[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF52967.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cwvB.bssp"
#ERROR : Can't open dsspfile "1dc1A.bssp"
#ERROR : Can't open dsspfile "1dc1B.bssp"
#ERROR : Can't open dsspfile "1ei1A.bssp"
#ERROR : Can't open dsspfile "1bgwA.bssp"
#ERROR : Can't open dsspfile "2e1qA.bssp"
#ERROR : Can't open dsspfile "3cwvA.bssp"
#ERROR : Can't open dsspfile "3b39B.bssp"
#ERROR : Can't open dsspfile "3b39A.bssp"
#ERROR : Can't open dsspfile "2ckjB.bssp"
#ERROR : Can't open dsspfile "1bjtA.bssp"
#ERROR : Can't open dsspfile "2ckjD.bssp"
#ERROR : Can't open dsspfile "2e3tA.bssp"
#ERROR : Can't open dsspfile "2e3tB.bssp"
#ERROR : Can't open dsspfile "2ckjC.bssp"
#ERROR : Can't open dsspfile "2au3A.bssp"
#ERROR : Can't open dsspfile "3b9jK.bssp"
#ERROR : Can't open dsspfile "2ckjA.bssp"
#ERROR : Can't open dsspfile "2b3qA.bssp"
#ERROR : Can't open dsspfile "2b3pA.bssp"
#ERROR : Can't open dsspfile "2cg9A.bssp"
#ERROR : Can't open dsspfile "1b1eA.bssp"
#ERROR : Can't open dsspfile "1b1iA.bssp"
#ERROR : Can't open dsspfile "1a4yB.bssp"
#ERROR : Can't open dsspfile "2czvC.bssp"
#ERROR : Can't open dsspfile "1b9cA.bssp"
#ERROR : Can't open dsspfile "2awjA.bssp"
#ERROR : Can't open dsspfile "2czvD.bssp"
#ERROR : Can't open dsspfile "1cvrA.bssp"
#ERROR : Can't open dsspfile "2awlA.bssp"
#ERROR : Can't open dsspfile "3cygA.bssp"
#ERROR : Can't open dsspfile "2awkA.bssp"
#ERROR : Can't open dsspfile "2c7cO.bssp"
#ERROR : Can't open dsspfile "2b6cA.bssp"
#ERROR : Can't open dsspfile "1b1jA.bssp"
#ERROR : Can't open dsspfile "1aj6A.bssp"
#ERROR : Can't open dsspfile "1bknA.bssp"
#ERROR : Can't open dsspfile "3bdjA.bssp"
#ERROR : Can't open dsspfile "1dgjA.bssp"
#ERROR : Can't open dsspfile "3bcyA.bssp"
#ERROR : Can't open dsspfile "1b62A.bssp"
#ERROR : Can't open dsspfile "2cbqC.bssp"
#ERROR : Can't open dsspfile "2cbqA.bssp"
#ERROR : Can't open dsspfile "1bknB.bssp"
#ERROR : Can't open dsspfile "2cg9B.bssp"
#ERROR : Can't open dsspfile "2cbqB.bssp"
#ERROR : Can't open dsspfile "3c0eA.bssp"
#ERROR : Can't open dsspfile "1b63A.bssp"
#ERROR : Can't open dsspfile "1ah8A.bssp"
#ERROR : Can't open dsspfile "1ea6A.bssp"
#ERROR : Can't open dsspfile "1byqA.bssp"
#ERROR : Can't open dsspfile "2brcA.bssp"
#ERROR : Can't open dsspfile "1ah6A.bssp"
#ERROR : Can't open dsspfile "3c11A.bssp"
#ERROR : Can't open dsspfile "1ea6B.bssp"
#ERROR : Can't open dsspfile "2cgfA.bssp"
#ERROR : Can't open dsspfile "2ccsA.bssp"
#ERROR : Can't open dsspfile "1ah8B.bssp"
#ERROR : Can't open dsspfile "2breA.bssp"
#ERROR : Can't open dsspfile "3dpwA.bssp"

## Summary of PDB Search
:684
    4e-92  26%  3cwvB  [x.x.x] DNA GYRASE, B SUBUNIT, TRUNCATED
    5e-87  13%  1dc1A  [c.52.1] BSOBI RESTRICTION ENDONUCLEASE
    1e-84  13%  1dc1B  [c.52.1] BSOBI RESTRICTION ENDONUCLEASE
    8e-66  47%  1ei1A  [d.122.1 - d.14.1] DNA GYRASE B
    2e-65  29%  1bgwA  [x.x.x] TOPOISOMERASE
    1e-59   9%  2e1qA  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    4e-57  25%  3cwvA  [x.x.x] DNA GYRASE, B SUBUNIT, TRUNCATED
    6e-57  11%  3b39B  [x.x.x] DNA PRIMASE
    7e-55  13%  3b39A  [x.x.x] DNA PRIMASE
    9e-55   8%  2ckjB  [x.x.x] XANTHINE OXIDOREDUCTASE
    1e-51  26%  1bjtA  [x.x.x] TOPOISOMERASE II
    7e-50   8%  2ckjD  [x.x.x] XANTHINE OXIDOREDUCTASE
    3e-46  10%  2e3tA  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    1e-45  10%  2e3tB  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    1e-44   8%  2ckjC  [x.x.x] XANTHINE OXIDOREDUCTASE
    2e-44  16%  2au3A  [x.x.x] DNA PRIMASE
    2e-43  10%  3b9jK  [x.x.x] XANTHINE OXIDASE
    2e-43   9%  2ckjA  [x.x.x] XANTHINE OXIDOREDUCTASE
    7e-35  12%  2b3qA  [x.x.x] GREEN FLUORESCENT PROTEIN
    8e-34  12%  2b3pA  [x.x.x] GREEN FLUORESCENT PROTEIN
    6e-33  13%  2cg9A  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    4e-29  11%  1b1eA  [d.5.1] HYDROLASE ANGIOGENIN
    1e-28  11%  1b1iA  [d.5.1] HYDROLASE ANGIOGENIN
    4e-28  11%  1a4yB  [d.5.1] ANGIOGENIN
    5e-28  21%  2czvC  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 2
    2e-27   9%  1b9cA  [d.22.1] PROTEIN (GREEN FLUORESCENT PROTEIN)
    2e-27  10%  2awjA  [x.x.x] GREEN-FLUORESCENT PROTEIN
    3e-27  21%  2czvD  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 2
    1e-26  10%  1cvrA  [c.17.1 - b.1.18] GINGIPAIN R
    1e-24   8%  2awlA  [x.x.x] GREEN FLUORESCENT PROTEIN
    4e-24  11%  3cygA  [x.x.x] UNCHARACTERIZED PROTEIN
    6e-23   8%  2awkA  [x.x.x] GREEN FLUORESCENT PROTEIN
    1e-22  26%  2c7cO  [x.x.x] 10 KDA CHAPERONIN MOLECULE: GROES, PROTEIN
    1e-21  10%  2b6cA  [x.x.x] HYPOTHETICAL PROTEIN EF3068
    5e-21  13%  1b1jA  [d.5.1] HYDROLASE ANGIOGENIN
    2e-16  42%  1aj6A  [x.x.x] GYRASE
    4e-15  14%  1bknA  [d.122.1 - d.14.1] MUTL
    4e-14   9%  3bdjA  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    1e-13   9%  1dgjA  [d.15.4 - a.56.1 - d.41.1 - d.133.1] ALDEHYDE OXIDOREDUCTASE
    2e-13  11%  3bcyA  [x.x.x] PROTEIN YER067W
    2e-13  14%  1b62A  [d.122.1 - d.14.1] PROTEIN (MUTL)
    5e-13  12%  2cbqC  [x.x.x] NEOCARZINOSTATIN
    3e-12  12%  2cbqA  [x.x.x] NEOCARZINOSTATIN
    8e-12  12%  1bknB  [d.122.1 - d.14.1] MUTL
    2e-11  13%  2cg9B  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    3e-11  13%  2cbqB  [x.x.x] NEOCARZINOSTATIN
    4e-11   8%  3c0eA  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    2e-10  11%  1b63A  [d.122.1 - d.14.1] MUTL
    8e-10  12%  1ah8A  [d.122.1] HEAT SHOCK PROTEIN 90
    1e-09   9%  1ea6A  [d.122.1 - d.14.1] PMS1 PROTEIN HOMOLOG 2
    4e-09   9%  1byqA  [d.122.1] PROTEIN (HEAT SHOCK PROTEIN 90)
    1e-08  10%  2brcA  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    2e-08  12%  1ah6A  [x.x.x] HEAT SHOCK PROTEIN 90
    2e-08  10%  3c11A  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    4e-08   9%  1ea6B  [d.122.1 - d.14.1] PMS1 PROTEIN HOMOLOG 2
    9e-08  13%  2cgfA  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    1e-07  10%  2ccsA  [x.x.x] HEAT SHOCK PROTEIN HSP-90 ALPHA
    1e-06  13%  1ah8B  [d.122.1] HEAT SHOCK PROTEIN 90
    5e-06  12%  2breA  [x.x.x] ATP-DEPENDENT MOLECULAR CHAPERONE HSP82
    3e-05   2%  3dpwA  [x.x.x] GREEN FLUORESCENT PROTEIN
:684

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxHNYDASSITILEGLEAVRKRPGMYIGSTGPRGLHHLIWEVVDNSVDEAMAGHATKVEVTLLEXXX
3cwvB           ------------------VENVRKRPGMYCGDVGEYGLHHLVYFLLDVAYEEARRGECRDVVLEVGGDG-
1dc1A           ----------------------------------------------------------------------
1dc1B           ----------------------------------------------------------------------
1ei1A           -----NSSDSSSIKVLKGLDAVRKRPGMYIGDTDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNS
1bgwA           ----------------------------------------------------------------------
2e1qA           ----------------EVDKFNKENCWKKRG----LCIIPTKFGISFTVPFLNQAGALLHVYTDGSVLLT
3cwvA           -----------------IVENVRKRPGMYCGDVGEYGLHHLVYFLLDVAYEEARRGECRDVVLEVGGDGS
