[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF53516.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bu5A.bssp"

## Summary of PDB Search
:150
    4e-04  20%  2bu5A  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
:150

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bu5A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxEHWQVKYLNNVIEGDHGRLKRILGPKVAFKNLDICISDVERDGGDALDSRKGQGTMF
2bu5A           -------------EDLSIKMSDRGGGVPLRKIERLFSYMYSTAPLPISRLYAKYFQGDQLFSMEGFGTDA


                         +         .         .         .         .         *         .:210
query           ALTxxxxxxx
2bu5A           VIY-------