[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF54367.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3e3nD.bssp"
#ERROR : Can't open dsspfile "3e3nA.bssp"
#ERROR : Can't open dsspfile "3e3nH.bssp"
#ERROR : Can't open dsspfile "3e3nB.bssp"
#ERROR : Can't open dsspfile "1ahpA.bssp"
#ERROR : Can't open dsspfile "2ecpA.bssp"
#ERROR : Can't open dsspfile "2c4mB.bssp"
#ERROR : Can't open dsspfile "2c4mC.bssp"
#ERROR : Can't open dsspfile "3ddsB.bssp"
#ERROR : Can't open dsspfile "2c4mA.bssp"
#ERROR : Can't open dsspfile "3e3oA.bssp"
#ERROR : Can't open dsspfile "2atiA.bssp"
#ERROR : Can't open dsspfile "3dd1B.bssp"
#ERROR : Can't open dsspfile "3ddwB.bssp"
#ERROR : Can't open dsspfile "3cejA.bssp"
#ERROR : Can't open dsspfile "3ddsA.bssp"
#ERROR : Can't open dsspfile "3e3oB.bssp"
#ERROR : Can't open dsspfile "3cehA.bssp"
#ERROR : Can't open dsspfile "1e4oA.bssp"
#ERROR : Can't open dsspfile "3e3oD.bssp"
#ERROR : Can't open dsspfile "3e3nC.bssp"
#ERROR : Can't open dsspfile "3e3lC.bssp"
#ERROR : Can't open dsspfile "3e3nE.bssp"
#ERROR : Can't open dsspfile "3e3lB.bssp"
#ERROR : Can't open dsspfile "1bx3A.bssp"
#ERROR : Can't open dsspfile "3e3lD.bssp"
#ERROR : Can't open dsspfile "3e3oC.bssp"
#ERROR : Can't open dsspfile "1c8lA.bssp"
#ERROR : Can't open dsspfile "1e1yA.bssp"
#ERROR : Can't open dsspfile "1abbA.bssp"
#ERROR : Can't open dsspfile "1a8iA.bssp"
#ERROR : Can't open dsspfile "3e3lA.bssp"
#ERROR : Can't open dsspfile "3cuvA.bssp"
#ERROR : Can't open dsspfile "1b4dA.bssp"
#ERROR : Can't open dsspfile "1c8kA.bssp"
#ERROR : Can't open dsspfile "3e3nF.bssp"
#ERROR : Can't open dsspfile "1axrA.bssp"
#ERROR : Can't open dsspfile "2amvA.bssp"
#ERROR : Can't open dsspfile "3csoA.bssp"

## Summary of PDB Search
:185
    2e-53  49%  3e3nD  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    2e-53  49%  3e3nA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    2e-53  49%  3e3nH  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    1e-52  49%  3e3nB  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    8e-45  47%  1ahpA  [c.87.1] E.COLI MALTODEXTRIN PHOSPHORYLASE
    8e-45  47%  2ecpA  [c.87.1] MALTODEXTRIN PHOSPHORYLASE
    3e-31  98%  2c4mB  [x.x.x] GLYCOGEN PHOSPHORYLASE
    5e-30  98%  2c4mC  [x.x.x] GLYCOGEN PHOSPHORYLASE
    2e-29  49%  3ddsB  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    3e-29  88%  2c4mA  [x.x.x] GLYCOGEN PHOSPHORYLASE
    6e-29  46%  3e3oA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    8e-29  49%  2atiA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    1e-28  49%  3dd1B  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    4e-28  49%  3ddwB  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    5e-28  49%  3cejA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    8e-28  49%  3ddsA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-27  40%  3e3oB  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    2e-27  49%  3cehA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    8e-27  47%  1e4oA  [c.87.1] MALTODEXTRIN PHOSPHORYLASE
    8e-27  39%  3e3oD  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    1e-26  40%  3e3nC  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    1e-26  40%  3e3lC  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    2e-26  46%  3e3nE  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    2e-26  39%  3e3lB  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    5e-26  49%  1bx3A  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE B)
    7e-26  46%  3e3lD  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    2e-25  40%  3e3oC  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    2e-25  48%  1c8lA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
    2e-25  50%  1e1yA  [c.87.1] GLYCOGEN PHOSPHORYLASE
    2e-25  49%  1abbA  [c.87.1] GLYCOGEN PHOSPHORYLASE B
    7e-25  40%  1a8iA  [x.x.x] GLYCOGEN PHOSPHORYLASE B
    7e-25  34%  3e3lA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    7e-25  39%  3cuvA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-24  50%  1b4dA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE B)
    2e-21  50%  1c8kA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
    9e-21  34%  3e3nF  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-20  50%  1axrA  [x.x.x] GLYCOGEN PHOSPHORYLASE
    4e-19  49%  2amvA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
    4e-08   6%  3csoA  [x.x.x] RNA-DIRECTED RNA POLYMERASE
:185

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPASDVSEQISTAGKEASGTSNMKFMMNGALTLGTMDGANVEIVDSVGEENAYIFGARVEELPALRESYQ
3e3nD           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
3e3nA           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
3e3nH           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLQRGYN
3e3nB           IPAADLSEQISTAGTEASGTGNM-FMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDDRLDQRGYN
