[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF53991.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c73A.bssp"
#ERROR : Can't open dsspfile "3c71A.bssp"
#ERROR : Can't open dsspfile "2b7jA.bssp"
#ERROR : Can't open dsspfile "3c73B.bssp"
#ERROR : Can't open dsspfile "3cynC.bssp"
#ERROR : Can't open dsspfile "2b7kA.bssp"
#ERROR : Can't open dsspfile "2e2mD.bssp"
#ERROR : Can't open dsspfile "1e2yF.bssp"
#ERROR : Can't open dsspfile "1e2yD.bssp"
#ERROR : Can't open dsspfile "1e2yH.bssp"
#ERROR : Can't open dsspfile "3cmiA.bssp"
#ERROR : Can't open dsspfile "2b5xA.bssp"
#ERROR : Can't open dsspfile "2b7kB.bssp"
#ERROR : Can't open dsspfile "1e2yA.bssp"
#ERROR : Can't open dsspfile "1e2yE.bssp"
#ERROR : Can't open dsspfile "2b7jB.bssp"
#ERROR : Can't open dsspfile "2cv4D.bssp"
#ERROR : Can't open dsspfile "2e2mA.bssp"
#ERROR : Can't open dsspfile "2e2gA.bssp"
#ERROR : Can't open dsspfile "3cynB.bssp"
#ERROR : Can't open dsspfile "2e2mC.bssp"
#ERROR : Can't open dsspfile "2cvbA.bssp"
#ERROR : Can't open dsspfile "2cv4A.bssp"
#ERROR : Can't open dsspfile "1eejA.bssp"
#ERROR : Can't open dsspfile "1e2yC.bssp"
#ERROR : Can't open dsspfile "2bmxA.bssp"
#ERROR : Can't open dsspfile "3e0uA.bssp"
#ERROR : Can't open dsspfile "2e2gB.bssp"
#ERROR : Can't open dsspfile "1e2yG.bssp"
#ERROR : Can't open dsspfile "2bmxB.bssp"
#ERROR : Can't open dsspfile "2cv4E.bssp"
#ERROR : Can't open dsspfile "1e2yB.bssp"
#ERROR : Can't open dsspfile "2ec4A.bssp"
#ERROR : Can't open dsspfile "3c7mA.bssp"
#ERROR : Can't open dsspfile "2cx3B.bssp"
#ERROR : Can't open dsspfile "2e2mH.bssp"
#ERROR : Can't open dsspfile "2b1kA.bssp"
#ERROR : Can't open dsspfile "3dwvA.bssp"
#ERROR : Can't open dsspfile "3drnA.bssp"
#ERROR : Can't open dsspfile "2e2gC.bssp"
#ERROR : Can't open dsspfile "3cynA.bssp"
#ERROR : Can't open dsspfile "2cx3A.bssp"
#ERROR : Can't open dsspfile "2b5eA.bssp"
#ERROR : Can't open dsspfile "3drnB.bssp"
#ERROR : Can't open dsspfile "2c0dB.bssp"
#ERROR : Can't open dsspfile "3boaA.bssp"
#ERROR : Can't open dsspfile "3dvxB.bssp"

## Summary of PDB Search
:160
    2e-11  25%  3c73A  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    1e-10  25%  3c71A  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    6e-10  13%  2b7jA  [x.x.x] SCO1 PROTEIN
    7e-10  22%  3c73B  [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
    1e-09  14%  3cynC  [x.x.x] PROBABLE GLUTATHIONE PEROXIDASE 8
    2e-09  13%  2b7kA  [x.x.x] SCO1 PROTEIN
    4e-09  14%  2e2mD  [x.x.x] PROBABLE PEROXIREDOXIN
    5e-09  14%  1e2yF  [c.47.1] TRYPAREDOXIN PEROXIDASE
