[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF54831.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bg1A.bssp"
#ERROR : Can't open dsspfile "3dwkC.bssp"
#ERROR : Can't open dsspfile "3dwkD.bssp"
#ERROR : Can't open dsspfile "3dwkB.bssp"
#ERROR : Can't open dsspfile "2c5wB.bssp"
#ERROR : Can't open dsspfile "2bg4A.bssp"
#ERROR : Can't open dsspfile "2bg4B.bssp"
#ERROR : Can't open dsspfile "2c6wB.bssp"
#ERROR : Can't open dsspfile "3czdA.bssp"
#ERROR : Can't open dsspfile "1alqA.bssp"
#ERROR : Can't open dsspfile "2drwE.bssp"
#ERROR : Can't open dsspfile "1e4dB.bssp"
#ERROR : Can't open dsspfile "1e4dA.bssp"
#ERROR : Can't open dsspfile "1e4dC.bssp"
#ERROR : Can't open dsspfile "1bsgA.bssp"
#ERROR : Can't open dsspfile "1djbA.bssp"
#ERROR : Can't open dsspfile "1e3uA.bssp"
#ERROR : Can't open dsspfile "1djaA.bssp"
#ERROR : Can't open dsspfile "3bfeA.bssp"
#ERROR : Can't open dsspfile "1e3uC.bssp"
#ERROR : Can't open dsspfile "1bt5A.bssp"
#ERROR : Can't open dsspfile "3e2lA.bssp"
#ERROR : Can't open dsspfile "1e3uD.bssp"
#ERROR : Can't open dsspfile "3bffA.bssp"
#ERROR : Can't open dsspfile "4blmA.bssp"
#ERROR : Can't open dsspfile "2cc1A.bssp"
#ERROR : Can't open dsspfile "2b5rA.bssp"
#ERROR : Can't open dsspfile "3dwkA.bssp"
#ERROR : Can't open dsspfile "1blpA.bssp"
#ERROR : Can't open dsspfile "3dw0A.bssp"
#ERROR : Can't open dsspfile "1dy6A.bssp"
#ERROR : Can't open dsspfile "3cmzA.bssp"
#ERROR : Can't open dsspfile "1ck3A.bssp"
#ERROR : Can't open dsspfile "1blcA.bssp"
#ERROR : Can't open dsspfile "2bcfA.bssp"
#ERROR : Can't open dsspfile "3bfdA.bssp"
#ERROR : Can't open dsspfile "3e2kA.bssp"
#ERROR : Can't open dsspfile "3c5aA.bssp"
#ERROR : Can't open dsspfile "1e25A.bssp"
#ERROR : Can't open dsspfile "3bydA.bssp"
#ERROR : Can't open dsspfile "1bueA.bssp"
#ERROR : Can't open dsspfile "2dnsE.bssp"
#ERROR : Can't open dsspfile "3dw0B.bssp"
#ERROR : Can't open dsspfile "3cjmA.bssp"
#ERROR : Can't open dsspfile "2blsA.bssp"
#ERROR : Can't open dsspfile "3dtmA.bssp"
#ERROR : Can't open dsspfile "1bzaA.bssp"
#ERROR : Can't open dsspfile "3brmA.bssp"
#ERROR : Can't open dsspfile "2dnsA.bssp"
#ERROR : Can't open dsspfile "2dnsC.bssp"
#ERROR : Can't open dsspfile "1dkiC.bssp"
#ERROR : Can't open dsspfile "2e8iA.bssp"
#ERROR : Can't open dsspfile "2bc3B.bssp"
#ERROR : Can't open dsspfile "2efuE.bssp"
#ERROR : Can't open dsspfile "3bq8B.bssp"
#ERROR : Can't open dsspfile "2dcfA.bssp"
#ERROR : Can't open dsspfile "2bsbA.bssp"
#ERROR : Can't open dsspfile "2d0aA.bssp"
#ERROR : Can't open dsspfile "2bc3A.bssp"
#ERROR : Can't open dsspfile "1ci9A.bssp"
#ERROR : Can't open dsspfile "2efuF.bssp"
#ERROR : Can't open dsspfile "3brmB.bssp"

## Summary of PDB Search
:622
    7e-36  15%  2bg1A  [x.x.x] PENICILLIN-BINDING PROTEIN 1B
    8e-36  16%  3dwkC  [x.x.x] PENICILLIN-BINDING PROTEIN 2
    4e-35  14%  3dwkD  [x.x.x] PENICILLIN-BINDING PROTEIN 2
    2e-34  15%  3dwkB  [x.x.x] PENICILLIN-BINDING PROTEIN 2
    5e-31  19%  2c5wB  [x.x.x] PENICILLIN-BINDING PROTEIN 1A
    4e-30  14%  2bg4A  [x.x.x] PENICILLIN-BINDING PROTEIN 1B
    1e-29  16%  2bg4B  [x.x.x] PENICILLIN-BINDING PROTEIN 1B
    3e-28  18%  2c6wB  [x.x.x] PENICILLIN-BINDING PROTEIN 1A
    4e-27  13%  3czdA  [x.x.x] GLUTAMINASE KIDNEY ISOFORM
    7e-23  11%  1alqA  [x.x.x] CP254 BETA-LACTAMASE
    1e-22  12%  2drwE  [x.x.x] D-AMINO ACID AMIDASE
    1e-21  11%  1e4dB  [e.3.1] BETA-LACTAMASE OXA-10
    5e-21  10%  1e4dA  [e.3.1] BETA-LACTAMASE OXA-10
    6e-21  10%  1e4dC  [e.3.1] BETA-LACTAMASE OXA-10
    5e-20  12%  1bsgA  [x.x.x] BETA LACTAMASE
    2e-19  12%  1djbA  [x.x.x] BETA-LACTAMASE
    4e-19  12%  1e3uA  [e.3.1] BETA-LACTAMASE OXA-10
    3e-18  11%  1djaA  [x.x.x] BETA-LACTAMASE
    4e-18  12%  3bfeA  [x.x.x] CLASS A BETA-LACTAMASE SED1
    8e-18  13%  1e3uC  [e.3.1] BETA-LACTAMASE OXA-10
    2e-17  17%  1bt5A  [e.3.1] PROTEIN (BETA-LACTAMASE)
    9e-17  12%  3e2lA  [x.x.x] CARBAPENEMASE
    2e-16  15%  1e3uD  [e.3.1] BETA-LACTAMASE OXA-10
    3e-16  14%  3bffA  [x.x.x] CLASS A BETA-LACTAMASE SED1
    3e-16  14%  4blmA  [e.3.1] BETA-LACTAMASE
    3e-16  16%  2cc1A  [e.3.1 (1mfoA)] BETA-LACTAMASE
    3e-16  18%  2b5rA  [x.x.x] BETA-LACTAMASE TEM
    4e-16  15%  3dwkA  [x.x.x] PENICILLIN-BINDING PROTEIN 2
    8e-16  12%  1blpA  [x.x.x] BETA-LACTAMASE
    2e-15  16%  3dw0A  [x.x.x] CLASS A CARBAPENEMASE KPC-2
    4e-15  14%  1dy6A  [e.3.1] CARBAPENEM-HYDROLYSING BETA-LACTAMASE SME-1
    4e-15  17%  3cmzA  [x.x.x] BETA-LACTAMASE TEM
    4e-15  17%  1ck3A  [e.3.1] BETA-LACTAMASE
    5e-15  11%  1blcA  [x.x.x] BETA-LACTAMASE