1ahpA           IPAADISEQISTAGKEASGTGNMKLALNGALTVGTLDGANVEIAEKVGEENIFIFGHTVKQVKAILAKYD
2ecpA           IPAADISEQISTAGKEASGTGNMKLALNGALTVGTLDGANVEIAEKVGEENIFIFGHTVKQVKAILAKYD
2c4mB           LPASDVSEQISTAGKEASGTSNMKFMMNGALTLGTMDGANVEIVDSVGEENAYIFGARVEELPALRESYK
2c4mC           LPASDVSEQISTAGKEASGTSNMKFMMNGALTLGTMDGANVEIVDSVGEENAYIFGARVEELPALRESYK
3ddsB           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKYE
2c4mA           LPASDVSEQISTAGKEASGTSNMKFMMNGALTLGTMDGANVEIVDSVGEENAYIFGAREELPARESYKPY
3e3oA           IPAADLSEQISTAGTEASGTGNMFMLNGA-LTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRYN
2atiA           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKYE
3dd1B           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKYE
3ddwB           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKYE
3cejA           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKYE
3ddsA           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKYE
3e3oB           IPAADLSEQISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEE-AGEENFFIFGMRVEDVDRLDQRYN
3cehA           IPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKYE
1e4oA           IPAADISEQISTAGKEASGTGNMKLALNGALTVGTLDGANVEIAEKVGEENIFIFGHTEQVKAILAKGYD
3e3oD           IPAADLSEQISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEE-AGEENFFIFGMRVEDVDRLDQRYN
3e3nC           IPAADLSEQISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEE-AGEENFFIFGMRVEDVDRLDQRYN
3e3lC           IPAADLSEQISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEE-AGEENFFIFGMRVEDVDRLDQRYN
3e3nE           IPAADLSEQISTAGTEASGTGNMFMLNGA-LTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRYN
3e3lB           IPAADLSEQISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEE-AGEENFFIFGMRVEDVDRLDQRYN
1bx3A           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRYN
3e3lD           IPAADLSEQISTAGTEASGTGNMFMLNGA-LTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRYN
3e3oC           IPAADLSEQISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEE-AGEENFFIFGMRVEDVDRLDQRYN
1c8lA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRYN
1e1yA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRYN
1abbA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRYN
1a8iA           IPAADLSEQISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEE-AGEENFFIFGMRVEDVDRLDQRYN
3e3lA           IPAADLSEQISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEEAGEEFFIFGMRVEDVDRLD-QRGYN
3cuvA           IPAADLSEQISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEEAG-EENFFIFGMRVEDVDRLDQRYN
1b4dA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRYN
1c8kA           -PAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRYN
3e3nF           IPAADLSEQISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRGYN
1axrA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDRGYN
2amvA           IPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRYN
3csoA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PYELYETVPGLKRALDALDNGTLNDNNSGLFYDLKHSLIHGYGKDASDTYYVLGDFADYRETRDRMAADY
3e3nD           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHH------DRFKVFADYEEYVKCQERVSALY
3e3nA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHH------DRFKVFADYEEYVKCQERVSALY
3e3nH           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHH------DRFKVFADYEEYVKCQERVSALY
3e3nB           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHH------DRFKVFADYEEYVKCQERVSALY
1ahpA           PVKWRKKDKVLDAVLKELESGKYSDGDKHAFDQMLHSIGKQGG----DPYLVMADFAAYVEAQKQVDVLY
2ecpA           PVKWRKKDKVLDAVLKELESGKYSDGDKHAFDQMLHSIGKQGG----DPYLVMADFAAYVEAQKQVDVLY
2c4mB           PYELYETVPGLKRALDALDNGTLNDNNSGLFYDLKHSLIHGYGKDASDTYYVLGDFADYRETRDRMAADY
2c4mC           PYELYETVPGLKRALDALDNGTLNDNNSGLFYDLKHSLIHGYGKDASDTYYVLGDFADYRETRDRMAADY
3ddsB           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYH------DRFKVFADYEAYVKCQDKVSQLY
2c4mA           ELYETVPG--LKRALDALDNGTLNDNNSGLFYDLKHSLIHGYGKDASDTYYVLGDFADYRETRDRMAADY
3e3oA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDR------FKVFADYEEYVKCQERVSALY
2atiA           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYH------DRFKVFADYEAYVKCQDKVSQLY
3dd1B           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYH------DRFKVFADYEAYVKCQDKVSQLY
3ddwB           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYH------DRFKVFADYEAYVKCQDKVSQLY
3cejA           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYH------DRFKVFADYEAYVKCQDKVSQLY
3ddsA           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYH------DRFKVFADYEAYVKCQDKVSQLY
3e3oB           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHH------DRFKVFADYEEYVKCQERVSALY
3cehA           AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYH------DRFKVFADYEAYVKCQDKVSQLY
1e4oA           PVKWRKKDKVLDAVLKELESGKYSDGDKHAFDQMLHSIGKQGG----DPYLVMADFAAYVEAQKQVDVLY
3e3oD           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDR------FKVFADYEEYVKCQERVSALY
