[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF53649.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1e7rA.bssp"
#ERROR : Can't open dsspfile "2b69A.bssp"
#ERROR : Can't open dsspfile "1bsvA.bssp"
#ERROR : Can't open dsspfile "3dbhC.bssp"
#ERROR : Can't open dsspfile "1e7qA.bssp"
#ERROR : Can't open dsspfile "1db3A.bssp"
#ERROR : Can't open dsspfile "3c1oA.bssp"
#ERROR : Can't open dsspfile "1a9zA.bssp"
#ERROR : Can't open dsspfile "3dbrG.bssp"
#ERROR : Can't open dsspfile "2bllA.bssp"
#ERROR : Can't open dsspfile "2c5aB.bssp"
#ERROR : Can't open dsspfile "2c29D.bssp"
#ERROR : Can't open dsspfile "2c54B.bssp"
#ERROR : Can't open dsspfile "1bxkB.bssp"
#ERROR : Can't open dsspfile "2c5aA.bssp"
#ERROR : Can't open dsspfile "2c5eA.bssp"
#ERROR : Can't open dsspfile "2cnbB.bssp"
#ERROR : Can't open dsspfile "1bxkA.bssp"
#ERROR : Can't open dsspfile "1ek6B.bssp"
#ERROR : Can't open dsspfile "3dbrE.bssp"
#ERROR : Can't open dsspfile "1bwsA.bssp"
#ERROR : Can't open dsspfile "1a2zA.bssp"
#ERROR : Can't open dsspfile "1e6uA.bssp"
#ERROR : Can't open dsspfile "1e7sA.bssp"
#ERROR : Can't open dsspfile "2c29F.bssp"
#ERROR : Can't open dsspfile "2c5eB.bssp"
#ERROR : Can't open dsspfile "1dihA.bssp"
#ERROR : Can't open dsspfile "2c54A.bssp"
#ERROR : Can't open dsspfile "1aorA.bssp"
#ERROR : Can't open dsspfile "2axqA.bssp"
#ERROR : Can't open dsspfile "2a92A.bssp"
#ERROR : Can't open dsspfile "1b8pA.bssp"
#ERROR : Can't open dsspfile "3eheA.bssp"
#ERROR : Can't open dsspfile "2c59B.bssp"
#ERROR : Can't open dsspfile "3c4tA.bssp"
#ERROR : Can't open dsspfile "1civA.bssp"
#ERROR : Can't open dsspfile "3dxfA.bssp"
#ERROR : Can't open dsspfile "3d5tA.bssp"
#ERROR : Can't open dsspfile "2c20A.bssp"
#ERROR : Can't open dsspfile "2cnbC.bssp"
#ERROR : Can't open dsspfile "2c59A.bssp"
#ERROR : Can't open dsspfile "1arzB.bssp"
#ERROR : Can't open dsspfile "2a92C.bssp"
#ERROR : Can't open dsspfile "1arzA.bssp"
#ERROR : Can't open dsspfile "1e5lA.bssp"
#ERROR : Can't open dsspfile "3bohA.bssp"
#ERROR : Can't open dsspfile "2blnA.bssp"
#ERROR : Can't open dsspfile "3e48A.bssp"
#ERROR : Can't open dsspfile "1arzC.bssp"
#ERROR : Can't open dsspfile "3bojA.bssp"
#ERROR : Can't open dsspfile "3dbhG.bssp"
#ERROR : Can't open dsspfile "2cnbA.bssp"
#ERROR : Can't open dsspfile "3d5tC.bssp"
#ERROR : Can't open dsspfile "1c3vA.bssp"
#ERROR : Can't open dsspfile "3e48B.bssp"
#ERROR : Can't open dsspfile "1c3xA.bssp"
#ERROR : Can't open dsspfile "3d1lA.bssp"
#ERROR : Can't open dsspfile "2a35B.bssp"
#ERROR : Can't open dsspfile "2cvoA.bssp"
#ERROR : Can't open dsspfile "2a35A.bssp"
#ERROR : Can't open dsspfile "1ds6B.bssp"
#ERROR : Can't open dsspfile "1bdmA.bssp"
#ERROR : Can't open dsspfile "1a9yA.bssp"
#ERROR : Can't open dsspfile "1ek5A.bssp"
#ERROR : Can't open dsspfile "1bmdA.bssp"
#ERROR : Can't open dsspfile "2a92B.bssp"
#ERROR : Can't open dsspfile "2dfdA.bssp"
#ERROR : Can't open dsspfile "3db2C.bssp"
#ERROR : Can't open dsspfile "2amfC.bssp"
#ERROR : Can't open dsspfile "3e5mA.bssp"
#ERROR : Can't open dsspfile "3c3xA.bssp"
#ERROR : Can't open dsspfile "3e5mB.bssp"
#ERROR : Can't open dsspfile "3dbhE.bssp"
#ERROR : Can't open dsspfile "2amfE.bssp"
#ERROR : Can't open dsspfile "2amfA.bssp"
#ERROR : Can't open dsspfile "2c82A.bssp"
#ERROR : Can't open dsspfile "3dxfB.bssp"
#ERROR : Can't open dsspfile "1bdmB.bssp"
#ERROR : Can't open dsspfile "3db2A.bssp"
#ERROR : Can't open dsspfile "3dr3A.bssp"
#ERROR : Can't open dsspfile "2bkaA.bssp"
#ERROR : Can't open dsspfile "2aefA.bssp"
#ERROR : Can't open dsspfile "3bywC.bssp"
#ERROR : Can't open dsspfile "3bywH.bssp"
#ERROR : Can't open dsspfile "1bw3A.bssp"
#ERROR : Can't open dsspfile "3db2B.bssp"
#ERROR : Can't open dsspfile "3bywD.bssp"
#ERROR : Can't open dsspfile "3c85C.bssp"
#ERROR : Can't open dsspfile "2cvoD.bssp"
#ERROR : Can't open dsspfile "3bywB.bssp"
#ERROR : Can't open dsspfile "1c9kA.bssp"
#ERROR : Can't open dsspfile "3bywF.bssp"
#ERROR : Can't open dsspfile "3ch6E.bssp"

## Summary of PDB Search
:317
    3e-38  17%  1e7rA  [c.2.1] GDP-FUCOSE SYNTHETASE
    5e-37  44%  2b69A  [x.x.x] UDP-GLUCURONATE DECARBOXYLASE 1
    1e-35  18%  1bsvA  [c.2.1] PROTEIN (GDP-FUCOSE SYNTHETASE)
    4e-34   9%  3dbhC  [x.x.x] NEDD8-ACTIVATING ENZYME E1 REGULATORY SUBUNIT
    1e-32  17%  1e7qA  [c.2.1] GDP-FUCOSE SYNTHETASE
    3e-32  24%  1db3A  [c.2.1] GDP-MANNOSE 4,6-DEHYDRATASE
    6e-32  13%  3c1oA  [x.x.x] EUGENOL SYNTHASE
    4e-31  21%  1a9zA  [x.x.x] UDP-GALACTOSE 4-EPIMERASE
    6e-31   7%  3dbrG  [x.x.x] NEDD8-ACTIVATING ENZYME E1 REGULATORY SUBUNIT
    6e-30  21%  2bllA  [x.x.x] PROTEIN YFBG
    9e-30  20%  2c5aB  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    8e-29  14%  2c29D  [x.x.x] DIHYDROFLAVONOL 4-REDUCTASE
    1e-28  22%  2c54B  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    5e-28  23%  1bxkB  [c.2.1] PROTEIN (DTDP-GLUCOSE 4,6-DEHYDRATASE)
    6e-28  22%  2c5aA  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    1e-27  23%  2c5eA  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    5e-27  19%  2cnbB  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    2e-26  23%  1bxkA  [c.2.1] PROTEIN (DTDP-GLUCOSE 4,6-DEHYDRATASE)
    2e-26  24%  1ek6B  [c.2.1] UDP-GALACTOSE 4-EPIMERASE
    6e-26  11%  3dbrE  [x.x.x] NEDD8-ACTIVATING ENZYME E1 REGULATORY SUBUNIT
    9e-26  17%  1bwsA  [c.2.1] PROTEIN (GDP-4-KETO-6-DEOXY-D-MANNOSE
    2e-25   9%  1a2zA  [c.56.4] PYRROLIDONE CARBOXYL PEPTIDASE
    3e-25  16%  1e6uA  [c.2.1] GDP-FUCOSE SYNTHETASE
    3e-25  15%  1e7sA  [c.2.1] GDP-FUCOSE SYNTHETASE
    6e-25  12%  2c29F  [x.x.x] DIHYDROFLAVONOL 4-REDUCTASE
    3e-24  22%  2c5eB  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    4e-23  12%  1dihA  [x.x.x] DIHYDRODIPICOLINATE REDUCTASE
    6e-23  21%  2c54A  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    9e-23  13%  1aorA  [d.152.1 - a.110.1] ALDEHYDE FERREDOXIN OXIDOREDUCTASE
    2e-22   8%  2axqA  [x.x.x] SACCHAROPINE DEHYDROGENASE
    2e-22   8%  2a92A  [x.x.x] L-LACTATE DEHYDROGENASE
    2e-22  10%  1b8pA  [c.2.1 - d.162.1] PROTEIN (MALATE DEHYDROGENASE)
    4e-22  23%  3eheA  [x.x.x] UDP-GLUCOSE 4-EPIMERASE (GALE-1)
