[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF54336.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1eexA.bssp"
#ERROR : Can't open dsspfile "1b1xA.bssp"
#ERROR : Can't open dsspfile "2de3B.bssp"
#ERROR : Can't open dsspfile "1dtzA.bssp"
#ERROR : Can't open dsspfile "2a8jA.bssp"
#ERROR : Can't open dsspfile "1bkaA.bssp"
#ERROR : Can't open dsspfile "2dbpA.bssp"
#ERROR : Can't open dsspfile "2de2A.bssp"
#ERROR : Can't open dsspfile "2b65A.bssp"
#ERROR : Can't open dsspfile "2czlA.bssp"
#ERROR : Can't open dsspfile "1blfA.bssp"
#ERROR : Can't open dsspfile "1biyA.bssp"
#ERROR : Can't open dsspfile "2de3A.bssp"
#ERROR : Can't open dsspfile "1d4nA.bssp"
#ERROR : Can't open dsspfile "1ce2A.bssp"
#ERROR : Can't open dsspfile "2bjjX.bssp"
#ERROR : Can't open dsspfile "2b3wA.bssp"
#ERROR : Can't open dsspfile "2cbjA.bssp"
#ERROR : Can't open dsspfile "2b4lA.bssp"
#ERROR : Can't open dsspfile "2b4mA.bssp"
#ERROR : Can't open dsspfile "2cbiA.bssp"
#ERROR : Can't open dsspfile "1dotA.bssp"
#ERROR : Can't open dsspfile "3b50A.bssp"

## Summary of PDB Search
:391
    6e-26  11%  1eexA  [c.1.19] PROPANEDIOL DEHYDRATASE
    2e-24   9%  1b1xA  [c.94.1 - c.94.1] LACTOFERRIN
    1e-22  11%  2de3B  [x.x.x] DIBENZOTHIOPHENE DESULFURIZATION ENZYME B
    5e-22   9%  1dtzA  [c.94.1 - c.94.1] APO LACTOFERRIN
    1e-21  11%  2a8jA  [x.x.x] THREONINE ASPARTASE 1
    8e-21  10%  1bkaA  [x.x.x] LACTOFERRIN
    1e-20   9%  2dbpA  [x.x.x] TTHA1568
    3e-20  11%  2de2A  [x.x.x] DIBENZOTHIOPHENE DESULFURIZATION ENZYME B
    1e-19  12%  2b65A  [x.x.x] LACTOTRANSFERRIN
    1e-19   9%  2czlA  [x.x.x] HYPOTHETICAL PROTEIN TTHA1568
    2e-19   9%  1blfA  [x.x.x] LACTOFERRIN
    8e-19   8%  1biyA  [x.x.x] LACTOFERRIN
    1e-18  11%  2de3A  [x.x.x] DIBENZOTHIOPHENE DESULFURIZATION ENZYME B
    1e-18   9%  1d4nA  [c.94.1] TRANSFERRIN
    2e-18   8%  1ce2A  [c.94.1 - c.94.1] PROTEIN (LACTOFERRIN)
    3e-12   9%  2bjjX  [x.x.x] LACTOTRANSFERRIN
    1e-11   7%  2b3wA  [x.x.x] HYPOTHETICAL PROTEIN YBIA
    3e-11   9%  2cbjA  [x.x.x] HYALURONIDASE
    2e-10  10%  2b4lA  [x.x.x] GLYCINE BETAINE-BINDING PROTEIN
    2e-09  10%  2b4mA  [x.x.x] GLYCINE BETAINE-BINDING PROTEIN
    2e-07  11%  2cbiA  [x.x.x] HYALURONIDASE
    2e-06  12%  1dotA  [x.x.x] DUCK OVOTRANSFERRIN
    5e-04  14%  3b50A  [x.x.x] SIALIC ACID-BINDING PERIPLASMIC PROTEIN SIAP
:391

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxSTALAGAARYVTSTSNNEPADNTPLTIGYVPIACSAPIAIANALGLFKKH
1eexA           -----------------------------VYGTEPVFTDGDDTPWSKGFLASSYASRGLKMRFTSGSGSE
1b1xA           ---------------------------------------APRKSVRWCTISPAE-AAKCAKFQRNMKKVR
2de3B           --------------------------------------------DTLTYSNSPVPNALLTASESGFLDAA
1dtzA           ---------------------------------------ASKKSVRWCTTSPAE-SKKCAQWQRRMKKVR
2a8jA           ----------------------------------------------------------AGYHSESKAKEY
