[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF54079.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3b6mA.bssp"
#ERROR : Can't open dsspfile "3b6mB.bssp"
#ERROR : Can't open dsspfile "3b6iA.bssp"
#ERROR : Can't open dsspfile "2d5iA.bssp"
#ERROR : Can't open dsspfile "2b3dB.bssp"
#ERROR : Can't open dsspfile "3brcA.bssp"
#ERROR : Can't open dsspfile "2b3dA.bssp"
#ERROR : Can't open dsspfile "1dxqA.bssp"
#ERROR : Can't open dsspfile "3edoB.bssp"
#ERROR : Can't open dsspfile "3brcB.bssp"
#ERROR : Can't open dsspfile "2a5lB.bssp"
#ERROR : Can't open dsspfile "3edoA.bssp"
#ERROR : Can't open dsspfile "2amjD.bssp"
#ERROR : Can't open dsspfile "2amjC.bssp"
#ERROR : Can't open dsspfile "2a5lA.bssp"
#ERROR : Can't open dsspfile "1d4aA.bssp"
#ERROR : Can't open dsspfile "2arkE.bssp"
#ERROR : Can't open dsspfile "3d7nA.bssp"
#ERROR : Can't open dsspfile "2arkA.bssp"
#ERROR : Can't open dsspfile "2arkB.bssp"
#ERROR : Can't open dsspfile "1amoA.bssp"
#ERROR : Can't open dsspfile "2amjB.bssp"

## Summary of PDB Search
:188
    8e-18  17%  3b6mA  [x.x.x] FLAVOPROTEIN WRBA
    1e-17  17%  3b6mB  [x.x.x] FLAVOPROTEIN WRBA
    2e-16  16%  3b6iA  [x.x.x] FLAVOPROTEIN WRBA
    3e-16  18%  2d5iA  [x.x.x] AZO REDUCTASE
    5e-15  13%  2b3dB  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    3e-13  14%  3brcA  [x.x.x] CONSERVED PROTEIN OF UNKNOWN FUNCTION
    3e-13  13%  2b3dA  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    1e-11  17%  1dxqA  [c.23.5] QUINONE REDUCTASE
    3e-11  10%  3edoB  [x.x.x] PUTATIVE TRP REPRESSOR BINDING PROTEIN
    4e-11  11%  3brcB  [x.x.x] CONSERVED PROTEIN OF UNKNOWN FUNCTION
    4e-10  14%  2a5lB  [x.x.x] TRP REPRESSOR BINDING PROTEIN WRBA
    8e-10  10%  3edoA  [x.x.x] PUTATIVE TRP REPRESSOR BINDING PROTEIN
    2e-08  10%  2amjD  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    4e-08  11%  2amjC  [x.x.x] MODULATOR OF DRUG ACTIVITY B
    9e-07  14%  2a5lA  [x.x.x] TRP REPRESSOR BINDING PROTEIN WRBA
    3e-06  17%  1d4aA  [c.23.5] QUINONE REDUCTASE
    4e-06  15%  2arkE  [x.x.x] FLAVODOXIN
    8e-06  14%  3d7nA  [x.x.x] FLAVODOXIN, WRBA-LIKE PROTEIN
    2e-05  16%  2arkA  [x.x.x] FLAVODOXIN
    6e-05  16%  2arkB  [x.x.x] FLAVODOXIN
    9e-05  12%  1amoA  [c.23.5 - b.43.4 - c.25.1] NADPH-CYTOCHROME P450 REDUCTASE
    1e-04  13%  2amjB  [x.x.x] MODULATOR OF DRUG ACTIVITY B
:188

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSKIAIITGSTRPGRVNIDVANWVLERAQERNDAQYELVDIADFNFPVLDEAMPAGYGQYANEHTKAWAA
3b6mA           -AKVLVLYYSMYGHIET--MARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGG----KTQTAPVATPQ
3b6mB           -AKVLVLYYSMYGHIET--MARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKT----QTAPVATPQ
3b6iA           -AKVLVLYYSMYGHIET--MARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKT----QTAPVATPQ