    5e-09  13%  1e2yD  [c.47.1] TRYPAREDOXIN PEROXIDASE
    7e-09  14%  1e2yH  [c.47.1] TRYPAREDOXIN PEROXIDASE
    1e-08  13%  3cmiA  [x.x.x] PEROXIREDOXIN HYR1
    1e-08  20%  2b5xA  [x.x.x] YKUV PROTEIN
    2e-08  13%  2b7kB  [x.x.x] SCO1 PROTEIN
    4e-08  16%  1e2yA  [c.47.1] TRYPAREDOXIN PEROXIDASE
    7e-08  16%  1e2yE  [c.47.1] TRYPAREDOXIN PEROXIDASE
    1e-07  14%  2b7jB  [x.x.x] SCO1 PROTEIN
    1e-07  16%  2cv4D  [x.x.x] PEROXIREDOXIN
    2e-07  11%  2e2mA  [x.x.x] PROBABLE PEROXIREDOXIN
    3e-07  14%  2e2gA  [x.x.x] PROBABLE PEROXIREDOXIN
    4e-07  15%  3cynB  [x.x.x] PROBABLE GLUTATHIONE PEROXIDASE 8
    6e-07  15%  2e2mC  [x.x.x] PROBABLE PEROXIREDOXIN
    6e-07  20%  2cvbA  [x.x.x] PROBABLE THIOL-DISULFIDE ISOMERASE/THIOREDOXIN
    6e-07  16%  2cv4A  [x.x.x] PEROXIREDOXIN
    7e-07  10%  1eejA  [d.17.3 - c.47.1] THIOL:DISULFIDE INTERCHANGE PROTEIN
    8e-07  14%  1e2yC  [c.47.1] TRYPAREDOXIN PEROXIDASE
    8e-07  10%  2bmxA  [x.x.x] ALKYL HYDROPEROXIDASE C
    8e-07  14%  3e0uA  [x.x.x] GLUTATHIONE PEROXIDASE
    1e-06  15%  2e2gB  [x.x.x] PROBABLE PEROXIREDOXIN
    1e-06  15%  1e2yG  [c.47.1] TRYPAREDOXIN PEROXIDASE
    4e-06   9%  2bmxB  [x.x.x] ALKYL HYDROPEROXIDASE C
    7e-06  16%  2cv4E  [x.x.x] PEROXIREDOXIN
    9e-06  16%  1e2yB  [c.47.1] TRYPAREDOXIN PEROXIDASE
    2e-05  11%  2ec4A  [x.x.x] FAS-ASSOCIATED FACTOR 1
    2e-05  11%  3c7mA  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBA-LIKE
    2e-05  18%  2cx3B  [x.x.x] BACTERIOFERRITIN COMIGRATORY PROTEIN
    3e-05  15%  2e2mH  [x.x.x] PROBABLE PEROXIREDOXIN
    4e-05  17%  2b1kA  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBE
    4e-05  13%  3dwvA  [x.x.x] GLUTATHIONE PEROXIDASE-LIKE PROTEIN
    5e-05  23%  3drnA  [x.x.x] PEROXIREDOXIN, BACTERIOFERRITIN COMIGRATORY
    7e-05  13%  2e2gC  [x.x.x] PROBABLE PEROXIREDOXIN
    7e-05  16%  3cynA  [x.x.x] PROBABLE GLUTATHIONE PEROXIDASE 8
    8e-05  18%  2cx3A  [x.x.x] BACTERIOFERRITIN COMIGRATORY PROTEIN
    1e-04  10%  2b5eA  [x.x.x] PROTEIN DISULFIDE-ISOMERASE
    4e-04  25%  3drnB  [x.x.x] PEROXIREDOXIN, BACTERIOFERRITIN COMIGRATORY
    6e-04   8%  2c0dB  [x.x.x] THIOREDOXIN PEROXIDASE 2
    7e-04  10%  3boaA  [x.x.x] PROTEIN DISULFIDE-ISOMERASE
    0.001  13%  3dvxB  [x.x.x] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBA
:160

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxLDNAPLLELDVQEWVNHEGLSNEDLRGKVVVVEVFQMLCPGCVNHGVPQAQKIHRMIDESQVQVIGL
3c73A           ------APNFVL---EDTNGKRIELSDLKGKGVFLNFWGTWCEHCKKE-FPYMANQYKHFKSQGVEIVAV
