[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF53115.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bl3B.bssp"
#ERROR : Can't open dsspfile "1biuA.bssp"
#ERROR : Can't open dsspfile "1bisB.bssp"
#ERROR : Can't open dsspfile "1bi4C.bssp"
#ERROR : Can't open dsspfile "1c6vC.bssp"
#ERROR : Can't open dsspfile "1bhlA.bssp"
#ERROR : Can't open dsspfile "2b4jB.bssp"
#ERROR : Can't open dsspfile "1c6vB.bssp"
#ERROR : Can't open dsspfile "1bi4B.bssp"
#ERROR : Can't open dsspfile "1biuB.bssp"
#ERROR : Can't open dsspfile "1bizB.bssp"
#ERROR : Can't open dsspfile "1bi4A.bssp"
#ERROR : Can't open dsspfile "1c6vA.bssp"
#ERROR : Can't open dsspfile "1b9fA.bssp"
#ERROR : Can't open dsspfile "1bizA.bssp"
#ERROR : Can't open dsspfile "1b9dA.bssp"
#ERROR : Can't open dsspfile "1bisA.bssp"
#ERROR : Can't open dsspfile "1cz9A.bssp"
#ERROR : Can't open dsspfile "2b4jA.bssp"
#ERROR : Can't open dsspfile "1bibA.bssp"

## Summary of PDB Search
:383
    2e-11  12%  1bl3B  [c.55.3] INTEGRASE
    6e-11  11%  1biuA  [c.55.3] HIV-1 INTEGRASE
    9e-11  14%  1bisB  [c.55.3] HIV-1 INTEGRASE
    7e-10  16%  1bi4C  [c.55.3] INTEGRASE
    1e-09  18%  1c6vC  [c.55.3] PROTEIN (SIV INTEGRASE)
    1e-09   9%  1bhlA  [x.x.x] HIV-1 INTEGRASE
    2e-09  14%  2b4jB  [x.x.x] INTEGRASE (IN)
    2e-09  16%  1c6vB  [c.55.3] PROTEIN (SIV INTEGRASE)
    8e-09  13%  1bi4B  [c.55.3] INTEGRASE
    1e-08  11%  1biuB  [c.55.3] HIV-1 INTEGRASE
    2e-08  11%  1bizB  [c.55.3] HIV-1 INTEGRASE
    2e-08  12%  1bi4A  [c.55.3] INTEGRASE
    2e-07  14%  1c6vA  [c.55.3] PROTEIN (SIV INTEGRASE)
    4e-07  13%  1b9fA  [c.55.3] PROTEIN (INTEGRASE)
    4e-06  12%  1bizA  [c.55.3] HIV-1 INTEGRASE
    2e-05  10%  1b9dA  [c.55.3] PROTEIN (INTEGRASE)
    3e-05  14%  1bisA  [c.55.3] HIV-1 INTEGRASE
    1e-04  15%  1cz9A  [c.55.3] AVIAN SARCOMA VIRUS INTEGRASE
    2e-04  10%  2b4jA  [x.x.x] INTEGRASE (IN)
    4e-04  16%  1bibA  [x.x.x] BIR A[MASQUE : MEMB(X) 45 / COIL(x) 0]
:383

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxREE
1bl3B           ----------------------------------------------------------------------
1biuA           ----------------------------------------------------------------------
1bisB           ----------------------------------------------------------------------
1bi4C           ----------------------------------------------------------------------
1c6vC           ----------------------------------------------------------------------
1bhlA           ----------------------------------------------------------------------
2b4jB           ----------------------------------------------------------------------
1c6vB           ----------------------------------------------------------------------
1bi4B           ----------------------------------------------------------------------
1biuB           ----------------------------------------------------------------------
1bizB           ----------------------------------------------------------------------
1bi4A           ----------------------------------------------------------------------
1c6vA           ----------------------------------------------------------------------
1b9fA           ----------------------------------------------------------------------
1bizA           ----------------------------------------------------------------------
1b9dA           ----------------------------------------------------------------------
1bisA           ----------------------------------------------------------------------
1cz9A           ----------------------------------------------------------------------
2b4jA           ----------------------------------------------------------------------
1bibA           -------------------------------------------------------------------PLK


                         .         .         *         .         .         .         .:140
query           ISRGLSVGLSYRAIARLTGRSASTISREVTRNRGRTAYRAIDADDRSWRQARRPQRCKLAKNPVLRGYVA
1bl3B           ----------------------------------------------------------------------
1biuA           ----------------------------------------------------------------------
