[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF53610.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3d5aE.bssp"
#ERROR : Can't open dsspfile "3bbnE.bssp"
#ERROR : Can't open dsspfile "1azpA.bssp"
#ERROR : Can't open dsspfile "1ca5A.bssp"
#ERROR : Can't open dsspfile "1c8cA.bssp"

## Summary of PDB Search
:211
    2e-34  45%  3d5aE  [x.x.x] 30S RIBOSOMAL PROTEIN S5
    6e-25  45%  3bbnE  [x.x.x] RIBOSOMAL PROTEIN S5
    6e-08  19%  1azpA  [b.34.13] PROTEIN (HYPERTHERMOPHILE CHROMOSOMAL PROTEIN
    4e-07  19%  1ca5A  [b.34.13] CHROMOSOMAL PROTEIN SAC7D
    3e-06  23%  1c8cA  [b.34.13] DNA-BINDING PROTEIN 7A
:211

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSQYIERVVTINRVSKVVKGGRRFSFTALX
3d5aE           ---------------------------------------------EKMILIRRTARMQAGGRRFRFGALV
3bbnE           ---------------------------------------------ENVVQVRRVTKVVKGGKHMRFRAIV
1azpA           -----------------------------------------YKGEEKEVDTSKIKKVWRVGKMVSFTY--
1ca5A           -----------------------------------------YKGEEKEVDTSKIKKVWRVGKMVSFTY--
1c8cA           ---------------------------------------------EKQVDISKIKKVWRVGKMISFTY--


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXXXXKAKEVPAAIQKGAEEARKNFFRVPMVNGTITHPVQGEKAAGIVMLKPAAPGTGVIA
3d5aE           VVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIA
3bbnE           VVGDKKGQVGVGVGKAKEVVSAVQKAAVDARRNIITVPMTKYTFPHRNEADYGAARVMLRPAAPGTGVIA
1azpA           ---DDNGKTGRGAVSEKDAPKELLDMLARAERE-------------------------------------
1ca5A           ---DDNGKTGRGAVSEKDAPKELLDMLARAERE-------------------------------------
1c8cA           --DEGGGKTGRGAVSEKDAPKELLQMLAKQKK--------------------------------------


                         +         .         .         .         .         *         .:210
query           GGAARPVLECAGIQDILSKSLGSDNAINVVHATVDGLKQLVRPEEVAARRGKTIEEVxxxxxxxxxxxxx
3d5aE           GAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG------------------
3bbnE           GGAVRTVLEMAGVENALGKQLGSNNALNNARATIVAVQTMRQFSDVARDRGIPMEEL-------------
1azpA           ----------------------------------------------------------------------
1ca5A           ----------------------------------------------------------------------
1c8cA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           x
3d5aE           -
3bbnE           -
1azpA           -
1ca5A           -
1c8cA           -