3c71A           ------APNFVLEDT---NGKRIELSDLKGKGVFLNFWGTWCPHCKKE-FPYMANQYKHFKSQGVEIVAV
2b7jA           ------GGPFHL---EDMYGNEFTEKNLLGKFSIIYFGFSNCPDICPDELDKLGLWLNTLSSKYGITLQP
3c73B           ------APNFVLEDT---NGKRIELSDLKGKGVFLNFWGTWCEHCKKE-FPYMANQYKHFKSQGVEIVAV
3cynC           ----NSFYAFEV---KDAKGRTVSLEKYKGKVSLVVNVASDCQLTDRN-YLGLKELHKEFGPSHFSVLAF
2b7kA           ----SLGGPFHL---EDMYGNEFTEKNLLGKFSIIYFGFSNCDICPDE-LDKLGLWLNTLSSKYGITLQP
2e2mD           ----ERFPEMEVTTDH-GVIKLPDHYVSQGKWFVLFSHPADFTPVTTE-FVSFARRYEDFQRLGVDLIGL
1e2yF           ------APEFDDALPN-GTFKKVSLSSYKGKYVVLFFYPDFTFVC-PTEIIQFSDDAKRFAEINTEVISC
1e2yD           ----HPAPEFDDALPN-GTFKKVSLSSYKGKYVVLFFYPDFTFVCPT----EIIQFSDDAKRFAEINTEV
1e2yH           ------APEFDDALPN-GTFKKVSLSSYKGKYVVLFFYPDFTFVCPTE-IIQFSDDAKRFAEINTEVISC
3cmiA           ------FYKLAPVDK---KGQPFPFDQLKGKVVLIVNVASKCGFTPQYK-ELEALYKRYKDEGFTIIGFP
2b5xA           ------MPELTGEKAW-LNGEVTREQLIGEKPTLIHFWSISCHLCKEA-MPQVNEFRDKYQDQLNVVAVH
2b7kB           ---------------HLEDMYGFTEKNLLGKFSIIYFGFSNCPDICPDELDKLGLWLNTLSSKYGITLQP
1e2yA           ------APEFDDALPNG-TFKKVSLSSYKGKYVVLFFYPDFTFVCPTE-IIQFSDDAKRFAEINTEVIS-
1e2yE           ------APEFDDALPNG-TFKKVSLSSYKGKYVVLFFYPDFTFVCPTE-IIQFSDDAKRFAEINTEVISC
2b7jB           ------GGPFHL---EDMYGNEFTEKNLLGKFSIIYFGFSCPDICPDE-LDKLGLWLNTLSSKYGITLQP
2cv4D           -------------------------YVSQGKWFVLFSHPADFTPVTTE-FVSFARRYEDFQRLGVDLIGL
2e2mA           ----ERFPEMEVTTDH-GVIKLPDHYVSQGKWFVLFSHPADFTPVTTE-FVSFARRYEDFQRLGVDLIG-
2e2gA           ----ERFPEMEVTTDH-GVIKLPDHYVSQGKWFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGL
3cynB           ----NSFYAFEV---KDAKGRTVSLEKYKGKVSLVVNVASDCQLTDRN-YLGLKELHKEFGPSHFSVLAF
2e2mC           ----ERFPEMEVTTDH-GVIKLPDHYVSQGKWFVLFSHPADFTPVTTE-FVSFARRYEDFQRLGVDLIGL
2cvbA           ----SPLIDAEL---PDPRGGRYRLSQFHEPLLAV-VFCNHCPYVKGS-IGELVALAERY-RGKVAFVGI
2cv4A           -----------------------DHYVSQGKWFVLFSHPADFTPVTTE-FVSFARRYEDFQRLGVDLIGL
1eejA           ----NKMLLKQL---NALEKEMIVYKAPQEKHVITVFTDITCGYCHKLH-EQMADYNALGITVRYLAFPR
1e2yC           ----HPAPEFDDALPN-GTFKKVSLSSYKGKYVVLFFYPDFTFVCPTE-IIQFSDDAKRFAEINTEVISC
2bmxA           -----------------------TSDEHPGKWRVVFFWPKDFTFVCPTEIAAFSKLNDEFEDRDAQILGV
3e0uA           ----------------------YDLSQHKGHPLLIYNVASRCGYT-KGGYETATTLYNKYKGQGFTVLAF
2e2gB           ----ERFPEMEVTTDH-GVIKLPDHYVSQGWFVLFSHPADFTPVCTTE-FVSFARRYEDFQRLGVDLIG-
1e2yG           ----HPAPEFDDALPN-GTFKKVSLSSYKGKYVVLFFYPDFTFVCPTE-IIQFSDDAKRFAEINTEVIS-
2bmxB           ----LSKVDAKQ---PGDYFTTITSDEHPGKWRVVFFWPKDFTFVCPTEIAAFSKLNDEFEDRDAQILGV
2cv4E           -----------------------DHYVSQGKWFVLFSHPADFTPVTTE-FVSFARRYEDFQRLGVDLIGL