2d5iA           -SKVLVLKSSILAGYSQSNLSDYFVEQWREKHADEITVRDLAANPIPVLDGELVGALRPSDAPLTDELIA
2b3dB           -SNILIINGAKKFAHSNGQLNDTLTEVADGTLRD--LGHDVRIVRADSDYDV-------------KAEVQ
3brcA           -------------------IGKAYLESAEDRRRDRSEEVEAIRKYIRSARRTVVPNWNAEKVDADVLRSF
2b3dA           -SNILIINGAKKFAHSNGQLNDTLTEVADGTLRD--LGHDVRIVRADS-------------DYDVKAEVQ
1dxqA           ARRALIVLAHSEKTSFNYAMKEAAVEALKKR-GWEVLESDLYAMNFPIISRNDITGELGRLSPDIVAEHK
3edoB           --KTLILYYSWSGE--TKKAEKINSEIKDSELKEVKVSEGTFDADYKTSDIALDQIQGNKDFPEIQLDNI
3brcB           -------------------IGKAYLESAEDRRGDRSEEVEAIRKYIRSARRTVVPNWNAEKVDAINLRSF
2a5lB           --YILVLYYSRHG---ATAEARQIARGVEQG-GFEARVRTVPAVSTEALYA----------------TLE
3edoA           --KTLILYYSWSGE--TKKAEKINSEIKDSELKEVKVSEGTFDADYKTSDIALDQIQGNKDFPEIQLDNI
2amjD           SSNILIINGAKNDTLTEV------ADGTLRDLGHDVRIVRADSDYDV------------------KAEVQ
2amjC           -SNILIINGA---KQLNDTLTEVADGTLRDLG-HDVRIVRADSDYDV------------------KAEVQ
2a5lA           --YILVLYYSRHG---ATAEARQIARGVEQ------GGFEARVRTVPAVSTAL------------YATLE
1d4aA           --RALIVLAHSERTSFNSDLYAMNFNPIISRKDITGKLKDPANFQYPA--ESVLAYKEGHLSPDIVAEQK
2arkE           -GKVLVIYDTRTG---NTKKAELVAEGARSLEGTEVRLKHVDEATKE-----------------------
3d7nA           -SNTVVVYHSGYG---HTHRAEAVAEGAEAT-----------LHAIDAEGNLS------------EDGWA
2arkA           AGKVLVIYDTRTG---NTKKAELVAEGARSLEGTEVRLKHVDE-----------------------ATKE
2arkB           AGKVLVIYDTRTG---NTKKAELVAEGARSLEGTEVRLKHVDE-----------------------ATKE
1amoA           GRNIIVFYGSQTGT--AEEFANRLSKDAHRYG-MRGMSADPEEYDLA------------------DLSSL
2amjB           SSNILIINGA--NGQLNDTLTEVADGTLRDLGH-DVRIVRADSDYDV------------------KAEVQ


                         .         .         *         .         .         .         .:140
query           KIAEFDGFIFVTGEYNHSVPAALTNALSYLSAEWNNKAAGIVSYGSAMGVRAAEHLRGILSELQIAHVQK
3b6mA           ELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWYGKLASVFSSTGTGGEQTITSTWTTLAHHGMVIVPI
3b6mB           ELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWYGKLASVFSSTGTGGEQTITSTWTTLAHHGMVAAQE
3b6iA           ELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWYGKLASVFSAHHGMVIVPIGYAAQELFDVS-QVRGG
2d5iA           ELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGTGKKAIVIIHKDGPTDLVTPYLSTFLGFIGI-----
2b3dB           NFLWADVVIWQMPGWWMGAPWTVKKYIDDVFTEGHGGRTDPSKKYGSGGLVQGKKYMLSLTWNAPMEA--
3brcA           NLREAEHLQFNTNWADLTRPAVTKALALDISGADSGSLLVIDSRGRSAASPPHVIHSEVREAVRSETH--
2b3dA           NFLWADVVIWQMPGWWMGAPWTVKKYIDDVFTEGSDGRTRKDKKYGSGGLVQGKKYMLSLTWNAPMEAFT
1dxqA           KLEAADLVIFQFPLQWFGVPAILKGWFERVLVAG------------------------------------
3edoB           DYNNYDLILIGSPVWSGYPATPIKTLLDQKN--YRGEVASFFTSAGTNHKAYVSHFNEWADGLNV-----
