[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF54728.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3ehwB.bssp"
#ERROR : Can't open dsspfile "3ehwA.bssp"
#ERROR : Can't open dsspfile "3c3iB.bssp"
#ERROR : Can't open dsspfile "3ca9B.bssp"
#ERROR : Can't open dsspfile "3c2tA.bssp"
#ERROR : Can't open dsspfile "3c2tB.bssp"
#ERROR : Can't open dsspfile "3ca9A.bssp"
#ERROR : Can't open dsspfile "3c3iA.bssp"
#ERROR : Can't open dsspfile "3c3iD.bssp"
#ERROR : Can't open dsspfile "2bazA.bssp"
#ERROR : Can't open dsspfile "1dupA.bssp"
#ERROR : Can't open dsspfile "2d4lA.bssp"
#ERROR : Can't open dsspfile "2d4mA.bssp"
#ERROR : Can't open dsspfile "1dunA.bssp"
#ERROR : Can't open dsspfile "3ecyA.bssp"
#ERROR : Can't open dsspfile "1ducA.bssp"
#ERROR : Can't open dsspfile "2d4nA.bssp"
#ERROR : Can't open dsspfile "1dutA.bssp"
#ERROR : Can't open dsspfile "2bsyA.bssp"
#ERROR : Can't open dsspfile "2bt1A.bssp"

## Summary of PDB Search
:149
    5e-33  39%  3ehwB  [x.x.x] DUTP PYROPHOSPHATASE
    3e-32  41%  3ehwA  [x.x.x] DUTP PYROPHOSPHATASE
    4e-32  39%  3c3iB  [x.x.x] DEOXYURIDINE TRIPHOSPHATASE
    5e-31  41%  3ca9B  [x.x.x] DEOXYURIDINE TRIPHOSPHATASE
    8e-31  41%  3c2tA  [x.x.x] DEOXYURIDINE TRIPHOSPHATASE
    3e-29  39%  3c2tB  [x.x.x] DEOXYURIDINE TRIPHOSPHATASE
    6e-29  42%  3ca9A  [x.x.x] DEOXYURIDINE TRIPHOSPHATASE
    7e-29  41%  3c3iA  [x.x.x] DEOXYURIDINE TRIPHOSPHATASE
    1e-28  41%  3c3iD  [x.x.x] DEOXYURIDINE TRIPHOSPHATASE
    3e-28  31%  2bazA  [x.x.x] HYPOTHETICAL PROTEIN BSU20020
    1e-27  37%  1dupA  [b.85.4] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    6e-26  32%  2d4lA  [x.x.x] DU
    6e-26  34%  2d4mA  [x.x.x] DU
    1e-25  33%  1dunA  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEODITOHYDROLASE
    2e-25  33%  3ecyA  [x.x.x] CG4584-PA, ISOFORM A (BCDNA.LD08534)
    4e-25  30%  1ducA  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEODITOHYDROLASE
    4e-24  36%  2d4nA  [x.x.x] DU
    5e-22  38%  1dutA  [b.85.4] DUTP PYROPHOSPHATASE
    3e-19  18%  2bsyA  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    4e-11  19%  2bt1A  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
:149

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxLAPIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLA
3ehwB           ------LRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLA
3ehwA           ------LRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLA
3c3iB           ------LLVKKLVESATTPMRGSEGAAGYDISSVEDVVVPAMGRIAVSTGISIRVPDGTYGRIAPRSGLA
3ca9B           ---MSSLLVKKLVESATTPMRGSEGAAGYDISSVEDVVVPAMGRIAVSTGISIRVPDGTYGRIAPRSGLA
3c2tA           ---MSSLLVKKLVESATTPMRGSEGAAGYDISSVEDVVVPAMGRIAVSTGISIRVPDGTYGRIAPRSGLA
3c2tB           ---MSSLLVKKLVESATTPMRGSEGAAGYDISSVEDVVVPAMGRIAVSTGISIRVPDGTYGRIAPRSGLA
3ca9A           ------LLVKKLVESATTPMRGSEGAAGYDISSVEDVVVPAMGRIAVSTGISIRVPDGTYGRIAPRSGLA
3c3iA           ------LLVKKLVESATTPMRGSEGAAGYDISSVEDVVVPAMGRIAVSTGISIRVPDGTYGRIAPRSGLA
3c3iD           ----SSLLVKKLVESATTPMRGSEGAAGYDISSVEDVVVPAMGRIAVSTGISIRVPDGTYGRIAPRSGLA
2bazA           ------IKIKYLDET-QTRINKMEQGDWIDLRAAEDVAIKKDEFKLVPLGVAMELPEGYEAHVVPRSSTY
1dupA           ------ILDPRVGKEFPLPTYATSGSAGLDLRACLNDELAPGDTTLVPTGLAIHIAPSLAAMMLPRSGLG
2d4lA           ------------KQPISKLTRATPGSAGLDLSTSHTVLTPEMGPQALSTGIYGPLPPNTFGLILGRSSIT
2d4mA           --------------PISKLTRATPGSAGLDLSTSHTVLTPEMGPQALSTGIYGPLPPNTFGLILGRSSIT
1dunA           -----------LAYQGTQIKEKRDEDAGFDLCVPYDIMIPVSDTKIIPTDVKIQVPPNSFGWVTGKSSM-
3ecyA           ------LRFAKLTENALEPVRGSAKAAGVDLRSAYDVVVPARGKAIVKTDLQVQVPEGSYGRVAPRFID-
1ducA           -----------LAYQGTQIKEKRDEDAGFDLCVPYDIMIPVSDTKIIPTDVKIQVPPNSFGWVTGKSSMA
2d4nA           --------------PISKLTRATPGSAGLDLCSTSHTVLTPEMPQALSTGIYGPLPPNTFGLILGRSSIT
1dutA           -----------------LDKRS--EDAGYDLLAAKEIHLLPGEVKVIPTGVKLMLPKGYWGLIIGKSSIG
2bsyA           ------IRYAFQNDKLLLQ---QASVGRLTLVNKTTILLRPMKTTTVDLGLYARPPEGHGLMLWGSTSRP
2bt1A           ---------IRYAFQNDKLLLQQASVGRLTLVNKTTILLRPMKTTTVDLGLYARPPEGHGLMLWGST---