1e2yB           ----HPAPEFDDALPN-GTFKKVSLSSYKGKYVVLFFYPDFTFVCPTE-IIQFSDDAKRFAEINTEVISC
2ec4A           ---GDCHPVFFIGSLEAAFQEAFYVKARDRKLLAIYLHHDESVLT--------NVFCSQMLCAESIVSYL
3c7mA           ---------------EGTDYMVLEKPIPNADKTLIKVFSYACPFCYKY-DKAVTGPVSEKVKDIVAFTPF
2cx3B           ------APDFTLPNQD-FEPVNLYEVLKRGRPAVLIFFPAAFSPVCTKELCTFRDKAQLEKA-NAEVLAI
2e2mH           ----ERFPEMEVTTDH-GVIKLPDHYVSQGKWFVLFSHPADFTPVTTE-FVSFARRYEDFQRLGVDLIG-
2b1kA           ----KPVPKFRLESLD-NPGQFYQADVLTQGPVLLNVWATWCPTC-----RAEHQYLNQLSAQGIRVVGM
3dwvA           ----SSIFDFEVLDA---DHKPYNLVQHKGSPLLIYNVASKCGYT-KGGYETATTLYNKYKSQGFTVLAF
3drnA           ------APLFEG---IADNGEKISLSDYIGKHIVLYFYPKDDTPGSTREASAFRDNWDLLKDYDVVVIGV
2e2gC           ----ERFPEMEVTTDH-GVIKLPDHYVSQGKFVLFSHPADFTPVCTTE-FVSFARRYEDFQRLGVDLIG-
3cynA           ----NSFYAFEV---KDAKGRTVSLEKYKGKVSLVVNVASDCQLT-DRNYLGLKELHKEFGPSHFSVLAC
2cx3A           ------APDFTLPNQD-FEPVNLYEVLKRGRPAVLIFFPAAFSPVCTKELCTFRDKAQLEKA-NAEVLAI
2b5eA           ---------------VKLATDSFNEYIQSHDLVLAEFFAPWCGHC--------KNMAPEYVKAAETLVEK
3drnB           ----DKAPLFEG---IADNGEKISLSDYIGKHIVLYFYPDDTPGSTRE-ASAFRDNWDLLKDYDVVVIGV
2c0dB           ------AYNFTAQLNKNNEIINVDLSSFIGQCCLLFYPLNYTFVCPTE-IIEFNKHIKDFENKNVELLGI
3boaA           -----------------LATDSFNEYIQSHDLVLAEFFAPWCGHC--------KNMAPEYVKAAETLVEK
3dvxB           ------------EGEDYLVLDKPIPQEQSGKIEVLEFFGYFCVHC--------HHFDPLLLKLGKALPSD


                         .         .         *         .         .         .         .:140
query           HSVFEHHDVMTPEALKVFISEFGIKFPVAVDMPREGQRIPSTMKKYRLEGTPSIILADRKGRIRQVQFGQ
3c73A           -NVGES-----KIAVHNFMKSYGVNFPVVLDTDRQ------VLDAYDVSPLPTTFLINPEGKVVKVVTGT
3c71A           -NVGE-----SKIAVHNFMKSYGVNFPVVLDTDRQ------VLDAYDVSPLPTTFLINPEGKVVKVVTGT
2b7jA           LFITCDPARDSPAVLKEYLSDFHPSILGLTGTFDEVKNA-CKKYRVYVDHSIFFYLMDPEGQFVDALGRN
3c73B           NV------GESKIAVHNFMKSYGVNFPVVLDTDRQ------VLDAYDVSPLPTTFLINPEGKVVKVVTGT
3cynC           PQFGESEPRPSKEVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSNFWKYLVNPEGQVVKFWRPE
2b7kA           LFITCDPARDSPAVLKEYLSDFHPSILGLTGTFDEVKNA-CKKYRVLVDHSIFFYLMDPEGQFVDALGRN
2e2mD           -SVDSVF--SHIKWKEWIERHIGVRIPFPIIADPQGT-VARRLGLLATHTVRGVFIVDARGVIRTMLYY-
1e2yF           --SCDSEYSHLQWTSVDRKKGGLGPAIPLADKTKAIARAYGVLDEDSGVAYRGVFIIDPNGKLRQIIIN-
1e2yD           ISCSCDSEYSHLQWTSVDRKKGGGPAIPLADKTKAIARAYGVLDEDSGVAYRGVFIIDPNGKLRQIIIND
1e2yH           --SCDSEYSHLQWTSVDRKKGGLGPAIPLADKTKAIARAYGVLDEDSGVAYRGVFIIDPNGKLRQIIIN-
3cmiA           CNQFGGVTFPIMKKIDVNGGNEDPVYKFLKS------QKSGMLGLRGIKWNFEKFLVDKKGKVYERYSSL
