXXXXXXXXXXXXYPVEIHNVQDHLKELADRYGIVANHLRDTIEEI--QDPISEDIIHA
DPS2_BACAN      RILAIGGKPVATMKEYL-EISSIQEAAYGETAEGMVEAIMKDYEMMLVELKKGMEIANSDDEMTSDLLLG
Y458_ANAVA      RVRTLGGYPIGSMEGFLQLATLKEHAGDVPSATGMVANLVQDHEQLIRNLRDHVDRSGDQDQGTADFLTG
Y458_ANASP      RVRTLGGYPIGSMEGFLQLATLKEHAGDVPSATGMVANLVQDHEQLIRNLRDHVDRSGDQDQGTADFLTG
DPS1_DEIRA      RLVALGGSPLAAPADLARYSTVQVPQETVRDARTQVADLVQDLSRVGKGYRDSQACDEANDPVTADMYNG
DPS_PORGI       RILQLGGKPENRFSEYVAEVKEEHELVCAASTLKNVTDTLQIIMAKERAIAEVAGEAG--DEVTVDLMIG
DPS_PORG3       RILQLGGKPENRFSEYVAEVKEEHELVCAASTLKNVTDTLQIIMAKERAIAEVAGEAG--DEVTVDLMIG
DPS1_BACAN      RILALEGKPLATMKEYLA-TSSVNEGTSKESAEEMVQTLVNDYSALIQELKEGMEVAGEADATSADMLLA
DPS_STRSU       RLITLGGAPFSTSENSQLKEVLGDYNVTIEEQLARVVEVFRYLAALFQKGFDVSDEEG--DSVTNDIFNV
DPS_STRMU       RLITIGGAPFSTDENSRLEETVGTWDKSITD---HLKRLVQVYDYLSSLYQVGLVTDEEDDAVSNDIFTA
G20U_BACSU      RLLALNGKPIATMKESLETAS---VKEAAGNAEQMVQSVYDDFTVIAEELKNGMDLADEVDETTGDMLLA
MRGA_BACSU      RLLAIGGQPVATVKEY-TEHASITDGGNETSASEMVQALVNDYKQISSESKFVIGLAEEQDNATADLFVG
Y1894_SYNY3     RIRSLDVFAPGTYK-EFAKLSSVQEVDGIPTSKEMVDILTKGHETIVQSCRDVLKCSQPAD---DESTIA
DPS_BREBE       RVLSIGGSPIAT----------------------------------------------------------
Y1349_HAEIN     RILTLGYTP-NNAYSQYLKISRIKEDIAVSEAQECLSGTLQGLKTLLDQQREILAFANNADEGTASQMSD
DPS_SYNE7       RLNGLGGVPVAHPDGVFNCRTMLEHDLAA--EQAILSLLRRLTAQV------------------------
DPS_LISIN       RLLAIGGSPFSTLENASVEEAPYTKPKTMDQLMEDLVTLELLRDEYKQGIELTDKEG---DDVTNDMLIA
DPSA_SYNP6      RLNGLGGVPVAHPDGVFNCRTMLEHDLAA--EQAILSLLRRLTAQV------------------------
DPS_LISMO       RLLAIGGSPFSTLENASVEEAPYTKPKTMDQLMEDLVTLELLRDEYQQGIELTDKEG---DNVTNDMLIA
DPS2_DEIRA      RQLSVGASSDGRAITIVASRLPEIPGGFLDDAQV-IQFFTYQYETVGQRIHQRVGDVEKVDPTTANLLQE
YBP2_STRAU      RVQTLGGVAVGDP---------------------------------------------------------
DPS_HALSA       RVQALGGVPHASPETLQAEASVDVEDEDVYDIRTSLANDMAIYGDIIEATRE------------------
DPS_HELPY       RIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKYLEKEFKESNTAEKEGDKVTVTYADD
DPS_HELPJ       RIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKHLEKEFKESNTAEKEGDKVTVTYADD
DPSA_ANASP      RLNGLGGVPAAS----------------------------------------------------------
TPF1_TREPA      RLLQLGAAPASMAEYLALSGIAEETEKEITIVSA-LARVKRDFEYLSTRFSQTVLAAESGDAVTDGIITD
TYF1_TREPE      RLLQLGAAPASMAEYLALSGIAEETEKEITIVSA-LARVKRDFEYLSTRFSQTVLAAESGDAVTDGIITD
COABC_METJA     RI--------------------------------------------------------------------
DPS_CAMJE       RVLQLG----------------------------------------------------------------
DAPE_ERWCT      ELLTNG----GTSDGRFIARMGAQVELGPINATIHKVDLSRMYQRIM-----------------------


                         +         .         .         .         .         *         .:210
query           QAAELEKFQWFIRAHIVDVDGNIxx
DPS_MYCSM       HAGELEKFQWFVRAHLESAGGQL--
DPS_MYCS2       HAGELEKFQWFVRAHLESAGGQL--
FTPA_HAEDU      QTRSLEKLQWFIRAHLDNGNGNI--
DPS_SALTY       ASRDLDKFLWFIESNI---------
DPS_SALTI       ASRDLDKFLWFIESNI---------
DPS_SALSV       ASRDLDKFLWFIESNI---------
DPS_SALPK       ASRDLDKFLWFIESNI---------
DPS_SALPC       ASRDLDKFLWFIESNI---------
DPS_SALPB       ASRDLDKFLWFIESNI---------
DPS_SALPA       ASRDLDKFLWFIESNI---------
DPS_SALNS       ASRDLDKFLWFIESNI---------
DPS_SALHS       ASRDLDKFLWFIESNI---------
DPS_SALG2       ASRDLDKFLWFIESNI---------
DPS_SALEP       ASRDLDKFLWFIESNI---------
DPS_SALDC       ASRDLDKFLWFIESNI---------
DPS_SALCH       ASRDLDKFLWFIESNI---------
DPS_SALA4       ASRDLDKFLWFIESNI---------
DPS_SALAR       ASRDLDKFLWFIESNI---------