                         .         .         *         .         .         .         .:140
query           AREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVRGDQ
3ehwB           AKHFIDVG--AGVIDEDYRGNVGVVLFNF-GKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSG
3ehwA           AKHF--IDVGAGVIDEDYRGNVGVVLFNFGKE-KFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSG
3c3iB           YKYGIDVL--AGVIDSDYRGEVKVILYNT-TERDYIIKKGDRIAQLILEQIVTPGVAVVLDLSDTARGSG
3ca9B           YKYG--IDVLAGVIDEDYTGEVKVILYNT-TERDYIIKKGDRIAQLILEQ--------------------
3c2tA           YKYG--IDVLAGVIDEDYTGEVKVILYNT-TERDYIIKKGDRIAQLILEQ--------------------
3c2tB           YKYGIDV--LAGVIDEDYTGEVKVILYNTTER-DYIIKKGDRIAQLILEQ--------------------
3ca9A           YKYG--IDVLAGVIDEDYTGEVKVILYNT-TERDYIIKKGDRIAQLILEQ--------------------
3c3iA           YKYGIDV--LAGVIDSDYRGEVKVILYNTTER-DYIIKKGDRIAQLILEQ--------------------
3c3iD           YKYGIDV--LAGVIDSDYRGEVKVILYNTTER-DYIIKKGDRIAQLILEQ--------------------
2bazA           KNFGVIQTNSMGVIDESYKGDNDFWFFPAYALRDTKIKKGDRICQFRIMK--------------------
1dupA           HKHGIVLGNLVGLIDSDYQGQLMISVWNRGQD-SFTIQPGERIAQMIFVP--------------------
2d4lA           MKGLQ---VYPGVIDNDYTGEIKIMAKAVNN--IVTVSQGNRIAQLILLP--------------------
2d4mA           MKGL--QVY-PGVIDNDYTGEIKIMAKAVNN--IVTVSQGNRIAQLILLP--------------------
1dunA           AKQGLLI--NGGIIDEGYTGEIQVICTNI-GKSNIKLIEGQKFAQLIILQ--------------------
3ecyA           --------VGAGVVDEDYRGNLGVVLFNHSDV-DFEVKHGDRIAQFICER--------------------
1ducA           KQ---GLLINGGIIDEGYTGEIQVICTNI-GKSNIKLIEGQKFAQLIILQ--------------------
2d4nA           MKGLQVY---PGVIDNDYTGEIKIMAKAVNN--IVTVSQGNRIAQLILLP--------------------
1dutA           SK---GLDVLGGVIDEGYRGEIGVIMINV-SRKSITLMERQKIAQLIILP--------------------
2bsyA           ------VTSHVGIIDPGYTGELRLILQNQRRY-NSTLRPSELKIHLAAFR--------------------
2bt1A           ---SRPVTSHVGIIDPGYTGELRLILQN------------------------------------------


                         +         .         .         .         .         *         .:210
query           GYGSTGKxx
3ehwB           GFGSTGK--
3ehwA           GFGSTGK--
3c3iB           GFG------
3ca9B           ---------
3c2tA           ---------
3c2tB           ---------
3ca9A           ---------
3c3iA           ---------
3c3iD           ---------
2bazA           ---------
1dupA           ---------
2d4lA           ---------
2d4mA           ---------
1dunA           ---------
3ecyA           ---------
1ducA           ---------
2d4nA           ---------
1dutA           ---------
2bsyA           ---------
2bt1A           ---------