    9e-15  14%  2bcfA  [x.x.x] PROBABLE D-ALANYL-D-ALANINE CARBOXYPEPTIDASE
    2e-14  15%  3bfdA  [x.x.x] CLASS A BETA-LACTAMASE SED1
    4e-14  16%  3e2kA  [x.x.x] CARBAPENEMASE
    5e-14  14%  3c5aA  [x.x.x] CLASS A CARBAPENEMASE KPC-2
    6e-14  15%  1e25A  [e.3.1] EXTENDED-SPECTRUM BETA-LACTAMASE PER-1
    3e-13  15%  3bydA  [x.x.x] BETA-LACTAMASE OXY-1
    3e-13  13%  1bueA  [e.3.1] PROTEIN (IMIPENEM-HYDROLYSING BETA-LACTAMASE)
    5e-13  10%  2dnsE  [x.x.x] D-AMINO ACID AMIDASE
    7e-13  15%  3dw0B  [x.x.x] CLASS A CARBAPENEMASE KPC-2
    8e-13  14%  3cjmA  [x.x.x] PUTATIVE BETA-LACTAMASE
    1e-12  12%  2blsA  [e.3.1] AMPC BETA-LACTAMASE
    3e-12  18%  3dtmA  [x.x.x] BETA-LACTAMASE
    8e-12  15%  1bzaA  [x.x.x] BETA-LACTAMASE
    2e-11  11%  3brmA  [x.x.x] GLUTAMINASE 1
    3e-11  15%  2dnsA  [x.x.x] D-AMINO ACID AMIDASE
    2e-09  14%  2dnsC  [x.x.x] D-AMINO ACID AMIDASE
    3e-09   6%  1dkiC  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    9e-08  12%  2e8iA  [x.x.x] 6-AMINOHEXANOATE-DIMER HYDROLASE
    1e-07  14%  2bc3B  [x.x.x] STREPTAVIDIN
    3e-07  14%  2efuE  [x.x.x] D-AMINO ACID AMIDASE
    6e-07  11%  3bq8B  [x.x.x] SENSOR PROTEIN PHOQ
    7e-07  11%  2dcfA  [x.x.x] 6-AMINOHEXANOATE-DIMER HYDROLASE
    6e-06   7%  2bsbA  [x.x.x] F17G ADHESIN SUBUNIT
    8e-06  12%  2d0aA  [x.x.x] RIBONUCLEASE HIII
    5e-05  14%  2bc3A  [x.x.x] STREPTAVIDIN
    9e-05  19%  1ci9A  [e.3.1] PROTEIN (CARBOXYLESTERASE)
    8e-04  18%  2efuF  [x.x.x] D-AMINO ACID AMIDASE
    0.001  15%  3brmB  [x.x.x] GLUTAMINASE 1
:622

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bg1A           ----------------------------------------------------------------------
3dwkC           ----------------------------------------------------------------------
3dwkD           ----------------------------------------------------------------------
3dwkB           ----------------------------------------------------------------------
2c5wB           ----------------------------------------------------------------------
2bg4A           ----------------------------------------------------------------------
2bg4B           ----------------------------------------------------------------------
2c6wB           ----------------------------------------------------------------------
3czdA           ----------------------------------------------------------------------
1alqA           ----------------------------------------------------------------------
2drwE           ----------------------------------------------------------------------
1e4dB           ----------------------------------------------------------------------
1e4dA           ----------------------------------------------------------------------
1e4dC           ----------------------------------------------------------------------
1bsgA           ----------------------------------------------------------------------
1djbA           ----------------------------------------------------------------------
1e3uA           ----------------------------------------------------------------------
1djaA           ----------------------------------------------------------------------
3bfeA           ----------------------------------------------------------------------
1e3uC           ----------------------------------------------------------------------
1bt5A           ----------------------------------------------------------------------
3e2lA           ----------------------------------------------------------------------
1e3uD           ----------------------------------------------------------------------
3bffA           ----------------------------------------------------------------------
4blmA           ----------------------------------------------------------------------
2cc1A           ----------------------------------------------------------------------
2b5rA           ----------------------------------------------------------------------
3dwkA           ----------------------------------------------------------------------
1blpA           ----------------------------------------------------------------------
3dw0A           ----------------------------------------------------------------------
1dy6A           ----------------------------------------------------------------------
3cmzA           ----------------------------------------------------------------------
1ck3A           ----------------------------------------------------------------------
1blcA           ----------------------------------------------------------------------
2bcfA           ----------------------------------------------------------------------