1bkaA           -------------------------------------------SVQWCAVSQPE-ATKCFQWQRNMRKVR
2dbpA           --------------------------------------------LRLGFSPCPNDTFIFYALVHG-RVES
2de2A           --------------------------------------------DTLTYSNCPVPNALLTASESGFLDAA
2b65A           ------------------------------------------TRVVWCAVG---PEEQKKCQQW--SQQS
2czlA           --------------------------------------------LRLGFSPPND-TFIFYALVHGRVES-
1blfA           --------------------------------------------VRWCTIS-QPEWFKCRRWQWRMKKLG
1biyA           ---------------------------------------APRKNVRWCTISQPE-WLKCHRWQWRMKKLG
2de3A           ---------------------------------------------TLTYSNSPVPNALLTASESGFLDAA
1d4nA           -----------------------------------------DKTVRWCAVSEHEATKCQSFRDHSVIPSD
1ce2A           ---------------------------------------APRKNVRWCTISQPE-WLKCHRWQWRMKKLG
2bjjX           ---------------------------------------RRRRSVQWCAVS-QPEATKCFQWQRNMRRVR
2b3wA           ----------------------------------------------------------------------
2cbjA           ----------------------------------------------------------------------
2b4lA           ----------------------------------------------------------------------
2b4mA           ----------------------------------------------------------------------
2cbiA           ----------------------------------------------------------------------
1dotA           --------------------SQLYLGFEYYSAIQSLRKDQLTVGPRENKIQWCAVGKDEKSKCDRWSVVS
3b50A           ------------------------------------------YDLKFGMNAGTSSNEYKAAEMFAVKEKS


                         .         .         *         .         .         .         .:140
query           GVNVTLKKYSGWSDLWTAYATEQLDVAHMLSPMTVAINAGVTNASRPMELSFTQNTNGQAITLASKHYGS
1eexA           VQMGYAEGKSCIYITKAAGVQGLQNGSVSCIGVPSAVPSGIRAVLAENICSSLDLECASSNDQTFTHSDM
1b1xA           GPSVSCIRKTSSFECIQAIAANKADAVTLDGGLVYAGLHPYKLRPVAAEVYQTRGKPQTRYYAVAVVKKG
2de3B           GIELDVLSGQQGTVHFTYDQPAYTRFGGEIPPLLSE-----GLRAPGRTRLLGITPLLGRQGFFVRDDSP
1dtzA           GPSVTCVKKTSRFECIQAISTEKADAVTLDGGLVYDAGLDPYKLRPIAAEGTENQPQTHYYAVAIAKKGT
2a8jA           KHVCKRACQKAIEKLQAALATDAVTAALVESPFTNAGMGSNLNLLCDASIMDGKSLNFGAVGALSGIKNP
1bkaA           GPPVSCIKRDSPIQCIQAIAENRADAVTLDGGFIYAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKG
2dbpA           PVPLEP-VLEDVETLNRWALEGRLPLTKLSYAAYA----QVRDRYVALRSGGALGRGVGPLVVARG----
2de2A           GIELDVLSGQQGTVHFTYDQPAYTRFGGEIPPLLSE-----GLRAPGRTRLLGITPLLGRQGFFVRDDSP
2b65A           GQNVTCATASTTDDCIVLVLKGEADALNLDGGYIYTLAENRKSSKHSSLDCVLRPTEGYLAVAVVKKANE
2czlA           PVPLEPV-LEDVETLNRWALEGRLPLTKLSYAAYAQVRDRY----VALRSGGALGRGVGPL------VVA
1blfA           APSITCVRRAFALECIRAIAEKKADAVTLDGGMVFAGRDPYKLRPVAAEIYGTKESPQTHYYAVAVVKKG
1biyA           APSITCVRRAFVLECIRAITEKKADAVTLDGGMVFEAGLDPLRPVAAEIYGTKESPQTHYYAVAVVKKGS
2de3A           GIELDVLSGQQGTVHFTYDQPAYTRFGGEIPPLLSEGLRA-----PGRTRLLGITPLLGRQGFFVRDDSP
