[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF53444.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cerD.bssp"
#ERROR : Can't open dsspfile "3cerA.bssp"
#ERROR : Can't open dsspfile "3cerC.bssp"
#ERROR : Can't open dsspfile "3cerE.bssp"
#ERROR : Can't open dsspfile "3dfuA.bssp"
#ERROR : Can't open dsspfile "3dfuB.bssp"

## Summary of PDB Search
:302
    2e-24  22%  3cerD  [x.x.x] POSSIBLE EXOPOLYPHOSPHATASE-LIKE PROTEIN
    1e-23  22%  3cerA  [x.x.x] POSSIBLE EXOPOLYPHOSPHATASE-LIKE PROTEIN
    8e-21  22%  3cerC  [x.x.x] POSSIBLE EXOPOLYPHOSPHATASE-LIKE PROTEIN
    6e-19  23%  3cerE  [x.x.x] POSSIBLE EXOPOLYPHOSPHATASE-LIKE PROTEIN
    1e-08  13%  3dfuA  [x.x.x] UNCHARACTERIZED PROTEIN FROM 6-PHOSPHOGLUCONATE
    2e-08  12%  3dfuB  [x.x.x] UNCHARACTERIZED PROTEIN FROM 6-PHOSPHOGLUCONATE
:302

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGSNTVHLVAVDARPGGHPTPMSNWRTPLRLVELLDDSGAISEKGINKLTSAVGEAADLAKTLGCAELMP
3cerD           CGTNSIRLKIARV-DADGHEVVPRILRVIRLGQDVDKTHRFADEALERAYVAAREFAGVIAEHPIDGLRF
3cerA           -GTNSIRLKIARV-DADGHEVVPRILRVIRLGQDVDKTHRFADEALERAYVAAREFAGVIAEHPIDGLRF
3cerC           CGTNSIRLKIARVD-ADGHEVVPRILRVIRLGQDVDKTHRFADEALERAYVAAREFAGVIAEHPIDGLRF
3cerE           -GTNSIRLKIARG-----HEVVPRILRVIRLGQDVDKTHRFADEALERAYVAAREFAGVIAEHPIDGLRF
3dfuA           DGSSTVNAEKLDSVGHYVTVLHA--PEDIRDFELVVIDAHGVEGYVEKLSAFARRGQFLHTSLTHG----
3dfuB           DGSSTVNAEKLDSVGHYVTVLHAPED--IRDFELVVIDAHG-VEGYVEKLSAFARRGQFLHTSLTHGITV


                         .         .         *         .         .         .         .:140
query           FATSAVRSATNSEAVLDHVEEETGVRLSILSGEDEARQTFLAVRRWYGWSAGRITNLDIGGGSLELSSGT
3cerD           VATSATRDAENREEFEDEIERILGVRPEVIPGTEEADLSFLGATSVVNRDPAPYLVVDLGGGSTELVIGG
3cerA           VATSATRDAENREEFEDEIERILGVRPEVIPGTEEADLSFLGATSVVNRDDLPAPYLDLGGGSTELVIGG
3cerC           VATSATRDAENREEFEDEIERILGVRPEVIPGTEEADLSFLGATSVVNRDDLPAPYLDLGGGSTELVIGG
3cerE           VATSATRDAENREEFEDEIERILGVRPEVIPGTEEADLSFLGATSVVNRDDLPAPYLDLGGGSTELVIGG
3dfuA           -ITVDPLETSGGIVSAHPIGQDRW---------------VASALDELGETIVGLLVGELGGSIVEIADDK
3dfuB           DPLETSGGIVSAHPIGQDRWVASALDELGETIVGLLVGELGGSIVEIADDKRAQLAAALTYAGFLSTLQR


                         +         .         .         .         .         *         .:210
query           DESPDLAFSLDLGAGRLTHNWFDTDPPARKKINLLRDYIDAELAEPARQMRTLGPARLAVGTSKTFRTLA
3cerD           DGVSAPTTQVQGAFSNIGSVRTENDPPTQTQIDEAVADVDEHIDEAFRTVDAGKARTI-IGVSGTVTTTA
3cerA           DGVSAPTTQVQGAFSNIGSVRTERHTQTQIDEAVADVD---EHIDEAFRTVDAGKARTIIGVSGTVTTTA
3cerC           DGVSAPTTQVQGAFSNIGSVRTERHLTNDPPTQTQIDEAVADVDEHAFRTVDAGKARTIIGVSGTVTTTA
3cerE           DGVSAPTTQVQGAFSNIGSVRTERHLTNDPPTQTQIDEDVDEHIDEAFRTVDAGKARTIIGVSGTVTTTA
3dfuA           RAQLAAALTYAGFLSTLQRDASYFLDEFDVTSDIVDSAQQFQALPSLDEVIAQYDSINNPGRQRLFRDLA
3dfuB           DASYFLDEFL--GDPDVTSDIVDSAQ----------QFQALPSLD---EVIAQYDSINNPGRQRLFRDLA


                         .         .         .         +         .         .         .:280
query           RLTGAAPSSAGPHVTRTLTAPGLRQLIAFISRMTAADRAELEGISSDRSHQIVAGALVAEAAMRALDIDK
3cerD           LA-GLKEYDHTVVDGHRLSFEDAYAVDDKF-LRTRAERREYKTIHPGRIDVVGGGAVVWSRVLAREAIDS
3cerA           LA-GLKEYDHTVVDGHRLSFEDAYAVDDKF-LRTRAERREYKTIHPGRIDVVGGGAVVWSRVLARVAIDS
3cerC           LALKEYDHTV--VDGHRLSFEDAYAVDDKF-LRTRAERREYKTIHPGRIDVVGGGAVVWSRVLARVAIDS
3cerE           LA-GLKEYDHTVVDGHRLSFEDAYAVDDKF-LRTRAERREYKTIHPGRIDVVGGGAVVWSRVLARVAIDS
3dfuA           RRQAEISRAQDIELWAIQ----------------------------------------------------
3dfuB           RRQAEISRAQ------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VEICPWALREGVILTRIDKGLE
3cerD           FVASEHGLLDGIVLDYGRRLL-
3cerA           FVASEHGLLDGIVLDYGRRLLA
3cerC           FVASEHGLLDGIVLDYGRRLLA
3cerE           FVASEHGLLDGIVLDYGRRLL-
3dfuA           ----------------------
3dfuB           ----------------------