3b39B           ----------------------------------------------------------------------
3b39A           ----------------------------------------------------------------------
2ckjB           -------------------KFNKENCWKKRG----LCIIPTKFGISFT----VPFLNQAGALLHVYTDGS
1bjtA           ----------------------------------------------------------------------
2ckjD           -------------------KFNKENCWKKRG----LCIIPTKFGISFT----VPFLNQAGALLHVYTDGS
2e3tA           --------------------FNRENCWKKRG----LCIIPTKFGISFTLPF----LNQGGALVHVYTDGS
2e3tB           -------------------KFNRENCWKKRG----LCIIPTKFGISFT----LPFLNQGGALVHVYTDGS
2ckjC           ----------------EVDKFNKENCWKKRG----LCIIPTKFGISFT----VPFLNQAGALLHVYTDGS
2au3A           ----------------------------------------------------------------------
3b9jK           -------------------KFNKENCWKKRGL----CIIPTKFGISFTVPFLNQAGALIHVYTDGSVLVS
2ckjA           -------------------KFNKENCWKKRG----LCIIPTKFGISFT----VPFLNQAGALLHVYTDGS
2b3qA           ---------------------------------------------------KGEELFTGVVPILVVNGHK
2b3pA           ----------------------------------------------------GEELFTGVVPILVVNGHK
2cg9A           ------EITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYKSLSDPKQLETEPDLFIRITPKPEQKV
1b1eA           ----------------QDNSRYTHFLTQHYDAKPQGRDDRYCESIMRR---RGLTSPCQDINTFIHGNKR
1b1iA           ------------------NSRYTHFLTQHYDAKPQGRDDRYCESIMRR---RGLTSPCKDINTFIHGNKR
1a4yB           ----------------QDNSRYTHFLTQHYDAKPQGRDDR---YCESIMRRRGLTSPCKDINTFIHGNKR
2czvC           ----------------------------------------------------------------------
1b9cA           ------------------------------------------------------ELFTGVVPILVVNGHK
2awjA           ----------------------------------------------------------------------
2czvD           ----------------------------------------------------------------------
1cvrA           ----------------------------------------------------------------------
2awlA           ----------------------------------------------------------------------
3cygA           ----------------------------------------------------------------------
2awkA           ----------------------------------------------------------------------
2c7cO           ----------------------------------------------------------------------
2b6cA           ----------------------------------------------------------------------
1b1jA           ------------------------------------KPQGRDDRYCESIRRRGLTSPCKDINTFIHGNKR
1aj6A           --------------VLKGLDAVRKRPGMYIGDTDDGTLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNS
1bknA           -------------------------------------PASVVKELVENSLDAGATR--IDIDIERGGAKL
3bdjA           -------------------KFNKENCWKKRG----LCIIPTKFGISFT----VPFLNQAGALIHVYTDGS
1dgjA           -------------------------------------------------------PDTSEAWVELNDDGS
3bcyA           ----------------------------------------------------------------------
1b62A           -----------PIQVLPPQLANQIAAGEV-----VERPASVVKELVENSLDAGATRIDIDIERG--GAKL
2cbqC           ----------------------------------------------------------------------
2cbqA           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
2cg9B           ------------------INTVYSNKEIFLRELISNASDALDKIRYKSLSDPKQLETEPDLFIRITEQKV
2cbqB           ----------------------------------------------------------------------
3c0eA           ------------------INTVYSNKEIFLRELISNASDKIRYKSLSDPKQLETEPDLFIRITPKPEQKV
1b63A           -----------PIQVLPPQLANQIAAGEV-----VERPASVVKELVENSLDAGATRIDIDIERG--GAKL
1ah8A           -----------------EFQAEITQLMSLIINTVYSNKEIFLRELISNASDPKQLETEPDLFIRITEQKV
1ea6A           ----------------------------------------------------------------------
1byqA           ------------------INTFYSNKEIFLRELISNSSDALDKIRYETLTDPSKLDSGKELHINLIQDRT
2brcA           ------------------FQAEITQLMSLIINTVYSNKEIFLRELISDPKQLETEPDLFIRITPKPEQKV
1ah6A           -----------------EFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYKSLSDPKQEQKV
3c11A           ------------------INTVYSNKEIFLRELISNASDALDKIRYKSLSDPKQLETEPDLFIRITPKPE
1ea6B           ----------------------------------------------------------------------
2cgfA           -----------------EFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYKSLSDPKQLETE
2ccsA           -----------------AFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYETLTDPSKLDSG
1ah8B           -----------------EFQAEITQLMSLIINTVYSNKEIFLRELISNASDPKQLETEPDLFIRITPKPE
2breA           ------------------INTVYSNKEIFLRELISNASDALDKIRYKSLSDPKQLETEPDLFIRITEQKV
3dpwA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXRGIPVDMHPSGAPTVQVVMTQLHAGGKFDSDSYAVSGGLHGVGISVVNALSTRVEADIKLHGK
3cwvB           ----------SIALFCSSMLVVSLALSSRYQVDIWD--------------------------------GR
1dc1A           ----------------------------------------------------------------------
1dc1B           ----------------------------------------------------------------------
1ei1A           VSVQDDGRGIPTGIHPEGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSQKLELVIQREGK
1bgwA           ----------------------------------------------------------------------
2e1qA           HGGTEMGQGLHTKMVQVKIPTSKIYISETSTNTVPNTSPTAASVSADLNGQAVYAACQTILKRLEPYKKK
3cwvA           IALFCTSRTVTAENLV-------------RVATGAFLGRPPGDGWGWDSMLVVSLALSSRYQVDIWADGR
3b39B           ----------------------------------------------------------------------
3b39A           ----------------------------------------------------------------------
2ckjB           VLLTHGGQGLHTKMVQLKIPTSKIYISETSTNTVPNTSPTAASVSADLNGQAVYAACQTILKRLEPYKKK
1bjtA           ----------------------------------------------------------------------
2ckjD           VLLTHGGQGLHTKMVQLKIPTSKIYISETSTNTVPNTSPTAASVSADLNGQAVYAACQTILKRLEPYKKK
2e3tA           VLLTHGGQGLHTKMVQVKIPTSKIHISETSTNTVPNTSPTAASASADLNGQGVYEACQTILKRLEPFKKK
2e3tB           VLLTHGGQGLHTKMVQVKIPTSKIHISETSTNTVPNTSPTAASASADLNGQGVYEACQTILKRLEPFKKK
2ckjC           VLLTHGGQGLHTKMVQVKIPTSKIYISETSTNTVPNTSPTAASVSADLNGQAVYAACQTILKRLEPYKKK
2au3A           ----------------------------------------------------------------------
3b9jK           HGGTEMGQGLHTKMVQVKIPISKIYISETSTNTVPNSSPTAASVSTDIYGQAVYEACQTILKRLEPFKKK
2ckjA           VLLTHGGQGLHTKMVQVKIPTSKIYISETSTNTVPNTSPTAASVSADLNGQAVYAACQTILKRLEPYKKK
2b3qA           FSVSGEGEGDATYGKL----TLKFICT----TGKLPVPWPTLVTTLVQSRYPDHMKRHDFFKS-AMPEGY
2b3pA           FSVRGEGEGDATN----GKLTLKFICT----TGKLPVPWPTLVTTLVQCFSRYPDHMKRHDFFSAMPEGY
2cg9A           LEIRDSGIGMTKAELINLGTIAK--SGTKAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKSNDD
1b1eA           SIKAICENGNPHRENLISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLDQSIF----
1b1iA           SIKAICENGNPHRENLISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLDQSIF----
1a4yB           SIKAICENGNPHRENLISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLDQSIF----
2czvC           ----------------------------------------------------------------------
1b9cA           FSVSGEGEGDATYGKL----TLKFICTTGKLPVPWPTLVTTFVQCFYPDHMKQHDFFKSA---MPEGYVQ
2awjA           -------EGDATYGKL----TLKFICT----TGKLTYGVQCFSRYPDHMKQAMPEGYVQE-MTISFKDDG