    4e-22  22%  2c59B  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    2e-21   9%  3c4tA  [x.x.x] ENDORIBONUCLEASE DICER
    4e-21   9%  1civA  [c.2.1 - d.162.1] NADP-MALATE DEHYDROGENASE
    9e-21  12%  3dxfA  [x.x.x] NMRA-LIKE FAMILY DOMAIN-CONTAINING PROTEIN 1
    3e-20  10%  3d5tA  [x.x.x] MALATE DEHYDROGENASE
    4e-20  24%  2c20A  [x.x.x] UDP-GLUCOSE 4-EPIMERASE
    4e-20  17%  2cnbC  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    6e-20  20%  2c59A  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    7e-19  10%  1arzB  [c.2.1 - d.81.1] DIHYDRODIPICOLINATE REDUCTASE
    1e-18   6%  2a92C  [x.x.x] L-LACTATE DEHYDROGENASE
    2e-18  12%  1arzA  [c.2.1 - d.81.1] DIHYDRODIPICOLINATE REDUCTASE
    2e-18   9%  1e5lA  [c.2.1 - d.81.1] SACCHAROPINE REDUCTASE
    2e-18  10%  3bohA  [x.x.x] CADMIUM-SPECIFIC CARBONIC ANHYDRASE
    3e-18  12%  2blnA  [x.x.x] PROTEIN YFBG
    3e-18  10%  3e48A  [x.x.x] PUTATIVE NUCLEOSIDE-DIPHOSPHATE-SUGAR EPIMERASE
    4e-18  12%  1arzC  [c.2.1 - d.81.1] DIHYDRODIPICOLINATE REDUCTASE
    6e-18  10%  3bojA  [x.x.x] CADMIUM-SPECIFIC CARBONIC ANHYDRASE
    7e-18   9%  3dbhG  [x.x.x] NEDD8-ACTIVATING ENZYME E1 REGULATORY SUBUNIT
    9e-18  22%  2cnbA  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    1e-17  13%  3d5tC  [x.x.x] MALATE DEHYDROGENASE
    1e-17  12%  1c3vA  [c.2.1 - d.81.1] DIHYDRODIPICOLINATE REDUCTASE
    7e-17  10%  3e48B  [x.x.x] PUTATIVE NUCLEOSIDE-DIPHOSPHATE-SUGAR EPIMERASE
    1e-16   9%  1c3xA  [c.56.2] PENTOSYLTRANSFERASE
    4e-16   9%  3d1lA  [x.x.x] PUTATIVE NADP OXIDOREDUCTASE BF3122
    1e-15  16%  2a35B  [x.x.x] HYPOTHETICAL PROTEIN PA4017
    1e-15  10%  2cvoA  [x.x.x] PUTATIVE SEMIALDEHYDE DEHYDROGENASE
    2e-15  17%  2a35A  [x.x.x] HYPOTHETICAL PROTEIN PA4017
    2e-15  13%  1ds6B  [b.1.18] RHO GDP-DISSOCIATION INHIBITOR 2
    3e-15  10%  1bdmA  [c.2.1 - d.162.1] MALATE DEHYDROGENASE
    1e-14  22%  1a9yA  [x.x.x] UDP-GALACTOSE 4-EPIMERASE
    3e-14  18%  1ek5A  [c.2.1] UDP-GALACTOSE 4-EPIMERASE
    5e-14   9%  1bmdA  [c.2.1 - d.162.1] MALATE DEHYDROGENASE
    8e-14   8%  2a92B  [x.x.x] L-LACTATE DEHYDROGENASE
    1e-13   9%  2dfdA  [x.x.x] MALATE DEHYDROGENASE
    2e-13  11%  3db2C  [x.x.x] PUTATIVE NADPH-DEPENDENT OXIDOREDUCTASE
    7e-13  11%  2amfC  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
    7e-13  13%  3e5mA  [x.x.x] NMRA-LIKE FAMILY DOMAIN-CONTAINING PROTEIN 1
    7e-13  13%  3c3xA  [x.x.x] EUGENOL SYNTHASE 1
    1e-12  14%  3e5mB  [x.x.x] NMRA-LIKE FAMILY DOMAIN-CONTAINING PROTEIN 1
    2e-12  13%  3dbhE  [x.x.x] NEDD8-ACTIVATING ENZYME E1 REGULATORY SUBUNIT
    6e-12  13%  2amfE  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
    8e-11  11%  2amfA  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
    7e-09  13%  2c82A  [x.x.x] 1-DEOXY-D-XYLULOSE 5-PHOSPHATE REDUCTOISOMERASE
    2e-08  10%  3dxfB  [x.x.x] NMRA-LIKE FAMILY DOMAIN-CONTAINING PROTEIN 1
    3e-08  11%  1bdmB  [c.2.1 - d.162.1] MALATE DEHYDROGENASE
    4e-08  10%  3db2A  [x.x.x] PUTATIVE NADPH-DEPENDENT OXIDOREDUCTASE
    1e-07  11%  3dr3A  [x.x.x] N-ACETYL-GAMMA-GLUTAMYL-PHOSPHATE REDUCTASE
    3e-07  12%  2bkaA  [x.x.x] TAT-INTERACTING PROTEIN TIP30
    2e-06  10%  2aefA  [x.x.x] CALCIUM-GATED POTASSIUM CHANNEL MTHK
    9e-06   7%  3bywC  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    5e-05   9%  3bywH  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    7e-05   7%  1bw3A  [x.x.x] BARWIN, BASIC BARLEY SEED PROTEIN
    9e-05  10%  3db2B  [x.x.x] PUTATIVE NADPH-DEPENDENT OXIDOREDUCTASE
    1e-04   9%  3bywD  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    1e-04  12%  3c85C  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    1e-04  12%  2cvoD  [x.x.x] PUTATIVE SEMIALDEHYDE DEHYDROGENASE
    4e-04   9%  3bywB  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    7e-04  24%  1c9kA  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    7e-04   9%  3bywF  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    7e-04  14%  3ch6E  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
:317

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRCVITGGAGFLGSHLTDLILNQGHEVIVLDDLSTGSLSNLFHQISNPRLQIKTVDVRKKFEIDGPVDIV
1e7rA           -RVFIAGHRGMVGSAIRRQLEQRGDVELVL-------------RTRDELNLLDSRAVHDFFASERIDQVY
2b69A           -RILITGGAGFVGSHLTDKLDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLA
1bsvA           -RVFIAGHRGMVGSAIRRQLEQRGDVELV-------------LRTRDELNLLDSRAVHDFFASERIDQVY
3dbhC           ---VCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFFLQRSSIGKAAMEFLQELNSDVSGS
1e7qA           -RVFIAGHRGMVGSAIRRQLEQRGDVEL-------------VLRTRDELNLLDSRAVHDFFASERIDQVY
1db3A           -VALITGVTGQDGSYLAEFLLEKGYEVHGIKRPKFHLHYGDLSDTSNLTRILREVQPDEVYNLGAMSHV-
3c1oA           EKIIIYGGTGYIGKFMVRASLSFSHPTFIYARPLTPDSVQLREEFRSMGVTIIEGEMEEMVSVLKQVDIV
1a9zA           MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEILHDHAIDTVIHFA
3dbrG           -AHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFFLQRSSIGEAAMEFLQELNSDVSGS
2bllA           MRVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRFLNHPHFHFVEGDISIHSEWIEYHVKKDVV
2c5aB           LKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTEDMFCDEFHLVDLRVMENCLKVTEGVDHVFN
2c29D           -TVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVLDLPKAETHLTLWKADLADEGSFDEAIKGCTGV
2c54B           LKISITGAGGFIASHIARRLKHEGHYVIA-SDWKKNEHMTEDMFCDEFHLVDLRVMENCLKVTEGVDHVF
1bxkB           -KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKELARVFTEHQPDCV
2c5aA           LKISITGAGGFIASHIARRLKHEGHYVIASDWKKNE-HMTEDMFCDEFHLVDLRVMENCLKVTEGVDHVF
2c5eA           LKISITGAGGFIASHIARRLKHEGHYVIASDWKKNE-HMTEDMFCDEFHLVDLRVMENCLKVTEGVDHVF
2cnbB           MRVLVCGGAGYIGSHFVRALLRDTNHSVVIVDSLVGTHGKSDHVETRENVARKLQQLNGVFTRHGPIDAV
1bxkA           -KILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKELARVFTEHQPDCV
1ek6B           -KVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQILDQGALQRLFKKYSFMAV
3dbrE           SAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFRSSIGKNRAEAMEFLQELNSDVSGS
1bwsA           -RVFIAGHRGMVGSAIRRQLEQRGDVEL-------------VLRTRDELNLLDSRAVHDFFASERIDQVY
1a2zA           KKVLITGFEPFGGDSKNPTEQIAKYFDRKQIGNAMVYGRVLPVSV--KRATIELKRYLEEIKPEIVINLG
1e6uA           QRVFIAGHRGMVGSAIRRQLEQRGDVEL-------------VLRTRDELNLLDSRAVHDFFASERIDQVY