3e3nC           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHH------DRFKVFADYEEYVKCQERVSALY
3e3lC           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHH------DRFKVFADYEEYVKCQERVSALY
3e3nE           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHH------DRFKVFADYEEYVKCQERVSALY
3e3lB           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDR------FKVFADYEEYVKCQERVSALY
1bx3A           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHH------DRFKVFADYEEYVKCQERVSALY
3e3lD           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHH------DRFKVFADYEEYVKCQERVSALY
3e3oC           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHH------DRFKVFADYEEYVKCQERVSALY
1c8lA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHH------DRFKVFADYEEYVKCQERVS-AL
1e1yA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHH------DRFKVFADYEEYVKCQERVSALY
1abbA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHH------DRFKVFADYEEYVKCQERVSALY
1a8iA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHH------DRFKVFADYEEYVKCQERVSALY
3e3lA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDR------FKVFADYEEYVKCQERVSALY
3cuvA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHH------DRFKVFADYEEYVKCQERVSALY
1b4dA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHH------DRFKVFADYEEYVKCQERVSALY
1c8kA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHH------DRFKVFADYEEYVKCQERVSALY
3e3nF           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHH------DRFKVFADYEEYVKCQERVSALY
1axrA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHH------DRFKVFADYEEYVKCQERVSALY
2amvA           AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHH------DRFKVFADYEEYVKCQERVSALY
3csoA           -----------------------------------------------SAFTLHSYSPGEINRVASCLRKL


                         +         .         .         .         .         *         .:210
query           ASDPLGWARMAWINICESGRFSSDRTIRDYATEIWKLKPTPAVKx
3e3nD           K-NPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSR----
3e3nA           K-NPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSR----
3e3nH           K-NPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSR----
3e3nB           K-NPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSR----
1ahpA           -RDQEAWTRAAILNTARCGMFSSDRSIRDYQARIWQAA-------
2ecpA           -RDQEAWTRAAILNTARCGMFSSDRSIRDYQARIWQAA-------
2c4mB           ASDPLGWARMAWINICESGRFSSDRTIRDYATEIWKLEPTPAV--
2c4mC           ASDPLGWARMAWINICESGRFSSDRTIRDYATEIWKLEPTPAVK-
3ddsB           -MNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
2c4mA           ASDPLGWARMAWINICESGRFSSDRTIRDYATEIWKLEPTPA---
3e3oA           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSR----
2atiA           M-NPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
3dd1B           M-NPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
3ddwB           M-NPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
3cejA           M-NPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEP------
3ddsA           M-NPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS-----
3e3oB           K-NPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSR----
3cehA           M-NPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEP------
1e4oA           -RDQEAWTRAAILNTARCGMFSSDRSIRDYQARIWQAK-------
3e3oD           K-NPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSR----
3e3nC           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSR----
3e3lC           K-NPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSR----
3e3nE           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSR----
3e3lB           K-NPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSR----
1bx3A           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQR--
3e3lD           K-NPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSR----
3e3oC           -KNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSR----
1c8lA           YKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSR----
1e1yA           K-NPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEP------
1abbA           K-NPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSR----
1a8iA           K-NPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSR----
3e3lA           K-NPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSR----
3cuvA           K-NPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSR----
1b4dA           K-NPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEP------
1c8kA           K-NPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSR----
3e3nF           K-NPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSR----
1axrA           K-NPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEP------
2amvA           KNPR-EWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSR----
3csoA           GVPPLRTWRHRARSVAKLLSQGGRAATCGRYLFNWAVRT------