[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF54269.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1e79G.bssp"
#ERROR : Can't open dsspfile "2ck3G.bssp"
#ERROR : Can't open dsspfile "1bmfG.bssp"
#ERROR : Can't open dsspfile "2dytA.bssp"

## Summary of PDB Search
:325
    1e-69  21%  1e79G  [c.49.2] ATP SYNTHASE GAMMA CHAIN
    6e-37  26%  2ck3G  [x.x.x] ATP SYNTHASE GAMMA CHAIN
    3e-32  19%  1bmfG  [c.49.2] BOVINE MITOCHONDRIAL F1-ATPASE
    2e-21  15%  2dytA  [x.x.x] AUTOPHAGY-RELATED PROTEIN 3
:325

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xATIRELRDRIRSVNSTKKITKAQELIATSRITKAQGRVAAAAPYAEEIQRVLERLASASSLDHPMLRER
1e79G           -ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYGVGS--------------LALYEKA
2ck3G           -ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVY-------------------------
1bmfG           ----------------------------------------------------------------------
2dytA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EGGKRAAVLVVTSDRGMAGGYNHNVXXXXXXXXXXXXXSGYEVVRYVTGKKGVDYYKFRAEDVAGAWTGF
1e79G           DIKTPELIIGVSSDRGLCGAIHSSVAKQMKSEAA----NLKEVKIIGVGDKIRSILHRTHSDLVTFKEVG
2ck3G           ---GVGLIIGVSSDRGLCGAIHSS------------------VAIIGVGDKIRSILTFKE--------VG
1bmfG           ----------------------------------------------------------------------
2dytA           ---LTTGQ-ITPEEFVQAGDYLCHMFPTWKWNE-----ESSDISYRDFLPKNKQFLIIRKVPCDKRAEQC


                         +         .         .         .         .         *         .:210
query           SQDPDWAATHNVRRHLIDGFTASSEGEAAWREGLNLSEGQDIQGFDQVHVVYTEFISMLTQNPVVHQLLP
1e79G           RRPPTFGDASVIALELLN-----SGYE-----------------FDEGSIIFNRFRSVISYKTEEKPIFS
2ck3G           RRPPTFGDASVI--------------------------------ALELSIIFNRFRSVISYKT-------
1bmfG           -----------------------------------------------LKDITRKSIKNIQKITKSMKMVA
2dytA           IDDIDELI-----QDMEIKMAQ--------------------ERYYDLYIAYSTSYRVPKIVGFNSNGSP


                         .         .         .         +         .         .         .:280
query           VEPVIEDEIFEKGEDLLSSSGDVEPDYEFEPDADTLLEALLPQYVSRRLFSIFLXXXXXXXXXXXNAMKS
1e79G           LDTISSAE----------------SMSIYDDIDADVLRNYQEYSLANIIYYSLKESTTSEQSARMTAMDN
2ck3G           ----------------------------EYSLANIIYYSLKESTTSEQSARM-------------TAMDN
1bmfG           AAK-YARAEREL------------KPARVYLCGAIHSSVAKQMKLANIIYYSLKESTTSEQSARMTAMDN
2dytA           LSP---EQMFE--------------DISADYRTKTATIEKLPFYKNSVLSVSIHPC--------------


                         .         *         .         .         .         .         +:350
query           ATDNASELVKDLSRVANQARQAQITQEITEIVGGAGALxxxxxxx
1e79G           ASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL-------
2ck3G           ASKNASEMIDKLTLTFNRTRQAVITKELIEIISGA----------
1bmfG           ASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL-------
2dytA           ---KHANVMKDKVRVVRQRRRKELQEE------------------