2b5xA           MPRSEDDL--DPGKIKETAAEHDITQPIFVDSDH------ALTDAFENEYVPAYYVFDKTGQLRHFQAGG
2b7kB           LFITCDPARDSPAVLKEYLSDFHPSILGKYRVYFSTPPNVKPGQDYLVDHSIFFYLMDPEGQFVDALGRN
1e2yA           CSCDSEYS--HLQWTSVDRKKGGLPAIPLADKTKAIARAYGVLDEDSGVAYRGVFIIDPNGKLRQIIIND
1e2yE           -SCDSEYS--HLQWTSVDRKKGGGPAIPLADKTKAIARAYGVLDEDSGVAYRGVFIIDPNGKLRQIIIND
2b7jB           LFITCDPARDSPAVLKEYLSDFHPSILGLTGTFDEVKNA---CKKYRVYFSTPPNVKPGQD---------
2cv4D           -SVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTARRLGLLHAESATHTVRGVFIVDARGVIRTLYYPE
2e2mA           --LSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGT-VARRLGLLATHTVRGVFIVDARGVIRTMLYYP
2e2gA           -SVDSVFS--HIKWKEWIERHIGVRIPFPIIADPQGT-VARRLGLLATHTVRGVFIVDARGVIRTM----
3cynB           PQFGESEPRPSKEVESFARKNYGVTFPIFHKIKILGSEFLVDSSKKEPRWNFWKYLVNPEGQVVKFWRPE
2e2mC           -SVDSVFS--HIKWKEWIERHIGVRFPIIADPQGTARRLGLLHAESATHTVRGVFIVDARGVIRTMLYYP
2cvbA           NANDYEKYPEDAPEKAAFAEEHGIFFPYLLDETQE------VAKAYRALRTPEVFLFDERRLLRYHGRVN
2cv4A           -SVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTARRLGLLHAESATHTVRGVFIVDARGVIRTLYYPE
1eejA           QGLDSDAEKEMKAIWCAKDKNKAFDDVMAASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKE
1e2yC           --SCDSEYSHLQWTSVDRKKGGLGPAIPLADKTKAIARAYGVLDEDSGVAYRGVFIIDPNGKLRQIIIN-
2bmxA           -------SIDSEFAHFQWRAQHNDLKTLPFPLSDIKRELSQAAGVLNADADRVTFIVDPNNEIQFVSATA
3e0uA           -----PCNQFAGFACTRFKADFPIMAKIDVNGSKAKATIPGLFGTKAIKWNFTSFLIDRHGVPVERFSPG
2e2gB           LSVDSVFSHIKWKEWIERHIGVRIPFPIIADP--QGTVARRLGLLHATHTVRGVFIVDARGVIRTMLYYP
1e2yG           --CSCDSEYSHLQWTSVDRKKGGLPAIPLADKTKAIARAYGVLDEDSGVAYRGVFIIDPNGKLRQIIIND
2bmxB           -------SIDSEFAHFQWRAQHNDLKTLPFPLSDIKRELSQGVLNADGVADRVTFIVDPNNEIQFVSATA
2cv4E           -SVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTARRLGLLHAESATHTVRGVFIVDARGVIRTLYYPE
1e2yB           SDSEYSHLQWTSVDRKKG---GLGPAIPLADKTKAIARAYGVLDEDSGVAYRGVFIIDPNGKLRQIIIN-
2ec4A           SQNFITWAWDLTKDSNRA-------RFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEV----
3c7mA           -HLETKGE--YGKQASEVFAVLINKDKAAGISLFDANS--------------------------------
2cx3B           -------SVDSPWCLKKFKDENRLAFNLLSDYNREVIKVYHEDLKGLKVAKRAVFIVKPDGTVAYKWVTD
2e2mH           LSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLAESATHTVRGVFIVDARGVIRTM----
2b1kA           NYKDD------RQKAISWLKELGNPYALSL---FDGDGMLGL--DLGVYGAPETFLIDGNGIIRYRHAGD
3dwvA           PQFGGQEPGNEEEIKEFVCTKFKAEFPIMAKINVNGENKPGILATKAIKWNFTSFLIDRDGVPVERFSPG
3drnA           SS----DDI---NSHKRFKEKYKLPFILVSD---PDKKIRELYGAKGFILARITFVIDKKGIIRHIYNSQ