1e7sA           -RVFIAGHRGMVGSAIRRQLEQRGDV---------------ELVLRTRDELNLLDSRAVHDFFASERIDQ
2c29F           -TVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLDEGSFDEAIKGCT-G
2c5eB           LKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTEDMFCDEFHLVDLRVMENCLKVTEGVD-HVF
1dihA           IRVAIAGAGGRMGRQLIQAALALEVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSSLDAVKDDFDVF
2c54A           LKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTEDMFCDEFHLVDLRVMENCLKVTEGVDHVFN
1aorA           ----------------------------------------------------------------------
2axqA           -NVLLLG-SGFVAQPVIDTLAANDDINVTVACRTLANAQALAKPSGSKAISLDVTDDSALDKVLADNDVV
2a92A           -PKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNCKVTGSNSYDDLKGADVVIVT
1b8pA           MRVAVTGAAGQICYSLLFRIANGDMLGKDQPVILQLLEIPNEKAQKALQGVMMEIDDCAFPLLAKDADVA
3eheA           ---VVTGGAGFIGSHVVDKLSESNEIVVIDNLSSGN-----EEFVNEAARLVKADLAADDIKDYLKGAEE
2c59B           LKISITGAGGFIASHIARRLKHEGHYVIASDWKKNE-HMTEDMFCDEFHLVDLRVMENCLKVTEGVDHVF
3c4tA           --------------------------------TLNHLISGFETFEKKINYRFKNKAYLLQAFTHALGDAI
1civA           INVAVSGAAGMISNHLLFKLASGEVFGPDQPISLKLLGSERSFAALEGVAMELEDSLYPLLRQVSIGIDP
3dxfA           -LVVVFGGTGAQGGSVARTLLEDGTFKVRVVTANPRKKAAKELRLQGAEVVQDQDDQVIMELALNGAYAT
3d5tA           KRVAVTGAAGQIAYSLLFRIANGDLLGKDQPVAVKGVVMELDDCAFPLLAGVV--ITDDPKVAFKDADVA
2c20A           -SILICGGAGYIGSHAVKKLVDEGLSVVVVDNLQTGHEDAITEGAKFYNGDLRDKAFLRDVFTQENIEAV
2cnbC           MRVLVCGGAGYIGSHFVRALLRDTNHSVVIVDSLVG-THGKSDHVETRENVARKLQQSDGPKPPWADRYA
2c59A           LKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTEDMFCDEFHLVDLRVMENCLKVTEGVDHVFN
1arzB           IRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAG----------------AGKTG
2a92C           -PKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMVTGSNSYDDLKGADVVIVT
1arzA           IRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAKTGVTVQSSLDAVKDDFDVF
1e5lA           KSVLMLG-SGFVTRPTLDVLTDSGIKVTVACRTLESAKKLSAGVQHSTPISLDVNDDAALDAEVAKHDLV
3bohA           ----------------------------------------------------------------------
2blnA           MKTVVFA-YHDMGCLGIEALLAAGYEISAIFTHTDFYGSVARLAAERGIPVYAPDNVNHERIAQLSPDVI
3e48A           ---ILTGATGHLGTHITNQAIANHIDHFHIGVRNVEKVPDDWR----GKVSVRQLDYFNQESVEPSIIHP
1arzC           IRVAIAGAGGRMGRQLIQAALALEGQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSSLDAVKDDFDVF
3bojA           ----------------------------------------------------------------------
3dbhG           ---VCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNLQRSSIGKNRAEANSDVSGSFVEESP
2cnbA           MRVLVCGGAGYIGSHFVRALLRDTNHSVVIVDSLVGTHGKSDHVETRENVARKLQDVRNEGPIDAVVHMC
3d5tC           KRVAVTGAAGQIAYSLLFRIANGDLLGKDLDLPQAQAAVKGVVMELDDCAFPLLAGVVITDDPKVAKDAD
1c3vA           MRVGVLGAKGKVGTTMVRAVAAADDLTLSAELDAGDLLTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAV
3e48B           ---ILTGATGHLGTHITNQAIANHIDHFHIGV----RNVEKVPDDWRGKVSVRQLDYFNQESVEAFKGDT
1c3xA           ----------------------------------------------------------------------
3d1lA           ---IVLIGAGNLATNLAKALYRKGFRIVQVYSRTEESARELAQKVEAEYTTDLAEVNPYKLYIVSLKDSA
2a35B           -RVLLAGATGLTGEHLLDRILSEPTLAKVIAPARKALAEHPRLDNPVGP--------LAELLPQLDGSID
2cvoA           VRIAVLGASGYTGAEIVRLLANHPQFRIKVMTADRKAGEQFGSVFPHLITQDLPNLVAVKDADFSNVDAV
2a35A           KRVLLAGATGLTGEHLLDRILSEPTLAKVIA--------PARKALAEHPRLDNPVGPLAELLPQLDGSID
1ds6B           LTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQKVDKATFMVG-SYG
1bdmA           VRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEIPQAMKALEGVVMELEDCAGLEATDDPDVAFK
1a9yA           MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVALMTEILHDHAIDTV
1ek5A           EKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGA
1bmdA           VRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEIPQAMKALEGVVMELEDCDDPDVAFKDADYAL
2a92B           -PKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSYDVVIVT
2dfdA           -KVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIETKAAVKGYLGPEQLPDCLKGCD
3db2C           -------GLGRWAYVADAYTKSEKLKLVTCYSRTEDKREKFRYNCAGDATEALLAREDVEVIITVPNDKH
2amfC           MKIGIIG-VGKMASAIIKGLKQTPHELIISGSSLERSKEIAEQPYAMSHQDLIDQVDLVILGIKPQLETV
3e5mA           -LVVVFGGTGAQGGSVARTLLEDGTFKVRVVTRNPRKKAAKELRLQGAE------VVQGDQDDQVIMELA
3c3xA           SKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPN--------SSKTTLLDEFQSLGAIIVKGELDEHEKL
3e5mB           -LVVVFGGTGAQGGSVARTLLEDGTFKVRVVT-------RNPRKKAAKELRLQGAEVVQGDQDDQVIMEL
3dbhE           ---VCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDFFLQRSSIGKNRAEAAMEFLQELNSDVSGS
2amfE           MKIGIIG-VGKMASAIIKGLKQTPHELIISGSSLERSKEIAEQLALPYAMSHQDLIDQVDLVILGIKPQL
2amfA           MKIGIIG-VGKMASAIIKGLKQTPHELIISGSSLE-RSKEIAEQLALPYAMSHQDLIDQVDLVILLFETV
2c82A           ----------------------------------------------------------------------
3dxfB           -LVVVFGGTGAQGGSVARTLLEDGTFKVRVVTANPKAAKELRLQGAEVVQGDQDDQVIMELALNGAYATF
1bdmB           VRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEIPQAMKALEGVVMELEDCAFPLLAGLEATDDP
3db2A           -------GLGRWAYVADAYTKSEKLKLVTCYSRTEDKREKFGKRYATEALLAREDVEVIITVPNDKHAEV
3dr3A           LNTLIVGASGYAGAELVTYVNRHPHMNITALTVSAQSNGKLISDLHPQLKGIVELPLQPMSDISVDVVFL
2bkaA           KSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVG
2aefA           -------GWSESTLECLRELRGSEVFVLAEDENVRKKVLRSGA---NFVHGDPTRVSDLEKANVRGARAV
3bywC           ---LGTLPANSEDAGARGLFVRANDDGLQITSHGELVLDLSKRELAQLPADATIAATEDETTAGRPIIGI
3bywH           --ILGTLPANSEDAGARGLFVRANDDGLQITSHGELVLDLSKRELLPADATIAISATEDETTAGETVERD
1bw3A           ---PAQNNWDLGAPAVSAYCATWDASKPLSWSKYGWTAFCGPAGPRGQAACGKCLRVTNPATGAGGLDLD
3db2B           -------GLGRWAYVADAYTKSEKLKLVTCYSRTEDKREKKRYNCAGDATEALLAREDVEVIITVPNDKH
3bywD           ---LGTLPANSEDAGARGLFVRANDDGLQITSHGELVLDLSKRELLPADATIAISATEDETTAGETVERD
3c85C           ---QVLILGGRIGTGAYDELRARYGKISLGIEIREEAAQQHRSERNVISGDATDPDFWERILDTGHVKLV
2cvoD           VRIAVLGASGYTGAEIVRLLANHPQIKVMTADRKAGEQFGSVFPHLITQDLPNLVAVKDADFSNVDAVFC
3bywB           --ILGTLPANSEDAGARGLFVRANDDGLQITSHGELVLDLSKRELLPADATIAISATEDETTAGVERDVR
1c9kA           ---LVTGGARSGKSRHAEALIGDAPQVL------------------------------------------