2czvD           ----------------------------------------------------------------------
1cvrA           ----------------------------------------------------------------------
2awlA           -------EGDATYGKL----TLKFICTTGKLPVPWPTLVTTLVQCRYPDHMKQHDFFKSAEKTISFKDDG
3cygA           ----------------------------------------------------------------------
2awkA           -------EGDATYGKL----TLKFICTTGKLPVPWPTLVTTLVQCRYPDHMKQHDFFKSAEMTISFKDDG
2c7cO           ----------------------------------------------------------------------
2b6cA           ----------------------------------------------------------------------
1b1jA           SIKAICENGNPHRENLISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLDQSIF----
1aj6A           VSVQDDGRGIPTGIVS-----------AAEVIMTVLHAGGKFSGGLHGVGVSVVNALSQKLELVIQHEGK
1bknA           IRIRDNGCGIKKDE-----------LALALAIASLDDLEAIISLGFRGEALASISSVSRLTLTSRTAEQQ
3bdjA           VLVSHGGQGLHTKMKALKIPISKIYISETSTNTVPNSSPTAASVSTDIYGQAVYEACQTILKRLEPFKKK
1dgjA           VTLGNSWEDHGQGADAGLGTAHEALRPLGITPENNDTSKTPNSGSQVVTGNAIRVACEMLIEGMRKPGGG
3bcyA           -----------------------------------DGETVKVFEDLQGFETFIANETEDDDFDHLHCKLN
1b62A           IRIRDNGCGIKKDELALA----LARHATSKIASLDDLEAIISLGF-RGEALASISSVSRLTLTSRTAEQQ
2cbqC           -------SGLSDGTVVAGLQAGTAYWVYQRAAVDTGVHASNPAVTADANGSASTSLTVRRSFEGFLFDGT
2cbqA           -------SGLSDGTVVAGLQAGTAYWVYQRAAVDTGVHASNPAVTADANGSASTSLTVRRSFEGFLFDGT
1bknB           ----------------------------------------------------------------------
2cg9B           LEIRDSGIGMTKAELINLGTIAK--SGTKAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKSNDD
2cbqB           -------SGLSDGTVVAGLQAGTAYWVYQRAAVDTSNPADLSSVTADANGSASTSLTVRRSFEGFLFDGT
3c0eA           LEIRDSGIGMTKAELINLGTIAA--AGTKAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKSNDD
1b63A           IRIRDNGCGIKKDELAL----ALARHATSKIASLDDLEAIISLGF-RGEALASISSVSRLTLTSRTAEQQ
1ah8A           LEIRDSGIGMTKAELIN-NLGTIAKSGTKAFMEALSAGADVSMIGQFGVGFYSLFLVAVQVISKSNDDEQ
1ea6A           ----------------------------------------------------------------------
1byqA           LTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDE
2brcA           LEIRDSGIGMTKAELINLGTIAKSGTKAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKSNDDEQ
1ah6A           LEIRDSGIGMTKAELINLGTIAKSGTKAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKSNDDEQ
3c11A           QKVLEIRIGMTKAELINLGTIAAAGTKAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKSNDDEQ
1ea6B           ----------------------------------------------------------------------
2cgfA           PDLFIRITGMTKAELIN-NLGTIAKSGTKAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKSNDD
2ccsA           KELHINLIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDE
1ah8B           QKVLEIRDSMTKAELI-NNLGTIAKSGTKAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKSNDD
2breA           LEIRDSGIGMTKAELINLGTIAK--SGTKAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKSNDD
3dpwA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           HWYQNFEKSVPDELIEGGNARGTGTTIRFWPDAEIXXXXXXXXXXISRRLQEMAFLNKGLTITLTDNRXX
3cwvB           QWRVMGEHGHPQGMEPMPVSAERGVRVHFVPDATIFEVLAFDRARLSRRCNELAALAPGLRVSFADLQ--
1dc1A           ----------------------------------------------------------------------
1dc1B           ----------------------------------------------------------------------
1ei1A           IHRQIYEHGVPQALAVTGETEKTGTMVRFWPSLETFTNVTEFEYELAKRLRELSFLDSGVSIRLRDKR--
1bgwA           ----------------------------------------------------------------------
2e1qA           NPSGSWEDWVTAPNLGYSFETNSGNPFHYFSYGVACSEVEIDCLTGDHKLRTDIVMDVGSSLNPAIDI--
3cwvA           QWRVMGEHGHPQGEGAAPVSAERGVRVHFVPDATIFEVLAFDRARLSRRCNELAALAPGLRVSFADLQ--
3b39B           ----------------------------------------------------------------------
3b39A           ----------------------------------------------------------------------
2ckjB           NPSGSWEDWVTAANLGYSFETNSGNPFHYFSYGVACSEVEIDCLTGDHKLRTDIVMDVGSSLNPAIDI--
1bjtA           ----------------------------------------------------------------------
2ckjD           NPSGSWEDWVTAANLGYSFETNSGNPFHYFSYGVACSEVEIDCLTGDHKNLRTDVMDVGSSLNPAIDI--
2e3tA           KPTGPWEAWVMDPNLGYSFETNSGNPFHYFSYGVACSEVEIDCLTGDHKLRTDIVMDVGSSLNPAI----
2e3tB           KPTGPWEAWVMDPNLGYSFETNSGNPFHYFSYGVACSEVEIDCLTGDKNLRTDIVMDVGSSLNPAI----
2ckjC           NPSGSWEDWVTAPNLGYSFETNSGNPFHYFSYGVACSEVEIDCLTGDHKNLRTDIMDVGSSLNPAIDI--
2au3A           ----------------------------------------------------------------------
3b9jK           NPDGSWEDWVMAPNLGYSFETNSGNAFHYFTYGVACSEVEIDCLTGDHKLRTDIVMDVGSSLNPAI----
2ckjA           NPSGSWEDWVTAPNLGYSFETNSGNPFHYFSYGVACSEVEIDCLTGDHKLRTDIVMDVGSSLN-------
2b3qA           VQERSFKDDGNYKTRATLVNRIELKGIDFKEDGNILGHKLEYNY-NSHNVYITADKQKNGIKANFKIR--
2b3pA           VQERTFKDDGTYKTRATLVNRIELKGIDFKEDGNI-LGHKLEYNFNSHNVYITADKQKNGIKANFK----
2cg9A           EQYIWESNAGGSFTVTLDEVNGRGTILRLFLKDDQLEYLEEKRIKEVIK-RHSEFVAYPIQLVVTK----
1b1eA           ----------------------------------------------------------------------
1b1iA           ----------------------------------------------------------------------
1a4yB           ----------------------------------------------------------------------
2czvC           ----------------------------------------------------------------------
1b9cA           ERTISFKDDGNYKTRAEVKFEGELKGIDFKEDGNI-LGHKLEYNYNSHNVYITADKQKNGIKANFKIR--
2awjA           NYKTRAEVKFEGD---TLVNRIELKGIDFKEDGNILGHKLEYNY-NSHNVYITADKQKNGIKANFKIRHN
2czvD           ----------------------------------------------------------------------
1cvrA           ----------------------------------------------------------------------
2awlA           NYKTRAEVKFE---GDTLVNRIELKGIDFKED-GNILGHKLEYNYNSHNVYITADKQKNGIKANFKIR--
3cygA           ---------------------------------------------IVKSSTENEIVRIHVELPRLKYLK-
2awkA           NYKTRAEVKFEG---DTLVNRIELKGIDFKED-GNILGHKLEYNYNSHNVYITADKQKNGIKANFKIR--
2c7cO           ----------------------------------------------------------------------
2b6cA           -------------------------------------------------LQFQKNPETAAKSAYKHQF--
1b1jA           ----------------------------------------------------------------------
1aj6A           IHRQIYEHGVPQAPLVTGETEKTGTMVRFWSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKR--
1bknA           EAWQAYAV------------TVKPAAHPVGTTLEVLDTEKTEFNHIDEIIRRIALARFDVTINLSH----
3bdjA           NPDGSWEDWVMAPNLGYSFETNSGNAFHYFTYGVACSEVEIDCLTGDHKNLRTIVMDVGSSL--------
1dgjA           FFTPAEMKAEGRPYDGKWTAPAKDCDAKGQGSPFACYMYGLFLTEVAVEVATGKATVEKMVCVADI----
3bcyA           YYPPFVLHESHEDPEKISDAANSHSKKFVRHLHQHIEKHLLKDIKQAVRKPELKFHEKSKEETFDKIT--
1b62A           EAWQAYAEGRDMNVTVKPAAHPVGTTYNTPARRKFLRTEKTEFNHIDEIIRRIALARFDVTINLSHNGKI
2cbqC           RWGTVDCTTAAVGLSDAAGNGPEGVAISF-----------------------------------------
2cbqA           RWGTVDCTTAACGLSDAAGNGPEGVAISF-----------------------------------------
1bknB           ----------------------------------------------------------------------
2cg9B           EQYIWESNAGGSTLDEVNERIGRGTILRLFLKDDQYLEEKRIKEVIKRHSEFVAYLNKTKPLWTRNPS--