3bfdA           ----------------------------------------------------------------------
3e2kA           ----------------------------------------------------------------------
3c5aA           ----------------------------------------------------------------------
1e25A           ----------------------------------------------------------------------
3bydA           ----------------------------------------------------------------------
1bueA           ----------------------------------------------------------------------
2dnsE           ----------------------------------------------------------------------
3dw0B           ----------------------------------------------------------------------
3cjmA           ----------------------------------------------------------------------
2blsA           ----------------------------------------------------------------------
3dtmA           ----------------------------------------------------------------------
1bzaA           ----------------------------------------------------------------------
3brmA           ----------------------------------------------------------------------
2dnsA           ----------------------------------------------------------------------
2dnsC           ----------------------------------------------------------------------
1dkiC           ----------------------------------------------------------------------
2e8iA           ----------------------------------------------------------------------
2bc3B           ----------------------------------------------------------------------
2efuE           ----------------------------------------------------------------------
3bq8B           ----------------------------------------------------------------------
2dcfA           ----------------------------------------------------------------------
2bsbA           ----------------------------------------------------------------------
2d0aA           ----------------------------------------------------------------------
2bc3A           ----------------------------------------------------------------------
1ci9A           ----------------------------------------------------------------------
2efuF           ----------------------------------------------------------------------
3brmB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWTVRWEPSLVHPKLGANQ
2bg1A           ----------------------------------------------------------------------
3dwkC           ----------------------------------------------------------------------
3dwkD           ----------------------------------------------------------------------
3dwkB           ----------------------------------------------------------------------
2c5wB           ----------------------------------------------------------------------
2bg4A           ----------------------------------------------------------------------
2bg4B           ----------------------------------------------------------------------
2c6wB           ----------------------------------------------------------------------
3czdA           ----------------------------------------------------------------------
1alqA           ----------------------------------------------------------------------
2drwE           ----------------------------------------------------------------------
1e4dB           ----------------------------------------------------------------------
1e4dA           ----------------------------------------------------------------------
1e4dC           ----------------------------------------------------------------------
1bsgA           ----------------------------------------------------------------------
1djbA           ----------------------------------------------------------------------
1e3uA           ----------------------------------------------------------------------
1djaA           ----------------------------------------------------------------------
3bfeA           ----------------------------------------------------------------------
1e3uC           ----------------------------------------------------------------------
1bt5A           ----------------------------------------------------------------------
3e2lA           ----------------------------------------------------------------------
1e3uD           ----------------------------------------------------------------------
3bffA           ----------------------------------------------------------------------
4blmA           ----------------------------------------------------------------------
2cc1A           ----------------------------------------------------------------------