1d4nA           GPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYAYLAPNNLKPVVAEYGSKEDPQTFYYAVAVVKKDS
1ce2A           APSITCVRRASVLECIRAITEKKADAVTLDGGMVFAGRDPYKLRPVAAEIYGTKESPQTHYYAVAVVKKG
2bjjX           GPPVSCIKRDSPIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTYAVAVVKKGG
2b3wA           ----------------------------------------------------------------------
2cbjA           ----------------------------------GEVDDDIPELDEALNGTTAENLKEEGYALVSNDGKI
2b4lA           ----------------------------------------------------------------------
2b4mA           ----------------------------------------------------------------------
2cbiA           -----------------------ENAVNALREFLTANNIEINSENDPTLIIGEVDDDIPELDEALNGTTG
1dotA           NGEVECTILDDNKDCIVKITKGEADAISLDGFVYTAGVCGLVEDETQCSKDEEQPAYYFAVAVVKK--SS
3b50A           QGKIEISLYPSSQAMLKQLKDGSLDFTFAESARFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRA


                         +         .         .         .         .         *         .:210
query           VNSAADLKGMVLGIPFEYSVHALLLRDYLASNAVDPIADLKLRLLPPADMVAQLTVEGIAGFIGPEPFNE
1eexA           RRTARLLMQFLPGTDFISSGYSAVPNYDNMFAGSNEDAEDFDDYNVIQRDLKPVREEDVIAIRNKAARAL
1b1xA           GFQLNQLQGVKSCHTGLGRAGWNIPIGTLRPYLNWTGPPEPLQKAVANFFSAS-----CVPCADGKQYPN
2de3B           ITAAADLAGRRIGVSALGSWEARALLHTLEHGELGV-DDVELVPISSPGVDVPAEQGDVDALYSWLPWAG
1dtzA           NFQLNQLQGLKSCHTLGRSAGWNIPMGLLRPFLDWTGPPEPLQKAVAKFFSAS-----CVPCVDGKEYPN
2a8jA           VSVACEGQKGKLGRIPPCFLVGEGAYRWAVDHGIPSCPTVGAVVVDHEGNVAAAVSSGGQAALYGCGCWA
1bkaA           SFQLNELQGLKSCHTGLRRAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGADKGQF--PNLCR
2dbpA           --PLQALEGLRVAVPGRHTTAYFLLSLYA--------QGFVPVEVRYDRILPMVAQGEVEAGLIIHESRF
2de2A           ITAAADLAGRRIGVSALGSWEARALLHTLEHGELGV-DDVELVPISSPGVDVPAEQLEESALYSWLPWAG
2b65A           GLTWNSLKDKKSCHTAVDRTAGWNIPMGLIVNQTGSFSQSCAPGADPKSRLCALCAGDDQGLDKCVPNSK
2czlA           RGPLQALEGLRVAVPGRHTTAYFLLSLYA--------QGFVPVEVRYDRILPMVAQGEVEAGLIIHESRF
1blfA           NFQLDQLQGRKSCHTGLGRAGWIIPMGILRPYLSWTESLEPLQGAVAKFFSAS-----CVPCIDRQAYPN
1biyA           NFQLDQLQGRNSCHTGLGRAGWNIPMGILRPYLSWTESLEPLQGAVAKFFSASCVPCVDRQAY--PNLCQ
2de3A           ITAAADLAGRRIGVSASAIRILRGQLGDYLELDPWRQTLVA----LGSWEARALLHTLEHGELGVDDVEL
1d4nA           GFQMNQLRGKKSCHTGLGRSAGNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPG
1ce2A           NFQLDQLQGRNSCHTGLGRAGWNIPMGILRPYLSWTESLEPLQGAVAKFFSASC----VPCVDRYPNLCQ
2bjjX           SFQLNELQGLKSCHTGLRRAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGADKG---------
2b3wA           ---------------------------------------------RAQRIQHVMQDTIINFYSTSDDYGD
2cbjA           AIEGKD--------GDGTFYGVQTFKQLVKESNIPE-----VNITDYPTVSARGIVEGFYG----TPWTH
2b4lA           ASAAEQVNKTIIGIDP-GSGIMSLTDKAMKDYDLNDWTLISASSAATATLKKSYDRKKPIIITGWTPHWM
2b4mA           --AAEQVNKTIIGIDPGSGIMSLTDK-AMKDYDLNDWTLISASSAATATLKKSYDRKKPIIITGWTPHW-
2cbiA           YALVSNDGKIAIEGKDGDGTFYGVFKQLVKESNIPE-----VNITDYPTVSARGIVEGFYG----TPWTH
