[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF53734.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3e5yA.bssp"
#ERROR : Can't open dsspfile "3e5yB.bssp"
#ERROR : Can't open dsspfile "3dcmX.bssp"

## Summary of PDB Search
:157
    3e-25  48%  3e5yA  [x.x.x] TRMH FAMILY RNA METHYLTRANSFERASE
    1e-24  45%  3e5yB  [x.x.x] TRMH FAMILY RNA METHYLTRANSFERASE
    1e-23  10%  3dcmX  [x.x.x] UNCHARACTERIZED PROTEIN TM_1570
:157

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxEHPLHVIFDNPVIPPNTGNAIRMCAGTGAHLHLVEPLGFELTEKHLRRAGLDYHDLADVTVHATFDEA
3e5yA           -----FNVVLVEPEIPPNTGNVIRLCANTGARLHLIEPLGFPLDDAKMRRAGLDYHEYAQMRVHRDWDAF
3e5yB           -----FNVVLVEPEIPPNTGNVIRLCANTGARLHLIEPLGFPLDQMRVHRDWDAFVA------------A
3dcmX           --KGKDGSIISTAVTNLDVHDIARTARTYNLKYYIVTNLRAQQDMVSKMLKFWREGFGSRYNPSRYLEDV


                         .         .         *         .         .         .         .:140
query           MAAVPGRVXXXXXXXXXXXXXXXFEPGDALLFGTEPTGLPQEHVEHSRITSELRIPMLPGRRSMNLSNSA
3e5yA           VAAEAARMFAFTTRGSGRFHDRAFEPGDWFVFGAETRGLAPALVDRFAPEQRVRLPMRPGNRSLNLSNTV
3e5yB           EAPDPARMFAFTTRGSGRFHDRAFEPGDWFVFGAETRGLAPALVDRFAPEQRVRLPMRPGNRSLNLSNTV
3dcmX           LEDISAKKRENDISFEEGRRIIIETEKPVLILLGTGWGLPDEILEISDYVL-EPIRAQSDFNHLSVRAAA


                         +         .         .         .         .         *         .:210
query           AVATYEAWRQLGFVGGx
3e5yA           AVVVFEAWRQAGFEGG-
3e5yB           AVVVFEAWRQAGFEGG-
3dcmX           AIIIDRLIGE-------