2b5rA           ----------------------------------------------------------------------
3dwkA           ----------------------------------------------------------------------
1blpA           ----------------------------------------------------------------------
3dw0A           ----------------------------------------------------------------------
1dy6A           ----------------------------------------------------------------------
3cmzA           ----------------------------------------------------------------------
1ck3A           ----------------------------------------------------------------------
1blcA           ----------------------------------------------------------------------
2bcfA           ----------------------------------------------------------------------
3bfdA           ----------------------------------------------------------------------
3e2kA           ----------------------------------------------------------------------
3c5aA           ----------------------------------------------------------------------
1e25A           ----------------------------------------------------------------------
3bydA           ----------------------------------------------------------------------
1bueA           ----------------------------------------------------------------------
2dnsE           ----------------------------------------------------------------------
3dw0B           ----------------------------------------------------------------------
3cjmA           ----------------------------------------------------------------------
2blsA           ----------------------------------------------------------------------
3dtmA           ----------------------------------------------------------------------
1bzaA           ----------------------------------------------------------------------
3brmA           ----------------------------------------------------------------------
2dnsA           ----------------------------------------------------------------------
2dnsC           ----------------------------------------------------------------------
1dkiC           ----------------------------------------------------------------------
2e8iA           ----------------------------------------------------------------------
2bc3B           ----------------------------------------------------------------------
2efuE           ----------------------------------------------------------------------
3bq8B           ----------------------------------------------------FRLLRGESNLFYTLAKWE
2dcfA           ----------------------------------------------------------------------
2bsbA           ----------------------------------------------------------------------
2d0aA           ----------------------------------------------------------------------
2bc3A           ----------------------------------------------------------------------
1ci9A           ----------------------------------------------------------------------
2efuF           ----------------------------------------------------------------------
3brmB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           HLELRAIEAQRANVISSDGAPVLAPGSIYRVLADPSAGDADVVVKRVADYLNEAHATDENVNTLDVEDIM
2bg1A           ----------------------------------------------------------------------
3dwkC           ----------------------------------------------------------------------
3dwkD           ----------------------------------------------------------------------
3dwkB           ----------------------------------------------------------------------
2c5wB           ----------------------------------------------------------------------
2bg4A           ----------------------------------------------------------------------
2bg4B           ----------------------------------------------------------------------
2c6wB           ----------------------------------------------------------------------
3czdA           ----------------------------------------------------------------------
1alqA           ----------------------------------------------------------------------
2drwE           ----------------------------------------------------------------------
1e4dB           ----------------------------------------------------------------------
1e4dA           ----------------------------------------------------------------------
1e4dC           ----------------------------------------------------------------------
1bsgA           ----------------------------------------------------------------------
1djbA           ----------------------------------------------------------------------