3brcB           NLREAEHLQFNTNWADLTRPAVTKALALDISGAPGSGSLLVIRGRLLSAASPPHVIHSEVREAV------
2a5lB           DLKNCAGLALGSPTRFGN-ASPLKYFLDGTSSLWLTPAAVFTSTASLHGETTQLSLLPLLHHLGIPYSEP
3edoA           DYNNYDLILIGSPVWSGYPATPIKTLLDQKN--YRGEVASFFTSAGTNHKAYVSHFNEWAD---------
2amjD           NFLWADVVIWQP--GWWGAPWTVKKYIDDVFTEGQGKKYLSLTWNAPEATEKDQFFHGVGVDGVYLPFHK
2amjC           NFLWADVVIW--QPGWWGAPWTVKKYIDDVFTEGVQGKKYLSWNAPEAFTEKDQFFHGVGVDGVYLPFHK
2a5lA           DLKNCAGLALGSPTRFGN-ASPLKYFLDGTSSLWLTPAAVFTSTASLHGETTQLSLLPLLHHGLVLGIPY
1d4aA           KLEAADLVIFQFPLQWFGVPAILKGWFERVFIGESKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSG
2arkE           DVLWADGLAVGSPTNGLVSWRFFDDVLGDLWGEIDGKIACAFSSSGGWGGGNEVACSILTLNFGFLVFGV
3d7nA           ALDAADAIIFGTPTYG-GPSWQFKKFADASSKPWQDKVFGGFTNSASLNLNTLQYLVLLAGQHGGLWVSL
2arkA           DVLWADGLAVGSPTNG-LVSWKKRFFDDVLGDLWGEIACAFSSSGGWGGNEVACSILTLNFGFLVFGVTD
2arkB           DVLWADGLAVGSPTNGL-VSWKKRFFDDVLGDLWGEIACAFSSSGGWGGNEVACSILTLNFGFLVFGVTD
1amoA           PEIDKSLVVFCMATYGEGDPQDFYDWLQETDVDLTGVFAVFGLGNKTY----------------------
2amjB           NFLWADVVIWQP--GWWGAPWTVKKYIDDVFTEGSDGRTKYGSGGLVQGKYLSLTWNAPEAFTEKDQFFH


                         +         .         .         .         .         *         .:210
query           TGLLSIFTDFEYPNFKPSEQGISSVDAMLEQLVVWTKAMSxxxxxxxx
3b6mA           GYAAQGGTPYGATTIQPSQEELSIARYQGEYVAGLAVKL---------
3b6mB           GGTPYGATTIAGGSRQPSQEELSIARYQGEYVAGLAVKLN--------
3b6iA           TPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKL---------
2d5iA           ------------------------------------------------
2b3dB           ---------FTEKDQFFHGVGVDGVYLPFHKANQFLGME---------
3brcA           --------ALERIGFK--------------------------------
2b3dA           EK----------------------------------------------
1dxqA           ------------------------------------------------
3edoB           ------------------------------------------------
3brcB           ------------------------------------------------
2a5lB           TPYGASHFAGADGKRSLDEHELTLCRALGKRLAETAGKLG--------
3edoA           ------------------------------------------------
2amjD           ANQFLGEPLPTFIANDVIKPDVPRYTEEYRKHL---------------
2amjC           ANQFLGEPLPTFIANPDVPRYTEEYRKHLVEIF---------------
2a5lA           TPYGASHFAGADGKRSLDEHELTLCRALGKRLAETAGKLG--------
1d4aA           ILHFCGFQVTYSIGHTPADARIQILEGWKKRL----------------
2arkE           TDYVGKKFTLHYGGEPRSEEEKEACRRLGRRLAEWVAIF---------
3d7nA           GYI--------APAQSESVGDLETARLYGARVANVARQH---------
2arkA           YVGKKFTLHYGAAGEPRSEEEKEACRRLGRRLAEWVAIF---------
2arkB           YVGKKFTLHYGAAGEPRSEEEKEACRRLGRRLAEWVAIF---------
1amoA           ------------------------------------------------
2amjB           GVGVDGVYL---------------------------------------