3bywF           ---LGTLPANSEDAGARGLFVRANDDGLQITSHGELVLDLSKRELLPADATIAISATEDETTAGVERDVR
3ch6E           -KVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAVAQAGKLMGGLDML


                         .         .         *         .         .         .         .:140
query           FNLASPASPPVYTQRRVECLLINSEAVLQVAEFALEKGARLVQASTSEVYGDPLSHPQLEHHWGNVNPIG
1e7rA           LAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDNKLLFLGSSCIYPKLAKQPMAESELLQGTLEP
2b69A           SPASPPNYYNPIKTLKTNTIGTLNLG------LAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIG
1bsvA           LAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVKLLFLGSSCIYPKLAKQPMAESELLQGTLEP
3dbhC           FVEESPENLLDNDPSFFCRFTVVVATQLPESTSLRNSQIPLLICRTYGLVGYMRIIIKEHHPDNALEDLR
1e7qA           LAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVKLLFLGASCIYPKLAKQPMAESELLQGTLEP
1db3A           --AVSFESPEYTADVDAMGTLRLLEAIR---FLGLEKKTRFYQASTSELYGLVQEIPQKETT-----PFY
3c1oA           ISALPFPMISSQIH------IIN-------AIKAAGNIKRFLPSDFGCEEDRIKPLPPFESVL-------
1a9zA           GLKAVGESVQKP----LEYYDNNVNGTLRLISAMRAANVKNFIFSSAATVYG---DNPKIPYVESFPTGT
3dbrG           FVEESPENLLDNDPSFFCRFTVVVATQLPESTVLWNSQIPLLICRTYGLVGYMRIIIKEHPVI--ESHPD
2bllA           LPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYGMCSDKYFDEDHSNLIVGPV
2c5aB           LAADMGGMGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAWP
2c29D           FHVATPMDFESKDPENIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAGTVNIQEHQLPVYDESCWSRAKKM
2c54B           NLAADMGGMGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIFKQLETTNVSLKESDAWPAE
1bxkB           MHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTEDKKSAFRFHHISTDEVYGDLHSTDPYA
2c5aA           NLAADMGGMGFIQSNHSVIMYNNTMISFNMIEAARINGKRFFYASSACIYPEFKQLETTNVSESDAWPAE
2c5eA           NLAADMGGMGFIQSNHSVIMYNNTMISFNMIEAARINGIKFFYASSACIYPEFKQLETTNVKESDAWPAE
2cnbB           VHMCAFLAVGESVRDPLKNVVGILRLLQAMLLHKCD---KIIFSSSAAIFGNPTAEPIDINAKKSP----
1bxkA           MHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTEDKKSAFRFHHISTDEVYGDLHSTDPYA
1ek6B           IHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSATVYGNPQYLPLDEAHP----TGG
3dbrE           FVEESPENLLDNDPSFFCRFTVVVATQLPES-------TSLRLADVLWNSQIPLLICRTYGLVGYMRIII
1bwsA           LAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLFLGSSCIYPKLAKQPMAESELLQGTLEP
1a2zA           LAPTYSNITVERIAVNIIDARIPDNDGYQPIDEKIEEDAPLAMATLPVRAITKTLRDNGIPATI------
1e6uA           LAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVKLLFLGSSCIYPKLAKQPMAESELLQGTLEP
1e7sA           VYLAAAKVGGIVANNTYPADFIYQIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEP
2c29F           VFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAG--TVNIQEHQLPVYDESCWS
2c5eB           NLAADMGGMGFIQSNHSVIMYNNTMISFNMIEAARINGIKFFYASSACIYPEFKQLETTNVSLKESDAWP
1dihA           IDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQNVMLKLLEKAAKVMGDYTDIEIIEAHH----RHK
2c54A           LAADMGGMGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDPAE
1aorA           ------------------------------------------------GDAPPFRWGNTEVLHYYIEKIA
2axqA           ISLIPYTFHPNVVKSAIRTTSSYISPALRELEPEIVKAGITVMNEIGLDPGIDHLYAVKTIDEVHRAKSF
2a92A           AGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLFEHSGVPKNKIIG
1b8pA           LLVGARPRGPGMERKDLLEANAQIFTVQ-GKAIDAVASRNIKVLVVGNPANTNAYIAMKSAPS-----LP
3eheA           VWHIAANPDVRGAENPDEIYRNNVLATYRLLEAMRKGVSRIVFTSTSTVYGEAKVIPTPEDYPTHPIS--
2c59B           NLAADMGGMGFIQSNHSVIMYNNTMISFNMIEAARINGIKFFYASSACIYPEFKQLETTNVSLKESDAWP
3c4tA           LDYLITKDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYKYFKAVSPELFHVIDDFVKFQLE----KNEE
1civA           WALLIGAKPRGPGMERADLLDINGQIFAEQGKALNAVASPNVKVMVVGNPC---NTNALICLKNAPNIPP
3dxfA           FIVTNYWECSQEQEVKQGKLLADLARR----------------------LGLHYVVYSGLENIKKLTAGR
3d5tA           LLVGARPRSMERKDLLSANAEIFTVQGAALNEVAS---RDVKVLVVGNPANTNAYIAMKSAP-----DLP
2c20A           MHFAADSLVGVSMEKPLQYYNNNVYGALCLEVMDEFKVDKFIFSSTAATYGEVDVDLITEETMTNPTN--
2cnbC           ALEVGDVRNEDFLNGVFTDAVVHMCAFLAVGESVLQAMLLHKCDKIIFSSSAAIFGNPTAEPIDINAKKS
2c59A           LAADMGGMGFIQSSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAWPAE
1arzB           VTVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGK----QAIRDAAADI-AIV
2a92C           AGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLFEHSG-----VPK
1arzA           IDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQVMLKLLEKAAKVMGDYTDIEIIEAHHRHKV----
1e5lA           ISLIPYIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGIVMNEIGLDPGIDHLYAIKTIEE-----VHAA
3bohA           ----------------------------------------------------------------------
2blnA           FSFYYRHLIYDEILQLAPAGAFNHGSLLPKYRGR--APLNWVLVNGETETGVTLHRMVKRADAGAIVAQL
3e48A           SF-------------------KRIPEVENLVYAAKQSGVAHIIFIGYYADQHNNPFHSPYFGYASRLLST
1arzC           IDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQNVMLKLLEKAAKVMGDYTDIEIIEAHH----RHK
3bojA           ----------------------------------------------------------------------
3dbhG           ENLLDNDPSFFCRFTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHHPDNALEDLR
2cnbA           AFLAVGESV----RDPLKYYDNNVVGILRLLQAMLLHKCDKIIFSSSAIFGNPTNAEPIDINAKKSP---
3d5tC           VALLVGARPRSKGMERKDLLSANAEIFTVQGAALNEVASRVKVLVVGNPANTNAYIAMKSAP-----DLP
1c3vA           VGTTGFTAERFQQVESWLNTSVLIAPNFAIGAVLS----MHFAKQAARFFDSAEV-------IELHHPHK
3e48B           VVFIPSIIHPSFKRIP---------------------EVENLVYAAKQSGVAHIIFIGYYADQ-------
1c3xA           -------------------------------------------------------------------PPL
3d1lA           FAELLQGIVEGKREEALVHTAGSIPNVWEGHVPHYGVFYPQTFREVDFKEIPFFIEASSTEDAAFLKSLH
2a35B           TAFCCLGTTIKEAGSEEAFRAVDFDLPLAVGKRALEMGARHYLVVSALGADAKSSIF-------------
2cvoA           FCLPHGTTQEIIKGLPQELKIVDLSADFRLRDINEYAEWYGHSHRAPELQQEAVYGLT-EVLRNEIRNAR
2a35A           TAFCCLGTTIKEAGSEEAFRAVDFDLPLAVGKRALEMGAHYLVVSALGADAKS-----------------
1ds6B           PRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDD----DKQDHLSWEWNLS-------------------
1bdmA           DADYALLVGAAPLQVNGKIFTEQGRALAEVAK------KDVKVLVVGNPANTNALIAYKNAP-----GLN
1a9yA           IHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSAATVYGDQPKIPYVESF---PTGT
1ek5A           LQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGG
1bmdA           LVGAAGMERRDLLQVNGKIFTEQGRALAEVAK------KDVKVLVVGNPANTNALIA-----YKNAPGLN
2a92B           AGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLFEHSGVPKNKIIG
2dfdA           VVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCPEAMICVIANPVNSTIPITA--EVFKKHGVYN
3db2C           AEVIEQCARSGKHIYVEKPISVSLDHAQRIDQVIKETGV-------------KFLCGHSSRRLGALRKKE
2amfC           LKPLHFKQPIISMAAGISLQRLATFVGQDLPLLRIMPNNAQILQSSTALTGNALVSQELQARVRDL----
3e5mA           LNGAYATFIV-TNAWESCSQEQEVKQGKLLADLARRLGLHYVVYSGLENIKKLTAGRLAAAHF-------
3c3xA           VELMKKVDVVISALAVPQYLDQFKILEAIKVAG----------------NIKRFLPSDFGVEEDRINALP
3e5mB           ALNGAYATFIVTNAWESCSQEQEVKQGKLLADLARRLGLHYVVYSGLENIKKLTAGRLAAAHF-------
3dbhE           FVEESPENLLDNDPSFFCRFTVVVATQLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPDNA
2amfE           F----ETVLKPLHFKQPIISMAAGISLQRLATFVGQNMNAQILQSSTALTGNALVSQELQARVRDL----
2amfA           LKPLHFKQPIISMAAGISLQRLATFVGQDLPLLRIMPNMAQILQSSTALTGNALVSQELQARVRDLTDSF
2c82A           ---------------------------------------------------------------------G
3dxfB           IVTNSQEQEVKQGKLLADLARRLGLH-------------YVVYSGLENIK-----------KLTAGRLAA
1bdmB           DVAFKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALALVVGNPANTNALIAYKNAP-----GLN
3db2A           IEQCARSGKHIYVEK--------------PISVSLDHAQRIDQV--IKETGVKFLCGHSSRRLGALRKKE
3dr3A           ATAHEVSHDLAPQFLEAGCVVFDLSGAFRVNDATFYKYYGFTHQYPELLEQAAYGLAEWCGNKLKEANLI
2bkaA           FCCLGTTRGKAGAEGFVRVDRDYVLKSAE--LAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEE
2aefA           I-VDLESDSETIRKIDESVRIIAEAERYENIEQLRMAGAISPFVISGRLMSRSIDDGYEAMFVQDVLATR
3bywC           YTELES----------------------------------------------------------------
3bywH           VR--------------------------------------------------------------------
1bw3A           WDTVFTKIDTNGIGYQQGHLNVN-----------------------------------------------
3db2B           AEVIEQCA-----RSGKHIYVEK------PISVSLDHAQRIDQVIKE--TGVKFLCGHSSRRLGALRKKE
3bywD           VR--------------------------------------------------------------------
3c85C           LLAPHH------------------QGNQTALE-QLQRRNYKGQIAA--IAEYPDQLEGLLES--GVDAAF
2cvoD           LPHGTTQEIIKGLPQELKIVDLSADFRLRDINEYAEWYGHSHRAPELQQEAVYGLTEVLRNEIRNARLVA
3bywB           PI--------------------------------------------------------------------
1c9kA           ----------------------------------------------------------------------
3bywF           PI--------------------------------------------------------------------
3ch6E           ILNHITNTSLNLFHDDIHSMEVNFLSYVVLTVAALSNGSIVVVSSLAGKVAYP-----------------


                         +         .         .         .         .         *         .:210
query           ERSCYDEGKRFAEALLSAMRLEQGLNAGIIRIFNTYGPRMHPFDGRVISGFVRQALANEPLTVFGDGSQT
1e7rA           TNEPEAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNLRRFHEATAQSAPDVVVWGSGTPM
2b69A           PRACYDEGKRVAE--TCYAYKQEGVEVRVARIFNTFGPRHNDG--RVVSNFILQALQGEPLTVYGSGSQT
1bsvA           TNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPALLRRFHEATAQNAPDVVVWGSGTPM
3dbhC           LDKPFPELREHFQSYDDMDHSHTPWIVIIAKYLAQWYSETNG----RIPKTYKEKEDFRDLIRQGILKPE
1e7qA           TNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHSHVIPALLRRFHEATAQSAPDVVVWGSGTPM
1db3A           PRSPYAVAKLYAYWITVNYRESYGMYACNGILFNHESPRRGEFVTRKITRAIANIAQGLESCLYGNMDSL
3c1oA           ------EKKRIIRRAIEA----AALPYTYVSANCFGAYFVN-----YLLHPSPHPNRNDDIVIYGTGETK
1a9zA           PQSPFGKSKLMVEQILTDLQKAPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGDGTGV
3dbrG           NALEDLRLDKPFPELREHFQSYTPWIVIIAKYLAQWYSETNGTYKEKEDFRDLIRQGILEENFEEAIKNV
2bllA           NKPRWIYSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNARAITQLILNLVEGSPIKLIDGGKQK
2c5aB           AEPQDAFGKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGREAAFCRKAQTSTDRFEMWGDGLQT
2c29D           TAWMYFVSKTLAEQAAWKYAKENNIDFITIIPTLVVGPFIMS---SMPPSLITALSPITGNEAHYSIIRQ
2c54B           PQDAYGLERLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGRPAAFCRKAQTSTDRFEMWGDGLQT
1bxkB           PSSPYSASKASSDHLVRAWLRTYGLPTLITNCSNNYGPYHFPEK--LIPLMILNALAGKSLPVYGNGQQI
2c5aA           PQDAFGLEKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGRPAAFCRKAQTSTDRFEMWGDGLQT
2c5eA           PQDAYGLEKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGRPAAFCRKAQTSTDRFEMWGDGLQT
2cnbB           -ESPYGESKLIAERMIRDCAEAYGIKGICLRYFNACGAHEDGEHYQGSTHLIPIILGRVMSDIADKRMCV
1bxkA           PSSPYSASKASSDHLVRAWLRTYGLPTLITNCSNNYGPYHFPEKL--IPLMILNALAGKSLPVYGNGQQI
1ek6B           CTNPYGKSKFFIEEMIDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYEALNVFGDGTGV
3dbrE           KEHPVIESHPDNALEDLRLDKPFPELREHFQSYDLHTPW-----IVIIAKYLAQWYSETNGRIPKTYKEK
1bwsA           TNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNLRRFHEATAQNAPDVVVWGSGTPM
1a2zA           ----------------SYSAGTYLCNYVMFKTLHFSKIEGYPL---KAGFIHVPYTPDQVVNKFFLLGKN
1e6uA           TNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPALLRRFHEATAQKAPDVVVWGSGTPM
1e7sA           TNEPYAIARIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNLRRFHEATAQSAPDVVVWGSGTPM
2c29F           DMEFCRAKKMTAWMYFVSKTLAEQAAWKYAKENNIDFITIIPTMSSMPPSLITALSPITGNEAHYSIIRQ
2c5eB           AEPQDAYGKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGREAAFCRKAQTSTDRFEMWGDGLQT
1dihA           VDAPSGTALAMGEAIAHALDKDLKDCAVYSREGHTGERVPGTIGFTVRAGDIVGEHTAMFADIGERLEIT
2c54A           PQDAYGLERLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGRPAAFCRKAQTSTDRFEMWGDGLQT
1aorA           KR--EGFGDKLAEGSAESYGHPELSMTVKKLELPAYDPRGAEGHGYATNNRGGCHIKNVSDDKIKMLILF
2axqA           LSYCGGLPAPEDSDNPLGYKFSWSSRGVLLALRNSAKYWKDGKIETVSSEDLMATPYFIYPGYARDSTLF
2a92A           LGGVLD-----TSRLKYYISQKLNVCPRDVNALIVGAHG---NKMVLLKRYITVGGIPLQEFINNKKITD
1b8pA           AKNFTAMLRLDHNRALSQIAAKTGKPVSSIEKLFVWGNHSPTMYADYRYAQIDGASVKDM---INDDAWN
3eheA           ---LYGASKLACEALIESYCHTFDMQAWIYRFANVIGRRSTHG--VIYDFIMKLKRNPEELEILGNGEQN
2c59B           AEPQDAYGKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGAPAAFCRKAQTSTDRFEMWGDGLQT
3c4tA           DIEVPKAMGDIFESLAGAIYMDSGMSLEVVWQVYYPM----------MQPLIEKFSANVPR---SPVREL
1civA           KN-FHALTRLDENRAKCQLALKAGVFYDKVSNVTIWGNHSTTQ----VPDFLNAKIHGIPVTEVIRDRKW