2cbqB           RWGTVDCTTAAVGLSDAAGNGPEGVAISF-----------------------------------------
3c0eA           EQYIWESNAGGSTVTLDEVNERIGRGTILRLFLKDDQLEYLEEKRIKEVIKRHSFVAYPIQLVVTKEV--
1b63A           EAWQAYAEVKPAAHPVGTTLEVLDLFYNTPARRKFLRTEKTEFNHIDEIIRRIALARFDVTINLSH----
1ah8A           YIWESNAGGSFTTLDEVNERIGRGTILRLFLKDDQEYLEEKRIKEVIKRHSE--FVAYPIQLVVTKEV--
1ea6A           ----------------------------------------------------------------------
1byqA           QYAWESSGGSFTVRTDTGEPMGRGTKVILHLKEDEYLEERRIKEIVKKHSQFIGY-----PITLFV----
2brcA           YIWESNAGGSFTVLDEVNERIGRGTILRLFLKDDQLEYLEEKRIKE-VIKRHSEFVAYPIQLVVTKEV--
1ah6A           YIWESNAGGSFTVLDEVNERIGRGTILRLFLKDDQLEYLEEKRIKEIKRHSE--FVAYPIQLVVTKEV--
3c11A           YIWESNAGGSFTVLDEVNERIGRGTILRLFLKDDQLEYLEEKRIKEIKRHSE--FVAYPIQLVVTKEV--
1ea6B           ----------------------------------------------------------------------
2cgfA           EQYIWESNAGGSFLDEVNERIGRGTILRLFLKDDQLEYLEEKRIKVIKKHSE--FVAYPIQLVVTK----
2ccsA           QYAWESSAGGSFTRTDTGEPMGRGTKVILHLKEDQEYLEERRIKEIVKKHSQ--FIGYPITL--------
1ah8B           EQYIWESNAGTVTLDEVNERIGRGTILRLFLKDDQEYLEEKRIKEVIKRHSE--FVAYPIQLVVTKEV--
2breA           EQYIWESNAGGSTLDEVNERIGRGTILRLFLKDDQEYLEEKRIKEVIKRHSE--FVAYPIQLVVTK----
3dpwA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXXXXXXXXXSLDEIDNETELVEETTDAXXXXXXXXXXXIFHYPNGLEDYVQYLNRSKTNI
3cwvB           ------------------------RGERT-------------------LWHLPGGVAQWAHVLTEARPQL
1dc1A           ----------------------------------------------------------------------
1dc1B           ----------------------------------------------------------------------
1ei1A           ----------------------------DGKEDH---------------FHYEGGIKAFVEYLNKNKTPI
1bgwA           ----------------------------------------------------------------------
2e1qA           -------------------------------------------------GQVEGAFVQGLGLFTLEELHY
3cwvA           ------------------------RGERT-------------------LWHLPGGVAQWAHVLTEARPQL
3b39B           ----------------------------------------------------------------------
3b39A           ----------------------------------------------------------------------
2ckjB           -------------------------------------------------GQVEGAFVQGLGLFTLEELHY
1bjtA           ----------------------------------------------------------------------
2ckjD           -------------------------------------------------GQVEGAFVQGLGLFTLEELHY
2e3tA           -----------------------------------------------DIGQVEGAFVQGLGLFTMEELHY
2e3tB           -----------------------------------------------DIGQVEGAFVQGLGLFTMEELHY
2ckjC           -------------------------------------------------GQVEGAFVQGLGLFTLEELHY
2au3A           ----------------------------------------------------------------------
3b9jK           -----------------------------------------------DIGQVEGAFVQGLGLFTLEELHY
2ckjA           ---------------------PAID-----------------------IGQVEGAFVQGLGLFTLEELHY
2b3qA           ----------------------------HNIEDG---------------SVQLADHYQQNTPIGDGPV-L
2b3pA           --------------------------IRHNVEDG---------------SVQLADHYQQNTPIGDGPVLL
2cg9A           ----------------------EVEKEEEVQE---------------------------IEELNKTKPLW
1b1eA           ----------------------------------------------------------------------
1b1iA           ----------------------------------------------------------------------
1a4yB           ----------------------------------------------------------------------
2czvC           ----------------------------------------------------------------------
1b9cA           ----------------------------HNIEDG---------------SVQLADHY-QQNTPIGDGPVL
2awjA           ------------------------IEDGSVQLADH-------------YQQNTPIGDGPVLLPDNHY---
2czvD           ----------------------------------------------------------------------
1cvrA           ----------------------------------------------------------------------
2awlA           --------------------HNIEDG-----------------------SVQLADHYQQNTPIGDGPVLL
3cygA           ---------------------DSNFEEKFN-------------------SEVEEKIKKFVNEVKGIAQED
2awkA           --------------------HNIEDG-----------------------SVQLADHYQQNTPIGDGPVLL
2c7cO           ----------------------------------------------------------------------
2b6cA           -------------------VFAGIPAP----------------------ERQALSKQLLKESHTWPKEKL
1b1jA           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1bknA           ------------------------NGKIVR-----------------QYRAVPEGGQKERRLGAICGTAF
3bdjA           ----------------------------------------------------------------------
1dgjA           ---------------------GKICNKLV------------------VDGQIYGGLAQGVGLALSEDYED
3bcyA           ----------------------------------------------------------------------
1b62A           VRQ---------------------------------------------YRAVPEGGQKERRLGAICGTAF
2cbqC           ----------------------------------------------------------------------
2cbqA           ----------------------------------------------------------------------
1bknB           ------------------------------------------------YRAVPEGGQKERRLGAICGTAF
2cg9B           ----------------------------------------------------------------------
2cbqB           ----------------------------------------------------------------------
3c0eA           ----------------------------------------------------------------------
1b63A           ---------------------NGKIVRQYRAVPEGGQKER--------RLGAICGTAFLEQA--------
1ah8A           ----------------------------------------------------------------------
1ea6A           ------------------------------------------------CTGGSPSIKENIGSVFGQKQLQ
1byqA           ----------------------------------------------------------------------
2brcA           ----------------------------------------------------------------------
1ah6A           ----------------------------------------------------------------------
3c11A           ----------------------------------------------------------------------
1ea6B           -------------------------------------------------TGGSPSIKENIGSVFGQKQLQ
2cgfA           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
1ah8B           ----------------------------------------------------------------------
2breA           ----------------------------------------------------------------------
3dpwA           -------------------------------------------------SVQL-ADHYQQNTPIGDGPVL


                         .         *         .         .         .         .         +:350
query           HPSIVSFEAKGDDHEVEVAMQWNSSYKESVHTFANTINTREGGTHEEGFRSALTSLMNRYAREHKLLKEK
3cwvB           HPEPVVFDFTWDGLRVQCALQWCEDEDSTLLSFANAVRTVRHGAHVKGVTQALRGALAKLSGETR-----
1dc1A           -----------------------------------------------------------FEN--HLKSVD
1dc1B           -----------------------------------------------------------FEN--HLKSVD
1ei1A           HPNIFYFSTEKDGIGVEVALQWNDGFQENIYCFTNNIPQRDGGTHLAGFRAAMTRTLNAYMDKEGYSKKA
1bgwA           ----------------------------------------------------------------------
2e1qA           SPEGSLHTRGPSTYKIPAFGSIPIEFRVSLLRAVGEPPLFLAASIFFAIKDAIRAARAQHTNNVKELFRL