1dotA           AITWNNLQGKKSCHTAVGRAGWNIPMGLIHNGSCDFDDYFSEGCAPPNSRLCKLSGENLLEKCVASSHEK
3b50A           INSIADMKGLKLRVPNAATNLAYAKYV-----------GASPTPMAFSEVYLALQTNAVDGQENPLAAVQ


                         .         .         .         +         .         .         .:280
query           RAISNGSGRIWLLTKQVWDKHPCCAVAKAKEWKAEHPTAAQGVLNALEEVSAILSNPAQFDSSARTLSQE
1eexA           QAVFAGMGLPPITDEEVE---AATYAHGSKDMPERNIVEDIKFAQEIINKNR---NG---LEVVKALAQG
1b1xA           LCRLCAGTEADKCACSSQEPYFGYSGAF-KCLENGAGDVAFVKDSTVFENLPDEAERDKYELLCPDNTRK
2de3B           ELQATGARPV-VDLGLDERNAYASVWTVSSGLVRQRPGLVQRLVDAAVDAGLARDHSDAV---TSLHA--
1dtzA           LCQLCAGTGENKCACSSQEPYFGYSGAFKCLQD-GAGDVAFVKDSTVFESLPAKADRDQYNNTRKPVDAF
2a8jA           ENTGAHNPYSTAVSTSGCGEHLVRTILARCSHALQAEDAHQALLETMQNKFISSPFLDGVLGGVIVLRSC
1bkaA           LCAGTGENKCAFSSQEPYFSYSGA----FKCLRDGAGDVAFIRESTVFEDLSDEAERDEYELLCPDNTRK
2dbpA           TYPRYGLVQV-VDLGAWWEERTGLPLPLILARRDLGEGLIRALDEAVRR--SVAYALAHPEEALDYMR-A
2de2A           ELQATGARPVVD-LGLDERNAYASVWTVSSGLVRQRPGLVQRLVDAAVDAGLARDHSDAV---TSLHA--
2b65A           EKYYGYTGAFRCLAEDVGDVAFVKNDTVWENTNGESTADWAKNLK-------------------------
2czlA           TYPRYGLVQV-VDLGAWWEERTPLPLGAILARRDLGEGLIRALDEAVRRSVAYA--LAHPEEALDYMR-A
1blfA           LCQLCKGEG-ENQCACSSREPYFGYSGAFKCLQDGAGDVAFVKETTVFENLPEKADRDQYELLCLNNSRA
1biyA           LCKGEGENQCACSPREPYFGYSCLQDGAGDVAFVKETTVFENLPEKADRDQYELLCLNNTRAPVDAFKEC
2de3A           VPISSPGVDVPAEQLEESATVKGADLFPDAVLASGDVDALYSWLPWAGELQA------------------
1d4nA           CGCSTLNQYF------GYSGAFKCLKDGAGDVAFVKESTIFENLANKADRDQELLCLDN---TRKPVDEY
1ce2A           LCKGEGENQCACSPREPYFGYSGCLQDGAGDVAFVKE---------------------------------
2bjjX           ----------------------------------------------------------------------
2b3wA           FSN--------------FAAWPIKVDGKTWPTSEHYFQAQKFLDEKYREEIRRVSSPMVAARMGRDRLRK
2cbjA           QDRLDQIKFYGENKLNTYIYAPKDDPYHREKWREPYPESEMQRMQELINASAENKVDFVFGISPDIRFDG
2b4lA           FSRYKLKYL--DDPKQSYGSAEEIHTITRKGFSKEQPNAAKLLSQFK--------WTQDEMGEIMIKVEE
2b4mA           -MFSRYKLKYLDDPKQSYGSAEEIHTITRKGFSKEQPNAAK----LLSQFKWTQDEMGEIMIKVEEGEKP
2cbiA           QDRLDQIKFYGENKLNTYIYAPKDDPYHREKWREPYPESEMQRMQELINASAENKVDFVFGISPDIRFDG
1dotA           YYGYTGALRCLVEQGDVAIKHS--TVGENVSGSNKDDWAKG-----------------------------
3b50A           AQKFYEVQKFLAMTNHILN--DQLYLVSNETYKELPEDLQKVVKDAAENA--------------------


                         .         *         .         .         .         .         +:350
query           KYLNQPAALLDGPFSGMYQDWHGQTHTDHERMSFGDPTDPTAIIWMATQIARWGLxxxxxxxxxxxxxxx
1eexA           GFTDVAQDMLNAKLTGDYLHTSAIIVGDGQVLSNDVNDYAGPATGYRLQGERWEE---------------
1b1xA           PVDAFKECHLARVPSHAVVARSVDGREDL-----------------------------------------
2de3B           ANLGVSTGAVGQGFGADFQQRLVPRLDH------------------------------------------
1dtzA           QECHLARVPSHAVVARSVNGKEDLIKLLVKAQEKFGRGKPSAFQLFGSPAGQK-----------------