3dxfA           LAAAHFDGKGEVEEYFRDIGVP----MTSVRLPCYFENLLSHFLPQKA------PDGKSYLLSLPTGDVP
3d5tA           KKNFTAMLRLDHNRALSQLAAKSGKPVASIEKLAVWGNH----SPTMYPDFRFATAEGESLLKLINDDVW
2c20A           ---TYGETKLAIEKMLHWYSQASNLRYKIFRYFNVAGATPNGIIGEDLIPLVLQVALGQREKIMMDGTCI
2cnbC           PESPYGESKLIAERMIRDCAEAYGIKGICLRYFNACGAHEDGDIGDIAPDTDKRMPIFGTDYPTPDGTCV
2c59A           PQDAYGLEKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGAPAAFCRKAQTSTDRFEMWGDGLQT
1arzB           FAANFSVGVNVMLKLLEKAAKVMGTDIEIIEAHHRHKVDAPSGTALAMGEAIAHALDKVYSREGHTGERV
2a92C           NKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLL--KRYITVGGIPLQEFINNKKITDE
1arzA           -DAPSGTALAMGEAIAHALDKDLKDCAVYSREGHTGERPGTIGFATVRAGDIVGEHTAMFADIGERLEIT
1e5lA           GGKIKTFLSYCGGLPAPESSDNPLGYKFSWSSRGVLLALRNAASFDGKVTNVAGPELMATAKPYFIYPGF
3bohA           --------------------------------------------MSLTPDQIVAALQERG----WQAEIV
2blnA           RIAIAPDDITLHHKLCHAARQLLEQTLPAIKHGNILEIAQRE---------NEATCFGRRTPDDSFLEWH
3e48A           SGIDY--TYVRAYDPLKPY------LPELNHKLIYPAGDGRINYITRNDIARGVIAIIKNPDTWGKRYLL
1arzC           VDAPSGTALAMGEAIAHALDKDLKDCAVYSREGHTGERVPGTIGFTVRAGDIVGEHTAMFADIGERLEIT
3bojA           ----------------------------------------------LTPDQIVAALQERG----WQAEIV
3dbhG           LDKPFPELREHFQSYDLDHDHSHTPIVIIAKYLAQWYSETNGRIPKDFRDLIRQGILKDEENFEEAIKNV
2cnbA           -ESPYGESKLIAERMIRDCAEAYGIKGICLRYFNACGAHEDGDIGEHIAPDDKRMPIFGTDYPTPDGTCV
3d5tC           KKNFTAMLRLDHNRALSQLAAKSGKPVASIEKLAVWGNHSPTMYPD----FRFATAEGESLLKLINDDVW
1c3vA           ADAPSGTAARTAKLIAEARKGLPPNP--DATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGTEGET
3e48B           ---HNNPFHSPYFGYASRLLSTSGIDYTYVRAYDPLKPYLPELNHKLIYPAGDG---------------R
1c3xA           DTDPFLVARAAADHIAQATVEGHDMALVLGSGWGGAAELLGEVVAERSIRVERADGSVRHALVLGSRTHL
3d1lA           LAAVFTCNFTNHYALAAELLKKYNLPFDVLPLIDETARKVHE--------LEPKTAQTGPAIRYDENVIG
2a35B           ----YNRVKGELEQALQEQG---WPQLTIARPSLLFGPREEFRLAE----ILAAPIPGKYHGIEAEEGKG
2cvoA           LVANPGCYPTSIQLPLVPLIKAKLIKVSNIIIDAKSGVSGAGRGAKEANLYTEIAEGIHAYGIKGHRHVP
2a35A           -SIFYNRVKGELEQAL---QEQGWPQLTIARPSLLFGPREEFR----LAEILAAPIAGKYHGIEAEEGKG
1ds6B           ----------------------------------------------------------------------
1bdmA           PRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVW----GNHSSIMFPDLFHAEVDGRPALLVDMEWYE
1a9yA           PQSPFGKSKLMVEQILTDLQKAQPWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGDGTGV
1ek5A           CTNPYGKSKFFIEEMIRDLCQADKTNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREAL
1bmdA           PRNFTAMTRLDHNRAKAQLAKKTGTGV----DRIRRMTVWGNHSSTMFPDLFHAEVDGRPALELVDMEWE
2a92B           LGGVLD-TSRLKYYISQKLN-----VCPRDVNALIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDEE
2dfdA           PNKIFGVTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQ-
3db2C           IDTKEIGEVSSIEAVFSNER-GLELKKGNWRGEPATAPGGPLTQLGVHQIDNLQFLLGPVARVFNFGKPY
2amfC           -TDSFGSTFDISEKDFDTFTALAGSSPAYIYLFIEALAKLEIVTQTVLASASNLKTSSQSPHDFIDAICS
3e5mA           ----------DGKGEVEEYFRDIGVPMTSVRLPCYFENLLSHF------LPQKAPDGKSYLLSLPTGDVP
3c3xA           PFEALIERKRMIRRAIEEANIP------------YTYVSANCFASYFINYLLRPYDPKDEITVYGTGEAK
3e5mB           ------DGKGEVEEYFRDIGVPMTSV----RLPCYFENLLSHF------LPQKAPDGKSYLLSLPTGDVP
3dbhE           LEDLRLDKPREHFQSYDLDHEKKDHSPWIVIIAKYLAQWYSETNGR------------------------
2amfE           -TDSFGSTFDISEKDFDTFTALAGSSPAYIYLFIEALAVKNGIPKAKALEIVTQTTSSQSPHDFIDSPGG
2amfA           GSTFDIAGSSPAYIYLFIEALAKAGVKNGIPKAKVTQTVLASASNLKTSSQSPHDFIDAI-----CSPGG
2c82A           IPYDRIDVVVHPQSIISMVTFIDGSTIAQASPPDMKLPISLAL-----GWPRRVSGAAAACDFHTASSWE
3dxfB           A-------HFDGKGEVEEYFRDIGVPMTSVRLPCYFENLLSHFL------PQKAPDGKSYLLSLPTGDVP
1bdmB           PRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHSSIMFPD----LFHAEVDGRPALELVDMEWE
3db2A           IDTKEIGEVSSIEAVFSNERGLELKKGNWRGEPATAPGGPLTQLG-VHQIDNLQFLLGPVARVFNFGKPY
3dr3A           AVPGC-----------------------------------------------------------------
2bkaA           LKFDR---------------------YSVFRPGVLLCDRQESRPG--------EWLVRKFFGSLPDSWAS
2aefA           RMVEVPIPEGSKLEGVSVLDADIHDVTGVIIIGVGRG------DELIIDPPRDYSFAGDIILGIGKPEEI
3bywC           ----------------------------------------------------------------------
3bywH           ----------------------------------------------------------------------
1bw3A           ----------------------------------------------------------------------
3db2B           IDTKEIGEVSSIEAVFSNERGLELKKGNWRGEPATAPGGPL-TQLGVHQIDNLQFLLGPVARVFNFGKPY
3bywD           ----------------------------------------------------------------------
3c85C           -NIYSEAGSGFARHVCKQLEPQ------------------------------------------------
2cvoD           NPGCYPTSIQLPLVPLIKAKLIKVSNIIIDAKSGVSGAGRGAKE--------------------------
3bywB           ----------------------------------------------------------------------
1c9kA           ----------------------------------------------------------------------
3bywF           ----------------------------------------------------------------------
3ch6E           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RSFCYVSDLVRGLWLMGNSNQPGPINLGNPIEQTVLSMAHLIKESTNSESSITFEPLPSDDPVRRRPDIS
1e7rA           REFLHVDDMAASIHVMELAHEVWLENTQPMLSHTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVT
2b69A           RAFQYVSDLVNGLV-ALNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIK
1bsvA           REFLHVDDMAAASILENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVT
3dbhC           DEENFEEAIKNVTALNTTQIPSSIEDIFNDDRCINITKQTPSFWILARALKEFVAKEGQGNLPVRGSGKY
1e7qA           REFLHVDDMAAAIHVMELAHEVWLENTQPMLSHTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVT
1db3A           RDWGHAKDYVKMQWMMLQQEQPEDFVIATGVQYSVRQFVEMAAAQLGIKLRFEGTGVEEKGIVVSVTDPT
3c1oA           FVLNYEEDIAKYTIKVACDPRCCNIYRPPKNIISQNELISLWEAKSGLSFKKVHMP---------DEQLV
1a9zA           RDYIHVMDLADGHVVAMEKLANKPGVHGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADAS
3dbrG           NTALNTTQIPSSIEDIFNDDRCIITKQTPSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQ
2bllA           RCFTDIRDGIEALYRIIENAGNRCNIGNPENEASIEELGEMLLASFEKHPLRHHFPPFAGFRVVRKPSIR
2c5aB           RSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEMVLSFEEKKLPIHHIP-GPEGVRGRNSDNN
2c29D           GQFVHLDDLCNAHIYLFENPKAEGRYICSSHDCIILDLAKMLREKYPEYNIPTEFKGV-DENLKSVCFSS
