[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF53009.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1c5fK.bssp"
#ERROR : Can't open dsspfile "1c5fG.bssp"
#ERROR : Can't open dsspfile "3bo7A.bssp"
#ERROR : Can't open dsspfile "1a33A.bssp"
#ERROR : Can't open dsspfile "1c5fI.bssp"
#ERROR : Can't open dsspfile "3bo7B.bssp"
#ERROR : Can't open dsspfile "3bt8A.bssp"
#ERROR : Can't open dsspfile "2cfeA.bssp"
#ERROR : Can't open dsspfile "1a58A.bssp"
#ERROR : Can't open dsspfile "2b71A.bssp"
#ERROR : Can't open dsspfile "2ck1A.bssp"
#ERROR : Can't open dsspfile "3bo7C.bssp"
#ERROR : Can't open dsspfile "1cynA.bssp"
#ERROR : Can't open dsspfile "3bo7D.bssp"
#ERROR : Can't open dsspfile "1clhA.bssp"
#ERROR : Can't open dsspfile "1dywA.bssp"
#ERROR : Can't open dsspfile "1bckA.bssp"
#ERROR : Can't open dsspfile "2alfA.bssp"
#ERROR : Can't open dsspfile "3bkpA.bssp"
#ERROR : Can't open dsspfile "1awqA.bssp"
#ERROR : Can't open dsspfile "2a2nA.bssp"
#ERROR : Can't open dsspfile "2c3bA.bssp"
#ERROR : Can't open dsspfile "2a2nC.bssp"
#ERROR : Can't open dsspfile "2c3bB.bssp"
#ERROR : Can't open dsspfile "1awsA.bssp"

## Summary of PDB Search
:190
    1e-36  38%  1c5fK  [b.62.1] PROTEIN (PEPTIDYLPROLYL ISOMERASE CYP-1)
    7e-36  38%  1c5fG  [b.62.1] PROTEIN (PEPTIDYLPROLYL ISOMERASE CYP-1)
    6e-35  32%  3bo7A  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE, CYCLOPHILIN-
    8e-35  38%  1a33A  [b.62.1 (1c5fE)] PEPTIDYLPROLYL ISOMERASE
    4e-34  38%  1c5fI  [b.62.1] PROTEIN (PEPTIDYLPROLYL ISOMERASE CYP-1)
    1e-33  32%  3bo7B  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE, CYCLOPHILIN-
    3e-33  42%  3bt8A  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE
    3e-33  37%  2cfeA  [x.x.x] ALLERGEN
    2e-32  38%  1a58A  [b.62.1 (1c5fA)] CYCLOPHILIN
    3e-32  35%  2b71A  [x.x.x] CYCLOPHILIN-LIKE PROTEIN
    3e-32  31%  2ck1A  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE E
    6e-32  30%  3bo7C  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE, CYCLOPHILIN-
    5e-31  38%  1cynA  [b.62.1] CYCLOPHILIN B
    5e-31  32%  3bo7D  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE, CYCLOPHILIN-
    6e-31  31%  1clhA  [x.x.x] CYCLOPHILIN
    7e-31  29%  1dywA  [b.62.1] CYCLOPHILIN 3
    9e-31  33%  1bckA  [b.62.1] CYCLOPHILIN A
    2e-30  34%  2alfA  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE A
    6e-30  34%  3bkpA  [x.x.x] CYCLOPHILIN
    7e-30  34%  1awqA  [b.62.1] CYCLOPHILIN A
    1e-29  47%  2a2nA  [x.x.x] PEPTIDYLPROLYL ISOMERASE DOMAIN AND WD REPEAT
    7e-28  31%  2c3bA  [x.x.x] PPIASE
    4e-27  47%  2a2nC  [x.x.x] PEPTIDYLPROLYL ISOMERASE DOMAIN AND WD REPEAT
    4e-26  34%  2c3bB  [x.x.x] PPIASE
    9e-25  31%  1awsA  [b.62.1] CYCLOPHILIN A
:190

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxMGVMTSKTATAILHTNRGDITIDLFGNHAPETVANFVGLAQGTKEYQAQNAQGDSEG
1c5fK           -----------------------TIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKI----SGKP
1c5fG           ----------------------VTIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKISGKPL---
3bo7A           -------------------KKGYLRIVTTQGSLNIELHADMAPRACDSFLRLCAVK--------------
1a33A           -----------------------TIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKISGKP----