2a8jA           LLVEFLWSHTTESMCVGYMSAQDGK---------------------------------------------
1bkaA           PVDKFKDCHLA-----------------------------------------------------------
2dbpA           HAQELSDEVIWAHVHTYVNAFSLDV----------GEEGERAVARLFAEAEARGL---------------
2de2A           ANLGVSTGAVGQGFGADFQQRLVPRLDH------------------------------------------
2b65A           ----------------------------------------------------------------------
2czlA           HAQELSDEVIWAHVHTYVNAFSLDV----------GEEGERAVARLFAEAEARGL---------------
1blfA           PVDAFK----------------------------------------------------------------
1biyA           HLAQVPS---------------------------------------------------------------
2de3A           ----------------------------------------------------------------------
1d4nA           KDCHLAQVPSHTVVARSMGGKEDQEHFGKDKSKEFQLFSSPHGLLFKDSAHGFLK---------------
1ce2A           ----------------------------------------------------------------------
2bjjX           ----------------------------------------------------------------------
2b3wA           NWESVKEQVMRKALRAKFEQHAELRALLLATAPAKLVEHTENDLGYLLMELREQL---------------
2cbjA           DAGEEDFNHLITKAESLYDMGVRSFDDIQDKSAAKHNRFNEEFVKAKGDVKPLIT---------------
2b4lA           GEKPAKVAAEYVNKHKDQIAEWTKGVQKVKGDKINLAYVAWDSEIASTNVIGK-----------------
2b4mA           AKVAAEYVNKHKDQIAEWTKGVQKVKGDKINLAYVAWDSEIASTNV------------------------
2cbiA           DAGEEDFNHLITKAESLYDM--------------------------------------------------
1dotA           ----------------------------------------------------------------------
3b50A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1eexA           -----------------------------------------
1b1xA           -----------------------------------------
2de3B           -----------------------------------------
1dtzA           -----------------------------------------
2a8jA           -----------------------------------------
1bkaA           -----------------------------------------
2dbpA           -----------------------------------------
2de2A           -----------------------------------------
2b65A           -----------------------------------------
2czlA           -----------------------------------------
1blfA           -----------------------------------------
1biyA           -----------------------------------------
2de3A           -----------------------------------------
1d4nA           -----------------------------------------
1ce2A           -----------------------------------------
2bjjX           -----------------------------------------
2b3wA           -----------------------------------------
2cbjA           -----------------------------------------
2b4lA           -----------------------------------------
2b4mA           -----------------------------------------
2cbiA           -----------------------------------------
1dotA           -----------------------------------------
3b50A           -----------------------------------------