2c54B           RSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEMVLSFEEKKLPIHHIPGP-EGVRGRNSDNN
1bxkB           RDWLYVEDHARALYCVATTGKVGETNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLIYAIDAS
2c5aA           RSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEMVLSFEEKKLPIHHIP-GPEGVRGRNSDNN
2c5eA           RSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEMVLSFEEKKLPIHHIPGPEGVR-GRNSDNN
2cnbB           RDYVHVCDLASAHILALDYVEKLVFNLGTSRGYSVREVIEVARKTTGHPIPVRECGRREGDPAYLVAASD
1bxkA           RDWLYVEDHARALYCVATTGKVGEYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLRYAIDAS
1ek6B           RDYIHVVDLAKGHIAALEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPS
3dbrE           EDFRDLIRQG------------------------------------------------------------
1bwsA           REFLHVDDMAAASIHVMELAHEVWLNVGTGVDCTIRDLAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVT
1a2zA           TPSMCLEAEIKAIELAVKVSLDYLEKDRDDI---------------------------------------
1e6uA           REFLHVDDMAAASIVMELAHEVWLENTQPMLSHINVGTGVDCTIRELYKGRVVFDASKPDGTPRKLLDVT
1e7sA           REFLHVDDMAAAIHVMELAHEVWLENTQPMLSHINVGTGVDCAKVVGYKGRVVFDASKPDGTPRKLLDVT
2c29F           GQFVHLDDLCNAHIYLFENPKAEGRYICSSHDCIILDLAKMLREKYPEYNIPTEFKGVDENL-KSVCFSS
2c5eB           RSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEMVLSFEEKKLPIHHIPGP-EGVRGRNSDNN
1dihA           HKASSRMTFANGAVRSALSGKESGLDMRDVLDLNNL----------------------------------
2c54A           RSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEMVLSFEEKKLPIHHIPGP-EGVRGRNSDNN
1aorA           QDLTALIDSAGLCLFTTFGLGADDYNAALGWDFTTEDYLKIGERIWNAERLFNLKAGLDDDTLPKRFLEE
2axqA           KDLYHIPEAETVIRTLRYQGFPEFVKALVDMGMLKDDANEIFSKPIAWNEALKQ--YLGAKSTSKEDLIA
2a92A           EEVEGIFDRTVNTAL---EIVNLLASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGHSNIFGGTP
1b8pA           RDTFLPTVGKRGAAII---DARGVSSAASAANAAIDHIHDWVGTAGKWTTMGIPSDGSYGIPEGVIFGFP
3eheA           KSYIYISDCVDAMLFGLRGDERVIFNIGSEDQIKVKRIAEIVCEEL---------GLSPRFRFTMLLSIE
2c59B           RSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEMVLSFEEKKLPIHHIPGPEGVR-GRNSDNN
3c4tA           LEMEPETAKFSPAERT------------------------------------------------------
1civA           LEDEFTNMVQTRGGVLIKKWGRSAASTAVSIVDAIRSLVTPTPEGDWFSTGVYTNGNPYGIAEDIVFSMP
3dxfA           MDGMSVSDLGPVVLSLLKEKYVGQNIGLSTCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFPGPDR
3d5tA           NRDTFIPTVGKRGAAI------------------------------------------------------
2c20A           RDYIHVEDLVAAHFLGLKDLQNDFYNLGNGNGFSVKEIVDAVREVTNHEIPAEVAPRRAGDPARLVASSQ
2cnbC           RDYVHVCDLASAHILALDYVEKLVFNLGTSRGYSVREVIEVARKTTGHPIPVRECGRREGDPAYLVAASD
2c59A           RSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEMVLSFEEKKLPIHHIPGPEGVR-GRNSDNN
1arzB           PGTIGFATVRAGDIVGEHTAMFADTHKASSRMTFANGAVRSALWLSGKESGLFDMRLDLNN---------
2a92C           EVEGIFDRTVNTALEIVN----LLASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGHTPLVIGGT
1arzA           HKASSRMTFANGAVALWLSGKESGLDMRDVLDLNNL----------------------------------
1e5lA           AFVAYPNRDSTPYKERYQIPEADNIVRGTLRYQGFPQFIKVLVDIGFLSDEEQPFLKEAIPWKEATQKIV
3bohA           TEFSLLNEMVDVDPQGCGPKMPGGIAIAHNRGVTTLEGLKQITKEVASKGHHGDHSSDMLGCGFFKLWVT
2blnA           KPASVLHNMVRAVADP----WPGAFSYVGNQKFTVWSSRVHPHASKAQPGSVI------SVAPLLIACGD
3e48A           SGYSYDKELAAILSE----------ASGTEIKYEPVSLETFAEYDEPKGFGALLASYHAGARGLLDQESN
1arzC           HKASSRMTFANGAVRSALWLSSGLFDMRDVLDLNNL----------------------------------
3bojA           TEFSLLNEMVDVDPQGCGPKMPGGIAIAHNRGVTTLEGLKQITKEVASKGHHGDHSSDMLGCGFFKLWVT
3dbhG           NTALNTTQIPSSIEDIFNDDRCINIVAKEGQGNLPVRGTMIADSGKYIKLQNVYREKAKKDAAAVGNHVA
2cnbA           RDYVHVCDLASAHILALDYVEKLVFNLGTSRGYSVREVIEVARKTTGHPIPVRECGRREGDPAYLVAASD
3d5tC           NRDTFITVGKRGAAIIEARGLSSAASAANAAIDHVRD--WVLGTNGKWVTMGIPSDGSYGIPEDIIYGVP
1c3vA           HDSLDRTSFVPGVLLAIAERPGLTVGLEPLLD--------------------------------------
3e48B           INYITRNDIARGVIAIIKNPDTWGKRYLLSGYSYDKELAAILSEASGTGFGALLASYHAGARGLLDQESN
1c3xA           YEGKGVRAVVHGVRTAAATGAETLIEWGAGTPVLLSDHINLTARSPLEGPTFVDLTDVYSPRLRELAHRV
3d1lA           NHLRLADDPAQRLYE-------------------------------------------------------
2a35B           VRFVESDELRK-----------------------------------------------------------
2cvoA           EIEQGLSEAAESKVTISFTPNLICMKRGMQSTMFVEMAPGVTANDLYQHLKSTYEGEEFVKLLNGSSVPH
2a35A           VRFVESDELRK-----------------------------------------------------------
1ds6B           ----------------------------------------------------------------------
1bdmA           KVFIPT----------------------------------------------------------------
1a9yA           RDYIHVMDLADGHVVAMEKLANKPYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADAS
1ek5A           NVFGNDYDTEDGTGVRDEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPS
1bmdA           KVFIPT----------------------------------------------------------------
2a92B           VEGIFDRTVNTALEIVN-----LLASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGHSNIFGGTP
2dfdA           -----EAGTEVVKAKAGAGSATLSMAYAGAR-----FVFSLVDAMNGKEGVVECSFVKSQETECTYFSTP
3db2C           TEVENITVNQTLLEFEDGKQAYLGTNWACPGVFSINVYGTKANLFYQLDFSWWSNSDVTDEHSTLIKREF
2amfC           PGGTGLMELERLGLTATVSSAIDKIDKAKSL---------------------------------------
3e5mA           MDGMSVSDLGPVVLSLMPEKYVGQNIGLSTCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFPGPDR
3c3xA           FAMNYEQDIGLYVATDPRALNRVVIYRPSTNIITQLELISRWEKKENIPIAILHCLFIDGA-TMSYDFKE
3e5mB           MDGMSVSDLGPVVLSLLKMPEKYVGIGLSTCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFPGPDR
3dbhE           ----------------------------------------------------------------------
2amfE           TTIAGLMELERLGLTATVSSAIDK----------------------------------------------
2amfA           TTIAGLMELERLGLTATVSSAIDKIDKAKSL---------------------------------------
2c82A           --FEPLDTDVFPAVLARQAGVAGGCAAFLAGRIGFPAIVGIIADVLHAADQWAVEPATVDD---------
3dxfB           MDGMSVSDLGPVVLSLLKMPEKYVGQNIGLSTCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGRDLA
1bdmB           KVFIPT----------------------------------------------------------------
3db2A           TEVENITVNQTLLEFEDGKQAYLGTNWACPGVFSIVYGTKANLFYQLDFSWWSNSDVTDEHSTLIKREFA
3dr3A           ----------------------------------------------------------------------
