[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF54563.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2cd7A.bssp"
#ERROR : Can't open dsspfile "2cwdB.bssp"
#ERROR : Can't open dsspfile "2cwdC.bssp"
#ERROR : Can't open dsspfile "1d2aA.bssp"
#ERROR : Can't open dsspfile "2cwdA.bssp"
#ERROR : Can't open dsspfile "1d1qA.bssp"
#ERROR : Can't open dsspfile "1dg9A.bssp"
#ERROR : Can't open dsspfile "1c0eA.bssp"
#ERROR : Can't open dsspfile "1d1pA.bssp"
#ERROR : Can't open dsspfile "1d1pB.bssp"
#ERROR : Can't open dsspfile "1d1qB.bssp"

## Summary of PDB Search
:140
    3e-19  27%  2cd7A  [x.x.x] PROTEIN ARSC
    2e-15  21%  2cwdB  [x.x.x] LOW MOLECULAR WEIGHT PHOSPHOTYROSINE PROTEIN
    3e-14  20%  2cwdC  [x.x.x] LOW MOLECULAR WEIGHT PHOSPHOTYROSINE PROTEIN
    6e-14  16%  1d2aA  [c.44.1] TYROSINE PHOSPHATASE
    1e-13  21%  2cwdA  [x.x.x] LOW MOLECULAR WEIGHT PHOSPHOTYROSINE PROTEIN
    2e-13  15%  1d1qA  [c.44.1] TYROSINE PHOSPHATASE (E.C.3.1.3.48)
    2e-11  13%  1dg9A  [c.44.1] TYROSINE PHOSPHATASE
    2e-10  13%  1c0eA  [c.44.1] PROTEIN (TYROSINE PHOSPHATASE (ORTHOPHOSPHORIC
    6e-10  15%  1d1pA  [c.44.1] TYROSINE PHOSPHATASE
    1e-08  12%  1d1pB  [c.44.1] TYROSINE PHOSPHATASE
    1e-06  11%  1d1qB  [c.44.1] TYROSINE PHOSPHATASE (E.C.3.1.3.48)
:140

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIDQPSVLFVCVGNGGKSQMXXXXXXXXXXXXXEIHSAGTKPGTKLNQQSLESIAEVGADMSQGFPKGID
2cd7A           --DKKTIYFICTGNSCRSQMAEGWGKEILGEGWNVYSAGIET-HGVNPKAIEAMKEVDIDISNQTSDLID
2cwdB           MDRPVRVLFVCLGNICRSPMRKLLKERGLEDRFEVDSAGTHVGEPMDPRARRVLEEEGAYFP-HVARRLT
2cwdC           -----RVLFVCLGNICRSPMRKLLKERGLEDRFEVDSAGTHVGEPMDPRARRVLEEEGAYFP-HVARRLT
1d2aA           ---KISVAFIALGNFCRSPMHEVEKANLENRFNKIDSFGTSVGESPDHRTVSICKQHGVKIN-HKGKQIK
2cwdA           -----RVLFVCLGNICRSPMRKLLKERGLEDRFEVDSAGTHVGEPMDPRARRVLEEEGAYFP-HVARRLT
1d1qA           IEKPKSVAFIALGNFCRSPMHEVEKANLENRFNKIDSFGTSVGESPDHRTVSICKQHGVKINHKGKQIKT
1dg9A           ----KSVLFVCLGNICRSPIRKLVTDQNISDNWVIDSGAVSVGRSPDPRAVSCLRNHGINTAHKARQ-VT
1c0eA           ----KSVLFVCLGNICRAPIRKLVTDQNISDNWVIDSGAVSVGRSPDPRAVSCLRNHGINTA-HKARQVT
1d1pA           ---KISVAFICLGNFCRSPMHEVEKANLENRFNKIDSFGTSVGESPDHRTVSICKQHGVKINHKGKQIKT
1d1pB           --PKISVAFICLGNFCRSPMEKANLENRFNKIDSFGTSNYHVGESPDHRTVSICKQHGVKINHKGKQIKT
1d1qB           --PKISVAFIALGNFCRSPMEKANLENRFNKIDSFGTSNYHVGESPDHRTVSICKQHGVKIN-HKGKQIK


                         .         .         *         .         .         .         .:140
query           LDLIRRVDRVIILGAEAQLEMPINANGTLQRWLTDEPSERGIEGMERMRLVRDDIDARVQNLIAELxxxx
2cd7A           NDILKQSDLVVTLCSDADNNCPLPPNVKKEHWGFDDPAGKEWSEFQR---VRDEIKLAIEKFKL------
2cwdB           REDVLAYDHILVMDRENLEEVLRRFPEARGKLVLEELGGGEVGDLEDFREVYWTLEAALQAFLDRH----
2cwdC           REDVLAYDHILVMENLEEVLRRFPEARGKVRLVLEELGGGEVGDLEDFREVYWTLEAALQAFLDRH----
1d2aA           TKHFDEYDYIIGMDESNINNLSKAKVCLFGDWNTNDGTVQTIGDIQDFEYNFKQITYFSKQFLKKE----
2cwdA           REDVLAYDHILVMDRENLEEVLRRFPEARGKLVLEELGGGEVGDLEDFREVYWTLEAALQAFLDRH----
1d1qA           -KHFDEYDYIIGMDESNINNLPEGSKALFGDWNTNDGTVQTIGDIQDFEYNFKQITYFSKQFLKKE----
1dg9A           KEDFVTFDYILCMDESNLELLGSYDPQK--QLIIEDPYYGNDADFET---VYQQCVRCCRAFLEKV----
1c0eA           KEDFVTFDYILCMDESNLRDLNRKSNQLLGSYDPQKQLIGNDADFET---VYQQCVRCCRAFLEKV----
1d1pA           KHF--DEYDYIIGMDESNINNLKKIQPLFGDWNTNDGTVQTYGDIQDFEYNFKQITYFSKQFLKKE----
1d1pB           KHF--DEYDYIIGMDESNINNLKKIQPLFGDWNTNDGTVQTYGDIQDFEYNFKQITYFSKQFLKKE----
1d1qB           TKHFDEYDYIIGMEGSKAKVCLFGDWNTNDGTVQTIIEDPWYGDIQDFEYNFKQITYFSKQFLKKE----