1bisB           ----------------------------------------------------------------------
1bi4C           ----------------------------------------------------------------------
1c6vC           ----------------------------------------------------------------------
1bhlA           ----------------------------------------------------------------------
2b4jB           ----------------------------------------------------------------------
1c6vB           ----------------------------------------------------------------------
1bi4B           ----------------------------------------------------------------------
1biuB           ----------------------------------------------------------------------
1bizB           ----------------------------------------------------------------------
1bi4A           ----------------------------------------------------------------------
1c6vA           ----------------------------------------------------------------------
1b9fA           ----------------------------------------------------------------------
1bizA           ----------------------------------------------------------------------
1b9dA           ----------------------------------------------------------------------
1bisA           ----------------------------------------------------------------------
1cz9A           ----------------------------------------------------------------------
2b4jA           ----------------------------------------------------------------------
1bibA           LIALLANGHSGEQLGETLGMSRAAINKVFTVPGKGYSLPEPIQLLNAKQILGQLDGGSVAVLPVID--ST


                         +         .         .         .         .         *         .:210
query           ARLREDWSPEQIAGRLKITYACTSRMQISHESIYKSLFIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bl3B           ----------------------------------------------------------------------
1biuA           ----------------------------------------------------------------------
1bisB           ----------------------------------------------------------------------
1bi4C           ----------------------------------------------------------------------
1c6vC           ----------------------------------------------------------------------
1bhlA           ----------------------------------------------------------------------
2b4jB           ----------------------------------------------------------------------
1c6vB           ----------------------------------------------------------------------
1bi4B           ----------------------------------------------------------------------
1biuB           ----------------------------------------------------------------------
1bizB           ----------------------------------------------------------------------
1bi4A           ----------------------------------------------------------------------
1c6vA           ----------------------------------------------------------------------
1b9fA           ----------------------------------------------------------------------
1bizA           ----------------------------------------------------------------------
1b9dA           ----------------------------------------------------------------------
1bisA           ----------------------------------------------------------------------
1cz9A           ----------------------------------------------------------------------
2b4jA           ----------------------------------------------------------------------
1bibA           NQYLLDRIGELKSGDACIAEYQQAGRGRSGANLYLSMFW-------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxGHWEGDLVIGAQQSQIATVIERATRFTRVVHVESRHAASVTAGLIR
1bl3B           ------------------------GIWQLDCTHLEGKV-ILVAVHVASGYIEAEVIPAETGQETAYFLLK
1biuA           ------------------------GIWQLDCTHLEGKV-ILVAVHVASGYIEAEVIPAETGQETAYF-LL
1bisB           ------------------------GIWQLDCTHLEGKV-ILVAVHVASGYIEAEVIPAETGQETAYFLLK
1bi4C           ------------------------GIWQLDCTHLEGKV-ILVAVHVASGYI-EAEVIPAETGQETAYFLL
1c6vC           ------------------------GTWQMD-CTHLEGKIVIVAVHVASGFIEAEVIPQETGRQTALFLLK
1bhlA           ------------------------GIWQLDTHLEGKV--ILVAVHVASGYIEAEVIPAETGQETAYFLLK