3cwvA           HPEPVVFDFTWDGLRVQCALQWCEDEDSTLLSFANAVRTVRHGAHVKGVTQALRGALAKLSGETRG----
3b39B           ----------------------------------------------------------------------
3b39A           ----------------------------------------------------------------------
2ckjB           SPEGSLHPAFGSIPIEFRVSLLRDCPNKKASKAVGEPPLFLAASIFFAIKDAIRAARAQHTNNVKELFRL
1bjtA           ----------------------------------------------------------------------
2ckjD           SPEGSLHTRGGSIPIEFRVSLLRDCPNKKASKAVGEPPLFLAASIFFAIKDAIRAARAQHGNNVKELFRL
2e3tA           SPEGSLHTRGPSTYKISIPIEFRVSLLRDCPNKRAIYASKLASSIFFAIKDAIRAARAQHGDNAKQLFQL
2e3tB           SPEGSLHTRGPSTYKIPAFGSIPIEFRVSLLRDCPNKRAASKAVGEFAIKDAIRAARAQHGDNAKQLFQL
2ckjC           SPEGSLHTRGPSTYIEFRVSLLRDCPNKKAIYASGEPPLFLAASIFFAIKDAIRAARAQHTNNVKELFRL
2au3A           ---------------------FGCGVGGDAIKFVSLY-------EDISYFEAALELAKRYGKKLDLEKSK
3b9jK           SPEGSLHTRGPSTYKIPAFGSIPTEFRVSLLRDCPNKKAASKAVGEPPLFSVFFAIKDRAQHTTKELFRL
2ckjA           SPEGSLHPAFGSIPIEFRVSLLRDCPNKKASKAVGEPPLFLAASIFFAIKDAIRAARAQHGNNVKELFRL
2b3qA           LPDNHYLS-----TQSALSKDPNEKRDHMVLLEF---VTAAGITH-------------------------
2b3pA           PDNHYLS------TQSVLSKDPNEKRDHMVL---LEFVTAAGITH-------------------------
2cg9A           TRN------PSDITQEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFRAILFIPKRAPIKLYVRRVFITDE
1b1eA           ----------------------------------------------------------------------
1b1iA           ----------------------------------------------------------------------
1a4yB           ----------------------------------------------------------------------
2czvC           ----------------------------------------------------------------------
1b9cA           LPDNHY-----LSTQSALSKDPNEKRDHMVLLEFV-----------------------------------
2awjA           LSTQSALSKDPNEKRDHMVLEFVTAA--------------------------------------------
2czvD           ----------------------------------------------------------------------
1cvrA           ----------------------------------------------------------------------
2awlA           PDNHYLSTQS----ALSKDPNEKRDHMVLLFVTAAGI---------------------------------
3cygA           HD----KDVQHTPYEAYVSVDVRY-EGKDFLSFVVYYYQFTGGAHGITFFETYNIDLKNSKVLKL-----
2awkA           PDNHYLSTQS----ALSKDPNEKRDHMVLLFVTAAGI---------------------------------
2c7cO           ----------------------------------------------------------------------
2b6cA           CQEIEAYYQKTEREYDLALQNVQRFSLEEVVAFKAYVPQKAWWDSVDAWRKFFGSWVALHLTELPTIFAL
1b1jA           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1bknA           LEQALAIEWQHGDLTLADPNHTTPALAEIQYCYVNGRMMRDRLINH-AIRQACEDKLGADQQPAFVLY--
3bdjA           ----------------------------------------------------------------------
1dgjA           LKKHSTMGGAGIPSIKMIPDDIEIVYVETPRKDG---PFGASGVGEMPLTAPHAAIINGIYNACG-ARVR
3bcyA           ----------------------------------------------------------------------
1b62A           LEQALAIEWQHGDLTLRGPNHTTPALAEIQYCYVNGRMMRDRLINH-AIRQACEDKLGADQQPAFVLYL-
2cbqC           ----------------------------------------------------------------------
2cbqA           ----------------------------------------------------------------------
1bknB           LEQALAIEWQHGDLTLRGWVHTTPALAEIQYCYVNGRMMRDRLIN-HAIRQACEDKLGADQQPAFVLSRL
2cg9B           ----------------------------------------------------------------------
2cbqB           ----------------------------------------------------------------------
3c0eA           ----------------------------------------------------------------------
1b63A           LAIEWQHGDLTLRGWVADPNHTTPALAEIQYCYVNGRMMRDRLINH-----AIRQACEDKLGADQQPAF-
1ah8A           ----------------------------------------------------------------------
1ea6A           SLIPFVQLPPSDSVCEEYGLSCSDAL-HNLFYISGFISQCTHGVGRSSTDRQFFFINRRPCDPAKVCRLV
1byqA           ----------------------------------------------------------------------
2brcA           ----------------------------------------------------------------------
1ah6A           ----------------------------------------------------------------------
3c11A           ----------------------------------------------------------------------
1ea6B           SLIPFVQLPPSDSVCEEYGLSCSDAL-HNLFYISGFISQCTHGVGRSSTDRQFFFINRRPCDPAKVCRLV
2cgfA           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
1ah8B           ----------------------------------------------------------------------
2breA           ----------------------------------------------------------------------
3dpwA           LPDNHYLSYQSA---LSKDPNEKRDHMVLL----------------------------------------


                         .         .         .         .         *         .         .:420
query           EANLTGDDCREGLSAVISVRVGDPQFEGQTKTKLGNTEIKSFVQRMANEHIGHWLEANPAEAKVIINKAV
3cwvB           -GAFPWARVAQGLTAIVAVSGPRRQFAGPTKELLAIPGLEEAIRKQLQPLFIELLREHPVTPALLARR--
1dc1A           DLKTTYEEYRAGFIAFALEKNSTPYIERARALKVAASVAKTPKDLLYLEDIQDALLYASGISDKAKKFLT
1dc1B           DLKTTYEEYRAGFIAFALEKNSTPYIERARALKVAASVAKTPKDLLYLEDIQDALLYASGISDKAKKFL-
1ei1A           KVSATGDDAREGLIAVVSVKVPDPKFSSQTKDKLVSSEVKSAVEQQMNELLAEYLLENPTDAKIVVGKII
1bgwA           ----------------------------------------------------------------------
2e1qA           DSPATPEKIRNACVDKFTTLCVTGVPENCKPWSVR-----------------------------------
3cwvA           --AFPWARVAQGLTAIVAVSGPRRQFAGPTKELLAIPGLEEAIRKQLQPLFIELLREHPVTPALLARR--
3b39B           -------HQRQTLYQLM--DGLNTFYQQSLQQPVATSARQYLEKRPGWDNVLKRFGGNPENRQSLIDAGM
3b39A           -----------------------TFYQQSLQQPVATSARQYLEKRPGWDNVLKRFGGNPENRQSLIDAGM
2ckjB           DSPATPEKIRNACVDKFTTLCVCKPWSVR-----------------------------------------
1bjtA           ----------------------------------------------------------------------
2ckjD           DSPATPEKIRNACVDKFTTLC-------------------------------------------------
2e3tA           DSPATPEKIRNACVDQFTTLC-------------------------------------------------
2e3tB           DSPATPEKIRNACVDQFTTLC-------------------------------------------------
2ckjC           DSPATPEKIRNACVDKFTTLC-------------------------------------------------
2au3A           DEKVYVALDRVCDFYRESLLKNREASEYVKSRGIDPKVARKFDLGYAKVLKENDLLEAYLETKNLLSPTK
3b9jK           DSPATPEKIRNACVDKFTTLC--VT---------------------------------------------
2ckjA           DSPATPEKIRNACVDKFTTLC--VTW--------------------------------------------
2b3qA           ----------------------------------------------------------------------
2b3pA           ----------------------------------------------------------------------
2cg9A           AEDLIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIVKKLIEAFNEIAEDSEQFEKFYSAFSK
1b1eA           ----------------------------------------------------------------------
1b1iA           ----------------------------------------------------------------------
1a4yB           ----------------------------------------------------------------------
2czvC           ----------------------------------------------------------------------
1b9cA           ----------------------------------------------------------------------