1e3uA           ----------------------------------------------------------------------
1djaA           ----------------------------------------------------------------------
3bfeA           ----------------------------------------------------------------------
1e3uC           ----------------------------------------------------------------------
1bt5A           ----------------------------------------------------------------------
3e2lA           ----------------------------------------------------------------------
1e3uD           ----------------------------------------------------------------------
3bffA           ----------------------------------------------------------------------
4blmA           ----------------------------------------------------------------------
2cc1A           ----------------------------------------------------------------------
2b5rA           ----------------------------------------------------------------------
3dwkA           ----------------------------------------------------------------------
1blpA           ----------------------------------------------------------------------
3dw0A           ----------------------------------------------------------------------
1dy6A           ----------------------------------------------------------------------
3cmzA           ----------------------------------------------------------------------
1ck3A           ----------------------------------------------------------------------
1blcA           ----------------------------------------------------------------------
2bcfA           ----------------------------------------------------------------------
3bfdA           ----------------------------------------------------------------------
3e2kA           ----------------------------------------------------------------------
3c5aA           ----------------------------------------------------------------------
1e25A           ----------------------------------------------------------------------
3bydA           ----------------------------------------------------------------------
1bueA           ----------------------------------------------------------------------
2dnsE           ----------------------------------------------------------------------
3dw0B           ----------------------------------------------------------------------
3cjmA           ----------------------------------------------------------------------
2blsA           ----------------------------------------------------------------------
3dtmA           ----------------------------------------------------------------------
1bzaA           ----------------------------------------------------------------------
3brmA           ----------------------------------------------------------------------
2dnsA           ----------------------------------------------------------------------
2dnsC           ----------------------------------------------------------------------
1dkiC           ----------------------------------------------------------------------
2e8iA           ----------------------------------------------------------------------
2bc3B           ----------------------------------------------------------------------
2efuE           ----------------------------------------------------------------------
3bq8B           NNKLHVELPPTTLIYDENGQLLWAQRDVPWLKIQPDW-LKSNGFHEIEADVNDTSLLLSGSIQQQLQEVR
2dcfA           ----------------------------------------------------------------------
2bsbA           ----------------------------------------------------------------------
2d0aA           ----------------------------------------------------------------------
2bc3A           ----------------------------------------------------------------------
1ci9A           ----------------------------------------------------------------------
2efuF           ----------------------------------------------------------------------
3brmB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           SNLGDSTYSLTTVDANLGARMEQDLAGIPGLTFxEEASMVATDPGFAPDIVSRVARIVEDELEGSNGWRA
2bg1A           -----------------------------------------------------QERMYDYLAQRDNVSAK
3dwkC           -----------------------------------------------------IDTNQDSEYNSYVNFVK
3dwkD           -----------------------------------------------------IDTNQDSEYNSYVNFVK
3dwkB           -------------------------------------------------------TNQDSEYNSYVNFVK
2c5wB           ----------------------------------------------------------------------
2bg4A           ----------------------------------SDGTVIASIDY-LYFTTEAQERMYDYLAQRDNVSAK