DPS_ERWT9       ASRDLDKFLWFIESNI---------
DPS_ENTS8       ASRDLDKFLWFIESNI---------
DPS_CITK8       ASRDLDKFLWFIEANI---------
DPS_CITFR       ASRDLDKFLWFIES-----------
DPS_ENTCL       ASRDLDKFLWFIESNI---------
DPS_SERP5       ASRDLDKFLWFIESNI---------
DPS_KLEP7       ASRDLDKFLWFIEANI---------
DPS_KLEP3       ASRDLDKFLWFIEANI---------
DPS_SHISS       ASRDLDKFLWFIESNI---------
DPS_SHIFL       ASRDLDKFLWFIESNI---------
DPS_SHIDS       ASRDLDKFLWFIESNI---------
DPS_SHIBS       ASRDLDKFLWFIESNI---------
DPS_SHIB3       ASRDLDKFLWFIESNI---------
DPS_PROVU       ASRDLDKFLWFIESNI---------
DPS_KLUCI       ASRDLDKFLWFIESNI---------
DPS_ESCF3       ASRDLDKFLWFIESNI---------
DPS_ECOUT       ASRDLDKFLWFIESNI---------
DPS_ECOSM       ASRDLDKFLWFIESNI---------
DPS_ECOSE       ASRDLDKFLWFIESNI---------
DPS_ECOLU       ASRDLDKFLWFIESNI---------
DPS_ECOLI       ASRDLDKFLWFIESNI---------
DPS_ECOLC       ASRDLDKFLWFIESNI---------
DPS_ECOL5       ASRDLDKFLWFIESNI---------
DPS_ECOHS       ASRDLDKFLWFIESNI---------
DPS_ECODH       ASRDLDKFLWFIESNI---------
DPS_ECOBW       ASRDLDKFLWFIESNI---------
DPS_ECO8A       ASRDLDKFLWFIESNI---------
DPS_ECO81       ASRDLDKFLWFIESNI---------
DPS_ECO7I       ASRDLDKFLWFIESNI---------
DPS_ECO5E       ASRDLDKFLWFIESNI---------
DPS_ECO57       ASRDLDKFLWFIESNI---------
DPS_ECO55       ASRDLDKFLWFIESNI---------
DPS_ECO45       ASRDLDKFLWFIESNI---------
DPS_ECO27       ASRDLDKFLWFIESNI---------
DPS_ECO24       ASRDLDKFLWFIESNI---------
DPS_SERMA       ASRDLDKFLWFIESNI---------
DPS_KLEPN       ASRDLDKFLWFIESNI---------
DPS_ECOL6       ASRDLDKFLWFIESNI---------
DPS_ENT38       ASRDLDQFLWFIESNI---------
DPS_YERPY       ASRDLDKFLWFIESNI---------
DPS_YERPS       ASRDLDKFLWFIESNI---------
DPS_YERPP       ASRDLDKFLWFIESNI---------
DPS_YERPN       ASRDLDKFLWFIESNI---------
DPS_YERPG       ASRDLDKFLWFIESNI---------
DPS_YERPE       ASRDLDKFLWFIESNI---------
DPS_YERPB       ASRDLDKFLWFIESNI---------
DPS_YERPA       ASRDLDKFLWFIESNI---------
DPS_YERP3       ASRDLDKFLWFIESNI---------
DPS_YERE8       ASRDLDKFLWFLEANL---------
DPS_PECCP       ASRDLDQFLWFIESNI---------
DPS_AGRT5       ASRDLDKSLWFLEAHV---------
DPS_SODGM       ASRDLDKFLWFIESNI---------
DPS_ERWCT       ASRDLDQFLWFIESNI---------
DPS_ACIAD       ALEDLDQYLWFLEANI---------
DPS2_BACAN      IYTELEKHAWMLRAFL---------
Y458_ANAVA      LMEEHEEIAWMLRSFI---------
Y458_ANASP      LMEEHEEIAWMLRSFI---------
DPS1_DEIRA      YAATIDKIRWMLQAIMDD-------
DPS_PORGI       FLSEQEKLVWMLSAY----------
DPS_PORG3       FLSGQEKLVWMLSAY----------
DPS1_BACAN      IHTTLEQHVWMLSAFL---------
DPS_STRSU       AKASIEKHIWMLQAEL---------
DPS_STRMU       AQTEAQKTIWMLQAELGQAPG----
G20U_BACSU      IHQNIEKHNWMLKAYL---------
MRGA_BACSU      LIEEVEKQVWMLSSYL---------
Y1894_SYNY3     LASDREKTAWMLRA-----------
DPS_BREBE       -------------------------
Y1349_HAEIN     YIKEQEKLVWMFQA-----------
DPS_SYNE7       -------------------------
DPS_LISIN       FKASIDKHIWMFKAFL---------
DPSA_SYNP6      -------------------------
DPS_LISMO       FKASIDKHIWMFKAFL---------
DPS2_DEIRA      VEHIIEKYQWQMRAFL---------
YBP2_STRAU      -------------------------
DPS_HALSA       -------------------------
DPS_HELPY       QLAKLQKSIWMLQAHL---------
DPS_HELPJ       QLAKLQKSIWMLEAHL---------
DPSA_ANASP      -------------------------
TPF1_TREPA      ILRTLGKAIWMLGA-----------
TYF1_TREPE      ILRTLGKAIWMLGA-----------
COABC_METJA     -------------------------
DPS_CAMJE       -------------------------
DAPE_ERWCT      -------------------------