2awjA           ----------------------------------------------------------------------
2czvD           ----------------------------------------------------------------------
1cvrA           ----------------------------------------------------------------------
2awlA           ----------------------------------------------------------------------
3cygA           -----YDIIKEEAEDTIKSNI-LKQIEQNNTDFFPDAPNILKDDIISKDGLIIYPHYPYASGPEF-----
2awkA           ----------------------------------------------------------------------
2c7cO           ----------------------------------------------------------------------
2b6cA           --FYGAENFWNRRVALNLQLLKEKTNQDLLAIIYDRTTEEFFIQKAIGWSLRQYSKTNPQWVEELKELVL
1b1jA           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1bknA           ---------LEIDPHQVSRLVHDFIYQGVLS---------------------------------------
3bdjA           ----------------------------------------------------------------------
1dgjA           HLPARPEKVLEAM---------------------------------------------------------
3bcyA           ----------------------------------------------------------------------
1b62A           ----------EIDPHQVDVNVHKHEVRFHQS-----RLVHDFIYQGVLSV--------------------
2cbqC           ----------------------------------------------------------------------
2cbqA           ----------------------------------------------------------------------
1bknB           VHDFIYQGVLSVL---------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
2cbqB           ----------------------------------------------------------------------
3c0eA           ----------------------------------------------------------------------
1b63A           ---------------VLYLEIDPHQVDHPAKHEVRFHQSRLVHDFI-YQGVLSVLQ--------------
1ah8A           ----------------------------------------------------------------------
1ea6A           NEVYHMYNRHQYPFVVLNISV-DSE---------------------------------------------
1byqA           ----------------------------------------------------------------------
2brcA           ----------------------------------------------------------------------
1ah6A           ----------------------------------------------------------------------
3c11A           ----------------------------------------------------------------------
1ea6B           NEVYHMYNRHQYPFVVLNISV-DSE---------------------------------------------
2cgfA           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
1ah8B           ----------------------------------------------------------------------
2breA           ----------------------------------------------------------------------
3dpwA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GSAQARLAARKARDLVRRKSATDLGGLPGKLADCRSKDPEKSELYIVEGDSAGGSAKSGRDSMFQAILPL
3cwvB           ----------------------------------------------------------------------
1dc1A           ----------EDDKKESINNLIEN---FLEPAGEEFIDELIFRYLLFQGDSLGGTMRNAQQKLTRAIISA
1dc1B           ---------TEDDKKESINNLIEN---FLEPAGEEFIDELIFRYLLFQGDSLGGTMRNAQQKLTRAIISA
1ei1A           DAARAREAARRAREM-------------------------------------------------------
1bgwA           -----------------RKSRITN---YPKLEDAGTKEGYKCTLVLTEGDSAAGLAVVGRD--YYGCYPL
2e1qA           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
3b39B           ---LVTNDQGRSYDRFRERVMFPIRDKRGRVIGFGGNDTPKYLNSPETDIFHKGRQLYGLYEAQQDNAE-
3b39A           LVTNDRSYDRF-----RERVMFPIRDKRGRVIGFGGRVGNDTPKYLNSPETHKGRQLYGLYEAQQDNAE-
2ckjB           ----------------------------------------------------------------------
1bjtA           -----------------RKSRITN---YPKLEDAGTKEGYKCTLVLTEGDSAAGLAVVGRD--YYGCYPL
2ckjD           ----------------------------------------------------------------------
2e3tA           ----------------------------------------------------------------------
2e3tB           ----------------------------------------------------------------------
2ckjC           ----------------------------------------------------------------------
2au3A           GVYRDLFLRRVVIPIKDPRGRVI--GFGGRRIV--EDKSPKYINSPDSRVFKKGENLFGLYEAKEYIKE-
3b9jK           ----------------------------------------------------------------------
2ckjA           ----------------------------------------------------------------------
2b3qA           ----------------------------------------------------------------------
2b3pA           ----------------------------------------------------------------------
2cg9A           NIKLGVHEDTQNRAALARYNSTKSVDELTSLTDYVTRMPEHKNIYYITGES-------------------
1b1eA           ----------------------------------------------------------------------
1b1iA           ----------------------------------------------------------------------
1a4yB           ----------------------------------------------------------------------
2czvC           ----------------------------------------------------------------------
1b9cA           ----------------------------------------------------------------------
2awjA           ----------------------------------------------------------------------
2czvD           ----------------------------------------------------------------------
1cvrA           ---------------------------------------ENGRMIVIVAKKYEGDIKDFVD-------WK
2awlA           ----------------------------------------------------------------------
3cygA           ----------------------------------------------------------------------
2awkA           ----------------------------------------------------------------------
2c7cO           -------------------------------------DRVIVKRKEVETKSAGGIVLTGS----AAAKST
2b6cA           SPLAQREGSKYLA---------------------------------------------------------
1b1jA           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
3bdjA           ----------------------------------------------------------------------
1dgjA           ----------------------------------------------------------------------
3bcyA           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
2cbqC           ----------------------------------------------------------------------
2cbqA           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
2cbqB           ----------------------------------------------------------------------
3c0eA           ----------------------------------------------------------------------
1b63A           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
1ea6A           ----------------------------------------------------------------------
1byqA           ----------------------------------------------------------------------
2brcA           ----------------------------------------------------------------------
1ah6A           ----------------------------------------------------------------------
3c11A           ----------------------------------------------------------------------
1ea6B           ----------------------------------------------------------------------
2cgfA           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
1ah8B           ----------------------------------------------------------------------