2bg4B           ----------------------------------------------------------------------
2c6wB           --------------------------------------------------------------------DN
3czdA           ----------------------------------------------------------------------
1alqA           ----------------------------------------------------------------------
2drwE           ----------------------------------------------------------------------
1e4dB           ----------------------------------------------------------------------
1e4dA           ----------------------------------------------------------------------
1e4dC           ----------------------------------------------------------------------
1bsgA           ----------------------------------------------------------------------
1djbA           ----------------------------------------------------------------------
1e3uA           ----------------------------------------------------------------------
1djaA           ----------------------------------------------------------------------
3bfeA           ----------------------------------------------------------------------
1e3uC           ----------------------------------------------------------------------
1bt5A           ----------------------------------------------------------------------
3e2lA           ----------------------------------------------------------------------
1e3uD           ----------------------------------------------------------------------
3bffA           ----------------------------------------------------------------------
4blmA           ----------------------------------------------------------------------
2cc1A           ----------------------------------------------------------------------
2b5rA           ----------------------------------------------------------------------
3dwkA           -------------------------------------------------------------YNSYVNFVK
1blpA           ----------------------------------------------------------------------
3dw0A           ----------------------------------------------------------------------
1dy6A           ----------------------------------------------------------------------
3cmzA           ----------------------------------------------------------------------
1ck3A           ----------------------------------------------------------------------
1blcA           ----------------------------------------------------------------------
2bcfA           ----------------------------------------------------------------------
3bfdA           ----------------------------------------------------------------------
3e2kA           ----------------------------------------------------------------------
3c5aA           ----------------------------------------------------------------------
1e25A           ----------------------------------------------------------------------
3bydA           ----------------------------------------------------------------------
1bueA           ----------------------------------------------------------------------
2dnsE           ----------------------------------------------------------------------
3dw0B           ----------------------------------------------------------------------
3cjmA           ----------------------------------------------------------------------
2blsA           ----------------------------------------------------------------------
3dtmA           ----------------------------------------------------------------------
1bzaA           ----------------------------------------------------------------------
3brmA           ----------------------------------------------------------------------
2dnsA           ----------------------------------------------------------------------
2dnsC           ----------------------------------------------------------------------
1dkiC           ----------------------------------------------------------------------
2e8iA           ----------------------------------------------------------------------
2bc3B           ----------------------------------------------------------------------
2efuE           ----------------------------------------------------------------------
3bq8B           EDDDDAETHSVAVNV------YPAT-SRPKLTI-------------------------------------
2dcfA           ----------------------------------------------------------------------
2bsbA           ----------------------------------------------------------------------
2d0aA           ----------------------------------------------------------------------
2bc3A           ----------------------------------------------------------------------