1c5fI           -----------------------TIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKISGKP----
3bo7B           -------------------KKGYLRIVTTQGSLNIELHADMAPRACDSFLRLCAVK--------------
3bt8A           -----------------------MIDSEPLGRITIGLFGKDAPLTTENFRQLCTGEHGF-----------
2cfeA           -----------------------TKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGF-----------
1a58A           -----------------------TIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKISGKPL---
2b71A           -------------KMKGHTERGYITIYTNLGDFEVELYWYHSPKTCLNFYTLCEMG--------------
2ck1A           -----------------------RIGNGDAGRIVMELRSDIVPRTAENFRALCTGERGF-----------
3bo7C           -------------------KKGYLRIVTTQGSLNIELHADMAPRACDSFLRLCAVK--------------
1cynA           -----------------------RIGDEDVGRVIFGLFGKTVPKTVDNFVALATGEK------------G
3bo7D           -------------------KKGYLRIVTTQGSLNIELHADMAPRACDSFLRLCAVKY-------------
1clhA           -------------------GDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSG--------------
1dywA           -----------------------TIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGIGKSGKPL----
1bckA           -----------------------AVDGEPLGRVSFELFADKVPKTAENFRALSTGEK------------G
2alfA           -----------------------AVDGEPLGRVSFELFADKVPKTAENFRALSTGEK------------G
3bkpA           ------------------STRGKVVLHTSLGDLDVELWARECPLACRNFVQLCLEG--------------
1awqA           ----------------------IAVDGEPLGRVSFELFADKVPKTAENFRALSTGEK------------G
2a2nA           ----------------------SAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNG--------------
2c3bA           ------------------EYAPVGTAETKVGRIVFNLFDKDVPKTAKNFRELCKRPA------------G
2a2nC           ----------------------SAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNG--------------
2c3bB           ------------------EYAPVGTAETKVGRIVFNLFDKDVPKTAKNFRELCKRPA------------G
1awsA           -----------------------AVDGEPLGRVSFELFADKVPKTAENFRALSTGEK------------G


                         .         .         *         .         .         .         .:140
query           PFYNGSVFHRVIDGFMIQXXXXXXXXXXXXXYTFADEFHPELRFDRAYLLAMANAGPGTNGSQFFITVTP
1c5fK           LHYKGSTFHRVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEMKHDEPFVVSMANKGPNTNGSQFFITTTP
1c5fG           -HYKGSTFHRVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEMKHDEPFVVSMANKGPNTNGSQFFITTTP
3bo7A           -YFDDTIFHRCIRNFMIQGGRAELRQPQSPRAPFEDEFDNRLVHQGIGVLSMANDGKHSNLSEFFITFKS
1a33A           LHYKGSTFHRVIKNFMIQGGDFTKGDGTGGESIYGGMFEFVMKHDEPFVVSMANKGPNTNGSQFFITTTP
1c5fI           LHYKGSTFHRVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEMKHDEPFVVSMANKGPNTNGSQFFITTTP
3bo7B           -YFDDTIFHRCIRNFMIQGGRAELRQPQQSPRSFEDEFDNRLVHQGIGVLSMANDGKHSNLSEFFITFKS
3bt8A           -GYKDSIFHRVIQNFMIQGGDFTNFDGTGGKSIYGEKFADENVKHFVGALSMANAGPNTNGSQFFITTAP
2cfeA           -GYAGSHFHRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADELKHNKPGLLSMANAGPNTNGSQFFITTVV
1a58A           -HYKGSTFHRVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEMKHDEPFVVSMANKGPNTNGSQFFITTTP
2b71A           -FYDNTIFHRVIPNFVIQGGDPTGTGKGGKSEYFEDEINKELKHTGAGILSMSNNGPNTNSSQFFITLAP
2ck1A           -GYHNCCFHRVIPQFMCQGGDFVKGDGTGGKSIYGRKFNFQLRHEGFGVLSMANSGPNTNGSQFFICTTK