2b4jB           ------------------------GIWQLDC-THLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLK
1c6vB           ------------------------GTWQMDCTHL-EGKIVIVAVHVASGFIEAEVIPQETGRQTALFLLK
1bi4B           ------------------------GIWQLDCTHLEGKV-ILVAVHVASGYIEAEVIPAETGQETAYFLLK
1biuB           ------------------------GIWQLDC-THLEGKVILVAVHVASGYIEAEVI-PAETGQETAYFLL
1bizB           ------------------------GIWQLDCTHLEGKV-ILVAVHVASGYIEAEVIPAETGQETAYFLLK
1bi4A           ------------------------GIWQLDCTHL-EGKVILVAVHVASGYIEAEVIPAETGQETAYFL-L
1c6vA           ------------------------GTWQMDCTHL-EGKIVIVAVHVASGFIEAEVIPQETGRQT-ALFLL
1b9fA           -------------------------IWQLDC-THLEGKVILVAVHVASGYIEAEVIPAETGQETA---YF
1bizA           ------------------------GIWQLDC-THLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLK
1b9dA           -------------------------IWQLDCT-HLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLK
1bisA           ------------------------GIWQLDCTHLEGKV-ILVAVHVASGYIEAEVIPAETGQETAYFLLK
1cz9A           ---------------------------------------LAVTVDTASSAIVVTQHGRVTSVAAQHHWAT
2b4jA           ------------------------GIWQLD-CTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLK
1bibA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ELGQLPDQAKRSLTWDRGMELAGHKEVTAGTGMTVCFADPHSPWQRGTNENTNRLLRQYFPKKTSMKGFS
1bl3B           LAGRWPVKTVHT-DNGSNFTSTTVKAACWWAGIKQEFVIESMNKELKKIIGQVRDQAEHL----------
1biuA           KLAGRWPVKTVHTDNGSNFTSTTVKAACEWGGIKQEFGQGVIESMNKELKKIIGQVRDQAEHL-------
1bisB           LAGR-WPVKTVHTDNGSNFTSTTVKAACEWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHL
1bi4C           KLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHL
1c6vC           LAGRWPITHLHT---DNGANFASQEVK--------MVAWWAGIEHTFGVEAMNHHLKNQIDRIREQANSV
1bhlA           LAGRWPVKTVHTDNGSNFTSTTVKA-------AWWAGIKQMNKELKKIIGQVRDQAEHLKTA--------
2b4jB           LAGRWPVKTVHT-DNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHL
1c6vB           LAGRWPITHLHT-DNGANFASQEVKMVAWWAGIEHTFGEAMNHHLKNQIDRIREQANSV-----------
1bi4B           LAGRWPVKTVHT-DNGSNFTSTTVKAACWWAGIKQEFLIESMNKELKKIIGQVRDQAEHLKTAVQMAVFI
1biuB           KLAGRWPVKTVHTDNGSNFTSTTVKAACEWGGIKQEFGGVIESMNKELKKIIGQV--------RDQAEHL
1bizB           -LAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGSMNKELK------------KIIGQVRDQAEHL
1bi4A           KLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIESMNKELKKIIGQVRDQAEHL----------
1c6vA           KLAGRWPITHLHTDNGANFASQEVKMVAWWAGIEHTFGEAMNHHLKNQIDRIREQANSVETIVL------
1b9fA           LLKLAGRWPVKTVHTDNGSNFTSTKAACWWAGIKQEFAIPYNPQSQAVIESMNKELKKIIGQVRDQAEHL
1bizA           ---LAGRWPVKTVHTDNGSNFTSTKAACWWAGIKQEFGGVIESMNKELKKIIGQVRDQAEHL--------
1b9dA           LAGRWPVKTVHT-DNGSNFTSTTVKAACWWAGIKQEFGGVIESMNKELKKIIGQVRDQAE--------HL
1bisA           LAGRWPVKTVHTDNG-SNFTSTTVKAACEWAGIKQEFGIPIESMNKELKKIIGQVRDQAEHLKTAVQ---
1cz9A           AIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFM
2b4jA           LAGRWPVKTVHT-DNGSNFTSTTVKAACWWAGFVIESMNKELKKIIGQVRDQAEHLKTAVQMA-------
1bibA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           QTDLDQVADKLNNRPRKVLGFRTPAExxxxxxx
1bl3B           KTAVQMAVFIHNHKRKGGIGGYSAGE-------
1biuA           KTAVQMAVFIHNKKRKGGIGGYSAGE-------
1bisB           KTAVQMAVFIHNKKRKGGIGGYSAGE-------
1bi4C           KTAVQMAVFIHNHKRKGGIGGYSAGE-------
1c6vC           ETIVLMAVHCMNHKRRGGIGDMTPAE-------
1bhlA           ---VQMAVFIHNHKRKGGIGGYSAGE-------
2b4jB           KTAVQMAVFIHNKKRSAGIVDIIATD-------
1c6vB           ETIVLMAVHCMNHKRRGGIGDMTPAE-------
1bi4B           ----------HNHKRKGGIGGYSAGE-------
1biuB           KTAVQMAVFIHNKKRKGGIGGYSAGE-------
1bizB           KTAVQMAVFIHNKKRKGGIGGYSAGE-------
1bi4A           KTAVQMAVFIHNHKRKGGIGGYSAGE-------
1c6vA           -----MAVHCMNHKRRGGIGDMTPAE-------
1b9fA           KTAVQMAVFIHNKKRKGRIVDIIATD-------
1bizA           KTAVQMAVFIHNKKRKGGIGGYSAGE-------
1b9dA           KTAVQMAVFIHNKKRKGRIVDIIATD-------
1bisA           -----MAVFIHNKKRKGGIGGYSAGE-------
1cz9A           KR-------------------------------
2b4jA           ------VFIHNKKSAGERIVDIIATD-------
1bibA           ---------------------------------