1ci9A           ----------------------------------------------------------------------
2efuF           ----------------------------------------------------------------------
3brmB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SIVTSNGAVIDDIAYDAPELAPSVRISLDHNVQRAAEEAVDLRAEMKAMMVVMRPSTGEILAVAQTDEAD
2bg1A           ELKNEATQKFYRDLAAKEIENGGYKITIDQKIHSAMQSAVAGTGRVEVGNVLMDNQTGAILGFVGGRNYQ
3dwkC           SELMNNKAFKDENLGNVLQSGIKIYTNMDKDVQKTLQNDVDKNKDQQVGATILDSKTGGLVAISGGRDFK
3dwkD           SELMNNKAFKDENLGNVLQSGIKIYTNMDKDVQKTLQNDVDKNKDQQVGATILDSKTGGLVAISGGRDFK
3dwkB           SELMNNKAFKDENLGNVLQSGIKIYTNMDKDVQKTLQNDVYKNKDQQVGATILDSKTGGLVAISGGRDFK
2c5wB           -LKEVINQVEEETGYNLLTTGMDVYTNVDQEAQKHLWDIYNPDDELQVASTIVDVSNGKVIAQLGARHQS
2bg4A           ELKNEATQKFYRDLAAIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDNVLMDNQTGAILGFVGGRNYQ
2bg4B           ----------------------KITTTIDQKIHSAMQSAVADYGYLLDDNVLMDNQTGAILGFVGGRNYQ
2c6wB           YLKEVINQVEEETGYNLLTTGMDVYTNVDQEAQKHLWDIYNTDEYLQVASTIVDVSNGKVIAQLGARHQS
3czdA           --------------------------SFTSHIDELYESAKKQSADYIPQLAKFSPDLWGVSVCTVDGQRH
1alqA           ----------------------SETAKSVMKEFAAAAKELNKKYNAHIGVYALDTKSGKEVKFNSDK---
2drwE           ---------------------------LNNAIQGILDDHVARGV---VGVSLALCLPGEETSLYQSGYAD
1e4dB           -----------------------------------------------WNKEFSAEAVNGVFVLCKSSSKS
1e4dA           -----------------------------------------------WNKEFSAEAVNGVFVLCKSSSKS
1e4dC           -----------------------------------------------WNKEFSAEAVNGVFVLCKSSSKS
1bsgA           ------------------------------DAERRLAGLER-ASGARLGVYAYDTGSGRTVA--------
1djbA           ---------------------------------NDLEKKYNAHI----GVYALDTKSGKEVK--------
1e3uA           -------------------------------------------------KEFSAEAVNGVFVLCKSSSKS
1djaA           -------------------------------MKELNDLEKKYNA--HIGVYALDTKSGKEVKNSDK----
3bfeA           -------------------------------VQKKLAALEK-QSGGRLGVALINTADNSQVLYRAD----
1e3uC           -----------------------------------------------WNKEFSAEAVNGVFVLCKSSSKS
1bt5A           -------------------------------TLVKVKDAED-QLGARVGYIELDLNSGKILESFRPEE--
3e2lA           -----------------------------------AEPFAKLEQDFGGGVYAMDTGSGATVSYRAEE---
1e3uD           -----------------------------------------------WNKEFSAEAVNGVFVLCKSSSKS
3bffA           -------------------------------VQKKLAALEK-QSGGRLGVALINTADNSQVLYRADE---
4blmA           -------------------------------------AKLEEQFDAKLGIFALDTGTNRTVAYRPD----
2cc1A           -------------------------------IDDQLAELER-RDNVLIGLYAANLQSGRRITHRPDE---
2b5rA           -------------------------------TLVKVKDAED-QLGARVGYIELDLNSGKILESFRPEE--
3dwkA           SELMNNKAFKDENLGNVLQSGIKIYTNMDKDVQKTLQNDVDNGSFVGATILDSKTGGLVAISGGRDFKDV
1blpA           ---------------------------------NDLEKKYNAHI----GVYALDTKSGKEVKFNSD----
3dw0A           -----------------------------------AEPFAKLEQDFGGGVYAMDTGSGATVSYRAEE---
1dy6A           --------------------------NKSDAAAKQIKKLEE-DFDGRIGVFAIDTGSGNTFGYRSDE---
3cmzA           ------------------------------ETLVKVKDAED-QLGARVGYIELDLNSGKILESFRPEE--
1ck3A           -------------------------------TLVKVKDAED-QLGARVGYIELDLNSGKILESFRPEER-
1blcA           ---------------------------------NDLEKKYNAHIGV----YALDTKSGKEVKFNSD----
2bcfA           --------------------------------PAGSVPIPDGPA---QTWIVADLDSGQVLAGRDQNV--
3bfdA           -------------------------------VQKKLAALEK-QSGGRLGVALINTADNSQVLYRADE---
3e2kA           -----------------------------------AEPFAKLEQDFGGGVYAMDTGSGATVSYR----AE
3c5aA           -----------------------------NLVAEPFAKLEQ-DFGGSIGVYAMDTGSGATVSYRAEE---
1e25A           -----------------------------PLLKEQIESIVI-GKKATVGVAVWGPDDLEPLLINPFE---
3bydA           -------------------------------IQQKLADLEK-RSGGRLGVALINTADDSQTLYRGDE---
1bueA           ----------------------------NTKGIDEIKNLET-DFNGRIGVYALDTGSGKSFSYRANE---
2dnsE           --------------------------DLNNAIQGILDDHVARGV---VGVSLALCLPGEETSLYQSGYAD
3dw0B           -------------------------------------AKLEQDFGGSIGVYAMDTGSGATVS--------
3cjmA           ----------------------SANTVFFDKINDLLVASVK-EFEGTVGISYLDLETGEQRSVNGQH---
2blsA           --------------------------QINDIVHRTITPLIEQQKI--PGMAVAVIYQGKPYYFTWGYADI
3dtmA           -------------------------------TLVKVKDAED-QLGARVGYIELDLNSGKILESFRSEER-
1bzaA           -------------------------------VQQQLEALEK-SSGGRLGVALINTADNSQILYRADE---
3brmA           ----------------------------------------------------------------------
2dnsA           --------------------------DLNNAIQGILDDHVARGV---VGVSLALCLPGEETSLYQSGYAD