2e2gC           --LSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLSATHTVRGVFIVDARGVIRTM----
3cynA           NQFGESEPRPSKEVESFARKNYGVTFPIFHKIKILGFRFLVDSSKKEPRWNFWKYLVNPEGQVVKFWRPE
2cx3A           S-------VDSPWCLKKFKDENRLAFNLLSDYNREVIKVYHEDLKGLKVAKRAVFIVKPDGTVAYKWVTD
2b5eA           NITLAQIDCTENQDLCMEHNIPGFPSLKIFK---NSDVN---NSIDYEGPRTAEAIVQFMIKQSQPAVAV
3drnB           SS----DDI---NSHKRFKEKYKLPFILVSD---PDKKIRELYGAKGFILARITFVIDKKGIIRHIYNSQ
2c0dB           SVDSVYSHLAWKNMPIEKGGIGNVEFTLVSDINKDISK-NYNVLYDNSFALRGLFIIDKNGCVRHQTVND
3boaA           NITLAQIDCTENQDLCMEHNIPGFPSLKIFK---NSDVN---NSIDYEGPRTAEAIVQFMIKQSQPAVAV
3dvxB           AYLRTEHVVWQPELGL----ARAAAVNLSGLKYQANPAV--FKAVYEQKIRLENRSVAGKWALSQKGFDG


                         +         .         .         .         .         *         .:210
query           VDDFVxxxxxxxxxxxxxxx
3c73A           MT------------------
3c71A           MT------------------
2b7jA           YD------------------
3c73B           MT------------------
3cynC           EP------------------
2b7kA           YD------------------
2e2mD           --------------------
1e2yF           --------------------
1e2yD           PI------------------
1e2yH           --------------------
3cmiA           TK------------------
2b5xA           SG------------------
2b7kB           YD------------------
1e2yA           PI------------------
1e2yE           PI------------------
2b7jB           --------------------
2cv4D           LGRLV---------------
2e2mA           MELG----------------
2e2gA           --------------------
3cynB           EP------------------
2e2mC           ME------------------
2cvbA           DN------------------
2cv4A           LGRLV---------------
1eejA           MKEFL---------------
1e2yC           --------------------
2bmxA           GS------------------
3e0uA           AS------------------
2e2gB           ME------------------
1e2yG           PI------------------
2bmxB           GS------------------
2cv4E           LGRLV---------------
1e2yB           --------------------
2ec4A           --------------------
3c7mA           --------------------
2cx3B           --------------------
2e2mH           --------------------
2b1kA           LN------------------
3dwvA           AS------------------
3drnA           MN------------------
2e2gC           --------------------
3cynA           EP------------------
2cx3A           --------------------
2b5eA           VAD-----------------
3drnB           MN------------------
2c0dB           LP------------------
3boaA           VAD-----------------
3dvxB           KK------------------