2breA           ----------------------------------------------------------------------
3dpwA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           RGKILNVEKARLDKVLKNAEVQAIITALGTGIHDEFDINKLRYHKIVLMADADVDGQHIATLLLTLLFRF
3cwvB           ----------------------------------------------------------------------
1dc1A           LYKWLDSRDKKYTNWMDKPEDDYELETFAKGISWTIKHRTLMYNITVSLVKKNVDICLFNCEPQQPEKYL
1dc1B           LYKWLDSRDKKYTNWMDKPEDDYELETFAKGISWTIKHRTLMYNITVSLVKKNVDICLFNCEPQQPEKYL
1ei1A           ----------------------------------------------------------------------
1bgwA           RGKMLNVREASADQILKNAEIQAIKKIMGLQHRKYEDTKSLRYGHLMIMTDQDHDGSHIKGLIINFLESS
2e1qA           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
3b39B           PNRLLVVEGYMDVVALAQYGINYAVASLGTSTADHIQLLFRATNNVICCYDGDRAGRDAAW---CALETA
3b39A           PNRLLVVEGYMDVVALAQYGINYAVASLGTSTADHIQLLFRATNNVICCYDGDRAGRDAAW---CALETA
2ckjB           ----------------------------------------------------------------------
1bjtA           RGKMLNVRE-----ALKNAEIQAIKKIMGLQHRKYEDTKSLRYGHLMIMTDSHIKG-----LIINFLESS
2ckjD           ----------------------------------------------------------------------
2e3tA           ----------------------------------------------------------------------
2e3tB           ----------------------------------------------------------------------
2ckjC           ----------------------------------------------------------------------
2au3A           EGFAILVEGYFDLLRLFSEGIRNVVAPLGTALQNQANLLSKFTKKVYILYDGDDAGRKAMKSAIPLL---
3b9jK           ----------------------------------------------------------------------
2ckjA           ----------------------------------------------------------------------
2b3qA           ----------------------------------------------------------------------
2b3pA           ----------------------------------------------------------------------
2cg9A           ---LKAVEKSPFLDALKAKNFEVL---FLTDPIDEYAFTQLKEFEGKTLVDITKDFE-------------
1b1eA           ----------------------------------------------------------------------
1b1iA           ----------------------------------------------------------------------
1a4yB           ----------------------------------------------------------------------
2czvC           ---------------------------------PPTLRDKNRYIAFEIISDGDFTKDEV----KELIWKS
1b9cA           ----------------------------------------------------------------------
2awjA           ----------------------------------------------------------------------
2czvD           ----------------------------------PTLRDKNRYIAFEIISDGDFTKDEV----KELIWKS
1cvrA           NQRGLRTEVKVAEDIASPVTANAIQQFVKQ----EYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVGQ
2awlA           ----------------------------------------------------------------------
3cygA           ----------------------------------------------------------------------
2awkA           ----------------------------------------------------------------------
2c7cO           RGEVLAVGNGRILE---NGEVKPLDVKVGDIVGYGVKSEKIDNEEVLIMSESDI----------------
2b6cA           ----------------------------------------------------------------------
1b1jA           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
3bdjA           ----------------------------------------------------------------------
1dgjA           ----------------------------------------------------------------------
3bcyA           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
2cbqC           ----------------------------------------------------------------------
2cbqA           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
2cbqB           ----------------------------------------------------------------------
3c0eA           ----------------------------------------------------------------------
1b63A           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
1ea6A           ----------------------------------------------------------------------
1byqA           ----------------------------------------------------------------------
2brcA           ----------------------------------------------------------------------
1ah6A           ----------------------------------------------------------------------
3c11A           ----------------------------------------------------------------------
1ea6B           ----------------------------------------------------------------------
2cgfA           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
1ah8B           ----------------------------------------------------------------------
2breA           ----------------------------------------------------------------------
3dpwA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           MPDLVAEGHVYLAQPPLYKLKWQRGEPGFAYSDEERDEQLNEGLAAGRKINKDDGIQRYKGLGEMNASEL
3cwvB           ----------------------------------------------------------------------
1dc1A           LLGELKGGIDPAGADEHWKTANTALT---RIRNKFSEKGLS-------PKTIFIGAAIEHSMAEEIWDQL
1dc1B           LLGELKGGIDPAGADEHWKTANTALT---RIRNKFSEKGL-------SPKTIFIGAAIEHSMAEEIWDQL
1ei1A           ----------------------------------------------------------------------
1bgwA           FLGLLIQGFLLEFITPIIKVSITKPT-KNTIAFYNMPDYEKW--REEESHKFTWKQKYYKGLGTSLAQEV
2e1qA           ----------------------------------------------------------------------
3cwvA           ----------------------------------------------------------------------
3b39B           LPYMTDGRQLRFMFLPDGEDP---DTLVRKEGKEAFEARMEQ-----AMPLSAFLFNSLMPQVDLSTPDG
3b39A           LPYMTDGRQLRFMFLPDGELVRKEGKEAFARMEQAMPLSAFLFNSLMPQVDLSTPDGRARLSTLAL--PL
2ckjB           ----------------------------------------------------------------------
1bjtA           FLGLLIQGFLLEFITPIIKVSI-TKPTKNTIAFYNMPDYEKW--REEESHKFTWKQKYYKGLGTSLAQEV
2ckjD           ----------------------------------------------------------------------
2e3tA           ----------------------------------------------------------------------
2e3tB           ----------------------------------------------------------------------
2ckjC           ----------------------------------------------------------------------
2au3A           ---LSAGVEVYPVYLPEGYDP---DEFIKEFGKEELRRLINS-----SGELFETLIKTARENLEEKTREF
3b9jK           ----------------------------------------------------------------------
2ckjA           ----------------------------------------------------------------------
2b3qA           ----------------------------------------------------------------------
2b3pA           ----------------------------------------------------------------------
2cg9A           ----------------------------------------------------------------------
1b1eA           ----------------------------------------------------------------------
1b1iA           ----------------------------------------------------------------------
1a4yB           ----------------------------------------------------------------------
2czvC           SLEVLGETGTAIVKPWLIKFDPNTKT-GIVRSDREYVEYLRFALMLVSEFNGKRLIIRTLGVS-------
1b9cA           ----------------------------------------------------------------------
2awjA           ----------------------------------------------------------------------