3bo7C           -YFDDTIFHRCIRNFMIQGGRAELRQPSKKQSPRSISGDNRLVHQGIGVLSMANDGKHSNLSEFFITFKS
1cynA           FGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGEDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVK
3bo7D           --FDDTIFHRCIRNFMIQGGRAELRQPQQSPRSFEDEFDNRLVHQGIGVLSMANDGKHSNLSEFFITFKS
1clhA           -FYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNLRNTRGTIAMARTADKDSATSQFFINVAD
1dywA           -HFKGSKFHRIIPNFMIQGGDFTRGNGTGGESIYGEDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVK
1bckA           FGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFNFILKHTGPGILSMANAGPNTNGSQFFICTAK
2alfA           FGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDELKHTGPGILSMANAGPNTNGSQFFICTAK
3bkpA           -YYVNTIFHRVVKDFIVQGGDPTGTGRGGADKPFDVETHPRLKFRYRGLVGVAN--LGTNGNQFFITLAR
1awqA           FGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDELKHTGPGILSMANAGPNTNGSQFFICTAK
2a2nA           -YYNGHTFHRIIKGFMIQTGDPTGTGMGGESIWFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVP
2c3bA           EGYRESTFHRIIPNFMIQGGD----------------------------SRKHDKKGILSMAQFFITTAV
2a2nC           -YYNGHTFHRIIKGFMIQTGDPTGTGMGGESGEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVP
2c3bB           EGYRESTFHRIIPNFMIQ--------------------------------GGDKKGILSMASQFFITTAV
1awsA           FGYKGSCFHRIIPGFCQGGDFTRHNGTGGKSYGEKFEDENFILKHTGPGILSANAGPNTNGSQFFICTAK


                         +         .         .         .         .         *         .:210
query           TPHLNNAHTIFGEVTDAESQKVVDAIATTATDRYDRPADAVVIESVEITA
1c5fK           APHLNNIHVVFGKVV--SGQEVVTKIEYLKTNSKNRPLADVVILNCGE--
1c5fG           APHLNNIHVVFGKVV--SGQEVVTKIEYLKTNSKNRPLADVVILNCGE--
3bo7A           CEHLNNKHTIFGRVV--GGLDVLRQWEKLETDKKDKPLKPPKVEEIIV--
1a33A           APHLNNIHVVFGKVV--SGQEVVTKIEYLKTNSKNRPLADVVILNCGE--
1c5fI           APHLNNIHVVFGKVV--SGQEVVTKIEYLKTNSKNRPLADVVILNCGE--
3bo7B           CEHLNNKHTIFGRVV--GGLDVLRQWEKLETDKKDKPLKPPKVEEIIV--
3bt8A           TPWLDGAHVVFGKVL--DGMDVVLRIEKTKTNSHDRPVKPVKIVASGE--
2cfeA           TSWLDGKHVVFGEVI--DGMNVVKAIEAEGSGS-GKPRSRIEIAKCGV--
1a58A           APHLNNIHVVFGKVV--SGQEVVTKIEYLKTNSKNRPLADVVILNCGE--
2b71A           LPHLDGKHTIFARVS--KNMTCIENIASVQTTATNKPIFDLKILRT----
2ck1A           CDWLDGKHVVFGRVV--DGQNVVKKMESVGSKS-GKVKEPVIISRCGE--
3bo7C           CEHLNNKHTIFGRVV--GGLDVLRQWEKLETDKKDKPLKPPKVEEIIV--
1cynA           TAWLDGKHVVFGKVL--EGMEVVRKVESTKTDSRDKPLKDVIIADCGK--
3bo7D           CEHLNNKHTIFGRVV--GGLDVLRQWEKLETDKKDKPLKPPKVEEIIV--
1clhA           NAFLDHGYAVFGKVV--KGMDVADKISQVPTHYQNVPSKPVVILSAKV--
1dywA           TEWLDGKHVVFGRVV--EGLDVVKAVESNGSQS-GKPVKDCMIADCGQ--
1bckA           TEWLDGKHVVFGKVK--EGMNIVEAMERFGSRN-GKTSKKITIADCGQ--
2alfA           TKWLDGKHVVFGAVK--EGMNIVEAMERFGSRN-GKTSKKITIADCGQ--
3bkpA           ADVLNNAYTLFGKVTG-HTLYNLMKFNDLEVGKEDRPMTPPFIKSVDVLW
1awqA           TEWLDGKHVVFGKVK--EGMNIVEAMERFGSRN-GKTSKKITIADCGQ--
2a2nA           TPWLDNKHTVFGRVT--KGMEVVQRISNVKVNKTDKPYEDVSIINITV--
2c3bA           TSWLDGKHVVFGEVADEKSYSVVKEIEALGSSGSVRSNTRPKIVNCGE--
2a2nC           TPWLDNKHTVFGRVT--KGMEVVQRISNVKVNKTDKPYEDVSIINITV--
2c3bB           TSWLDGKHVVFGEVADEKSYSVVKEIEALGSSGSVRSNTRPKIVN-----
1awsA           TEWLDGKHVVFGKVK--EGNIVEAER---FGSRNGKTSKKITIADCGQ--