2bkaA           GHSVPVVTVVRALNNVVRPRDKQMELLENKAIHDL-----------------------------------
2aefA           ERL-------------------------------------------------------------------
3bywC           ----------------------------------------------------------------------
3bywH           ----------------------------------------------------------------------
1bw3A           ----------------------------------------------------------------------
3db2B           TEVENITVNQTLLEFEDGKQAYLGTNWACPGVFSI--NVYGTKANLFYQLDFSWWSNSDVTDEHSTLIKR
3bywD           ----------------------------------------------------------------------
3c85C           ----------------------------------------------------------------------
2cvoD           ----------------------------------------------------------------------
3bywB           ----------------------------------------------------------------------
1c9kA           ----------------------------------------------------------------------
3bywF           ----------------------------------------------------------------------
3ch6E           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KAKELLGWEPLVGIDVGLREVINWQIETQRTYAEKIS
1e7rA           RLHQ-LGWYHEISLEAGLASTYQWFLENQ--------
2b69A           KAKL-LGWEPVVPLEEGLNKAIHYFRKELEYQA----
1bsvA           RLHQ-LGWYHEISLEAGLASTYQWFLENQDRF-----
3dbhC           IKLQNVYREKAKKDAAAVGNHVAK-------------
1e7qA           RLHQ-LGWYHEISLEAGLASTYQWFLENQ--------
1db3A           KAHEKLGWKPEITLREMVSEMVANDLEAAKKHS----
3c1oA           RLSQELPQPQNIPVSILHSIFVKGDLM----------
1a9zA           KADRELNWRVTRTLDEMAQDTWHWQSR----------
3dbrG           NVYREKAKKDAAAVGNHVAKLLQSIGQAPESISE---
2bllA           NAHRCLDWEPKIDMQETIDETLDFFLRTVDLT-----
2c5aB           LIKEKLGWAPNMRLKEGLRITYFWIKEQIEKEKAKGS
2c29D           KKLTDLGFEFKYSLEDMFTGAVDT-------------
2c54B           LIKEKLGWAPNMRLKEGLRITYFWIKEQIEKEKAKGS
1bxkB           KIARELGCVPQETFESGMRKTVQWYLANESWWKQ---
2c5aA           LIKEKLGWAPNMRLKEGLRITYFWIKEQIEKEKAKGS
2c5eA           LIKEKLGWAPNMRLKEGLRITYFWIKEQIEKEKAKGS
2cnbB           KAREVLGWKPKYDTLEAIMETSWKFQRTHP-------
1bxkA           KIARELGCVPQETFESGMRKTVQWYLANESWWKQVQD
1ek6B           LAQEELGWTAALGLDRMCEDLWRWQKQNPSGFG----
3dbrE           -------------------------------------
1bwsA           RLHQ-LGWYHEISLEAGLASTYQWFLENQ--------
1a2zA           -------------------------------------
1e6uA           RLHQL-GWYHEISLEAGLASTYQWFLENQ--------
1e7sA           RLHQ-LGWYHEISLEAGLASTYQWFLENQ--------
2c29F           KKLTDLGFEFKYSLEDMFTGAVDTCRA----------
2c5eB           LIKEKLGWAPNMRLKEGLRITYFWIKEQIEKEKAKGS
1dihA           -------------------------------------
2c54A           LIKEKLGWAPNMRLKEGLRITYFWIKEQIEKEKAKGS
1aorA           PMPEGPNKGHTVRLKEMLPRYYKLRGWTEDGKKEKL-
2axqA           SIDSKATWKDDEDRERILSGFAWLGLF----------
2a92A           LVIGGTGVEQVIELQLKFDEAVAETKRMKA-------
1b8pA           VTTENGEYKIVQGLSIRINVTLNELLEEQNGVQH---
3eheA           KLKR-LGWKPRYNSEEAVRMAVRDLVE----------
2c59B           LIKEKLGWAPNMRLKEGLRITYFWIKEQIEKEKAKGS
3c4tA           -------------------------------------
1civA           CRSKGDGDYEFVKDVIKIKKSEDELLAEKKCVAHLT-
3dxfA           DIELTLRLNPALTLDQWLEQHKGD-------------
3d5tA           -------------------------------------
2c20A           KAKEKLGWDPYVNVKTIIEHAWNWHQKQPNGYEK---
2cnbC           KAREVLGWKPKYDTLEAIMETSWK-------------
2c59A           LIKEKLGWAPNMRLKEGLRITYFWIKEQIEKEKAKGS
1arzB           -------------------------------------
2a92C           GVEQVIELQLNAEEKTKFDEAVAETKRMK--------
1arzA           -------------------------------------
1e5lA           KASSASEQDIVSTIVSNATFESTEEQKRIV-------
3bohA           GRFDDMGYPRPQFDADQGAKAVENAGG----------
2blnA           GALEIVTGQAGDGITMQGSQLAQ--------------
3e48A           DFKQLVNDQP-QTLQSFLQE-----------------
1arzC           -------------------------------------
3bojA           GRFDDMGYPRPQFDADQGAKAVENAGG----------
3dbhG           KLLQSIGQAP---------------------------
2cnbA           KAREVLGWKPKYDTLEAIMETSWK-------------
3d5tC           VICENGEYKRVEGLEIKMDGTLAELLEERDGVAH---
1c3vA           -------------------------------------
3e48B           DFKQLVNDQP-QTLQSFLQENI---------------
1c3xA           DPTLPEGVYAQFPGPHYETPAEVRMAGIL--------
3d1lA           -------------------------------------
2a35B           -------------------------------------
2cvoA           TRHVVGSNYCFMNRIPGRAIIISVIDNLVKGASGQ--
2a35A           -------------------------------------
1ds6B           -------------------------------------
1bdmA           -------------------------------------
1a9yA           KADRELNWRVTRTLDEMAQDTWHWQSR----------
1ek5A           LAQEELGWTAALGLDRMCEDLWRWQKQ----------
1bmdA           -------------------------------------
2a92B           LVIGGTGVEQVIELQLKFDEAVAETKRMK--------
2dfdA           LLLGKKGIEKNLGVSSFEEKMISDAIPELKASIKKG-
3db2C           ANRILRDVKVDFESVDHLRVEV---------------
2amfC           -------------------------------------
3e5mA           DIELTLRLNPALTLDQWLEQHKGD-------------
3c3xA           NDVEASTLYPELKIDELLDIFVHDPPPPASA------
3e5mB           DIELTLRLNPALTLDQWLEQHKGDF------------
3dbhE           -------------------------------------
2amfE           -------------------------------------
2amfA           -------------------------------------
2c82A           -------------------------------------
3dxfB           NMFRFYALRPDRDIELTLRLNPKA-LTLDQWLEQ---
1bdmB           -------------------------------------
3db2A           SNRILRDVKVDFESVDHLRVEV---------------
3dr3A           -------------------------------------
2bkaA           -------------------------------------
2aefA           -------------------------------------
3bywC           -------------------------------------
3bywH           -------------------------------------
1bw3A           -------------------------------------
3db2B           EFAILRDVKVDFESVDHLRVEV---------------
3bywD           -------------------------------------
3c85C           -------------------------------------
2cvoD           -------------------------------------
3bywB           -------------------------------------
1c9kA           -------------------------------------
3bywF           -------------------------------------
3ch6E           -------------------------------------