2czvD           SLEVLGETGTAIVKPWLIKFDPNTKT-GIVRSDREYVEYLRFALMLVSEFNGKRLIIRTLGVS-------
1cvrA           IVGNDHYNEVFIGRFSCESKEDLKTQI-DRTIHYERN-------------ITTEDKWLGQALCIASAEGG
2awlA           ----------------------------------------------------------------------
3cygA           ----------------------------------------------------------------------
2awkA           ----------------------------------------------------------------------
2c7cO           ----------------------------------------------------------------------
2b6cA           ----------------------------------------------------------------------
1b1jA           ----------------------------------------------------------------------
1aj6A           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
3bdjA           ----------------------------------------------------------------------
1dgjA           ----------------------------------------------------------------------
3bcyA           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
2cbqC           ----------------------------------------------------------------------
2cbqA           ----------------------------------------------------------------------
1bknB           ----------------------------------------------------------------------
2cg9B           ----------------------------------------------------------------------
2cbqB           ----------------------------------------------------------------------
3c0eA           ----------------------------------------------------------------------
1b63A           ----------------------------------------------------------------------
1ah8A           ----------------------------------------------------------------------
1ea6A           ----------------------------------------------------------------------
1byqA           ----------------------------------------------------------------------
2brcA           ----------------------------------------------------------------------
1ah6A           ----------------------------------------------------------------------
3c11A           ----------------------------------------------------------------------
1ea6B           ----------------------------------------------------------------------
2cgfA           ----------------------------------------------------------------------
2ccsA           ----------------------------------------------------------------------
1ah8B           ----------------------------------------------------------------------
2breA           ----------------------------------------------------------------------
3dpwA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           WETTMDPTVRILRRVDITDAQRADELFSILMGDDVVARRSFITRNAKDVRFLDI
3cwvB           ------------------------------------------------------
1dc1A           QSGSLTNSANLTKTEQVGSLCR--------------------------------
1dc1B           QSGSLTNSANLTKTEQVGSLCR--------------------------------
1ei1A           ------------------------------------------------------
1bgwA           REYFSNLDRHLKIFHLFSLADNIRSIPNVLDGFKPGQRKVLYGCFKKNL-----
2e1qA           ------------------------------------------------------
3cwvA           ------------------------------------------------------
3b39B           RARLSTLALPLISQ--VPGETLRIYLRQEL------------------------
3b39A           ISQVPGETLRIYLRQELGNKLGILDDSQL-------------------------
2ckjB           ------------------------------------------------------
1bjtA           REYFSNLDRHLKIFHSLQWLRQYEPFILFSLADNIRSIPNVLDGFKPGQRKVLY
2ckjD           ------------------------------------------------------
2e3tA           ------------------------------------------------------
2e3tB           ------------------------------------------------------
2ckjC           ------------------------------------------------------
2au3A           RGFISDGVRRFATKYKVPMEILLMKI----------------------------
3b9jK           ------------------------------------------------------
2ckjA           ------------------------------------------------------
2b3qA           ------------------------------------------------------
2b3pA           ------------------------------------------------------
2cg9A           ------------------------------------------------------
1b1eA           ------------------------------------------------------
1b1iA           ------------------------------------------------------
1a4yB           ------------------------------------------------------
2czvC           --GTIKRLKRKFLAK---------------------------------------
1b9cA           ------------------------------------------------------
2awjA           ------------------------------------------------------
2czvD           --GTIKRLKRKFLAK---------------------------------------
1cvrA           P--SADNGESDIQHENVIANLLTQYGYTKIIKCYDPGVTPKNIID---------
2awlA           ------------------------------------------------------
3cygA           ------------------------------------------------------
2awkA           ------------------------------------------------------
2c7cO           ------------------------------------------------------
2b6cA           ------------------------------------------------------
1b1jA           ------------------------------------------------------
1aj6A           ------------------------------------------------------
1bknA           ------------------------------------------------------
3bdjA           ------------------------------------------------------
1dgjA           ------------------------------------------------------
3bcyA           ------------------------------------------------------
1b62A           ------------------------------------------------------
2cbqC           ------------------------------------------------------
2cbqA           ------------------------------------------------------
1bknB           ------------------------------------------------------
2cg9B           ------------------------------------------------------
2cbqB           ------------------------------------------------------
3c0eA           ------------------------------------------------------
1b63A           ------------------------------------------------------
1ah8A           ------------------------------------------------------
1ea6A           ------------------------------------------------------
1byqA           ------------------------------------------------------
2brcA           ------------------------------------------------------
1ah6A           ------------------------------------------------------
3c11A           ------------------------------------------------------
1ea6B           ------------------------------------------------------
2cgfA           ------------------------------------------------------
2ccsA           ------------------------------------------------------
1ah8B           ------------------------------------------------------
2breA           ------------------------------------------------------
3dpwA           ------------------------------------------------------