2dnsC           ---------------------------LNNAIQGILDDHVARGV---VGVSLALCLPGEETSLYQSGYAD
1dkiC           -----------------------SAITFIQKIKLDKVNLGNMYVYNIFVIVSGDKRSPEILGYSGKENIA
2e8iA           -------------------SAAVSRRPGHALARLGAIAAQLPDLEQRYTDAFLVLRGTEVVAEYYRAGFA
2bc3B           ----------------------------------------------------------------------
2efuE           --------------------------DLNNAIQGILDDHVARGVVG---VSLALCLPGEETSLYQSGYAD
3bq8B           ----------------------------------------------------------------------
2dcfA           -------------------SAAVSRRPGHALARLGAIAAQLLEQRLEQTDAFLVLRGTEVVAEYYRAGFA
2bsbA           ----------------------------------------------------------------------
2d0aA           ----------------------------------------------------------------------
2bc3A           ----------------------------------------------------------------------
1ci9A           --------------------------SLAARLDAVFDQALRERRLVGAVAIVAR--HGEILYRRAQGLAD
2efuF           ---------------------------LNNAIQGILDDHVARGVVGVSLALC---LPGEETSLYQSGYAD
3brmB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           KDGDVALMGQYPPGSTFKIITAAAGLAHEGLTPDSIVPCPGTMNIYGRIVTNYNSFSLGNTSLDDAFANS
2bg1A           ENQNHAFDTKRSPASTTKPLLAYGIAIDQGLGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYS
3dwkC           DVVRNQATDPHPTGSSLKPFLAYGPAIENMWATNHAIQDESSYQVDGSTFRNYDTKSHGTVSIYDALRQS
3dwkD           DVVRNQATDPHPTGSSLKPFLAGPAIENMKWATNHAIQDESSYQVDGSTFRNYDTKSHGTVSIYDALRQS
3dwkB           DVVRNQATDPHPTGSSLKPFLAYGPAIENMWATNHAIQDESSYQVDGSTFRNYDTKSHGTVSIYDALRQS
2c5wB           SNVSFAVETNRDWGSTMKPITDAPALEYGVYESTATIVHDEPYNYPGTPVYNWDRGYFGNITLQYALQQS
2bg4A           ENQNHAFDTKRSPASTTKPLLAGIAIDQGLMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYS
2bg4B           ENQNHAFDTKRSPASTTKPLLAYGIAIDQGMGSETILSNYPTNFANGNPIMYANSKGTGMMTLGEALNYS
2c6wB           SNVNQAVETNRDWGSTMKPITDYAPALEYGYDSTATIVHDEPYNYPGTNTPNWDRGYFGNITLQYALQQS
3czdA           STGDT--KVPFCLQSCVKPLKYAIAVNDLGTEYVHRYPSGLRLFLNEDDKPHNPMVNAGAIVVTSLIKQG
1alqA           ---------RFAYASTSKAINSAILLEQVPLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYS
2drwE           KNKPMTGDHLFRIASCTKSFIATGLHLQDGVDLDEPITRWFPDLPKAAQMPLNHRSGLPDFETSMPMISD
1e4dB           CATNDRASKEYLPASTFIPNAIIGLETG-VIKNEHQVFKWDGKPRAMKQWE-------RDLTLRGAIQVS
1e4dA           CATNDRASKEYLPASTFIPNAIIGLETG-VIKNEHQVFKWDGKPRAMKQWE-------RDLTLRGAIQVS
1e4dC           CATNDRASKEYLPASTFIPNAIIGLETG-VIKNEHQVFKWDGKPRAMKQWE-------RDLTLRGAIQVS
1bsgA           YRADEL----FPMCSVFKTLSSAAVLRDLDRNGEFLSRRIADGAPETGKPQNLANGMTVEELCEVSITAS
1djbA           FNSD----KRFAYAATSKAINSAILLEQVPYNKLNKKNKDDIVAYSPILEKYVGKDITLKALIEASMTYS
1e3uA           CATNDRASKEYLPASTFKIPNAIIGLETGVIKNEHQVFKWDGKPRAMKQWE-------RDLTLRGAIQVS
1djaA           ---------RFAYASTSHAINSAILLEQVPLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYS
3bfeA           --------ERFAMCSTSKVMTAAAVLSETHGILQQKMKKADLTNWNPVTEKYVGNTMTLAELSAATLQYS
1e3uC           CATLARASKEYLPASTFKIPNAIIGLETGVIKNEHQVFKWD----------RAMKQWERDLTLRGAIQVS
1bt5A           ---------RFPMMSTFKVLLCGAVLIDAGEQLGRRIHYSQNDLVEYSPVTHLTDGMTVRELCSAAITMS
3e2lA           ---------RFPLCSFKGFLAAAVLARSQAGLLDTPIRYGKNALVPWSPISYLTTGMTVAELSAAAVQYS
1e3uD           CATNDRASKEYLPASTFKIPNAIIGLETGVIKNEHQVFKPRAMKQWERDLT-----------LRGAIQVS
3bffA           ---------RFAMCSTSKVMTAAAVLSETHGILQQKMTIKKADLTNWNPVTYVGNTMTLAELSAATLQYS
4blmA           --------ERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRVNYNPITEKHVDTGMTLKELADASLRYS
2cc1A           ---------MFAMCSTFKGYVAARVLEHGEISLDNRVFVDALVPNSPVTEARAGAEMTLAELCQAALQRS
2b5rA           ---------RFPMMSTFKVLLCGAVLIDAGEQLGRRIHYSQNDLVYNSPVTHLTDGMTVRELCSAAITMS
3dwkA           VNRNQATDPHPTGSSLKPFLAYGPAIENMKWATNHAIQDESSYQVDGSTFRNYDTKSHGTVSIYDALRQS
1blpA           --------KRFAYASTSKAINSAILLPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYS
3dw0A           ---------RFPLCSSFKGFLAAAVLQQQAGLLDTPIRYGKNALVPWSPISYLTTGMTVAELSAAAVQYS
1dy6A           ---------RFPLCSSFKGFLAAAVLQQKKLDINQKVKYESRDLEYHSPITYKGSGMTLGDMASAALQYS
3cmzA           ---------RFPMMSTFKVLLCGAVLSAGQEQLGRRIHYSQNDLVEYSPVTHLTDGMTVRELCSAAITMS
1ck3A           ----------FPMMSTFKVLLCGAVLDAGQEQLGRRIHYSQNDLVEYSPVTHLTDGMTVRELCSAAITMS
1blcA           --------KRFAYASTSKAINSAILLEQVPYNKLNKINKDDIVAYSPILEKYVGKDITLKALIEASMTYS
2bcfA           ---------AHPPASTIKVLLALVALDELDLNSTVVADVADTQAECNCVGVKPGRSYTVRQLLDGLLLVS
3bfdA           ---------RFAMCSTSKVMTAAAVLKQSDGILQQKMTIKKADLTNWNPVTYVGNTMTLAELSAATLQYS
3e2kA           ER--------FPLCSSFKGFLAAAVLSQQQGLLDTPIRYGKNALVPWSPISEKYLTTTVAELSAAAVQYS
3c5aA           ---------RFPLCSSFKGFLAAAVLSQQQGLLDTPIRYGKNALVPWSPISEKYLTMTVAELSAAAVQYS
1e25A           ---------KFPMQSVFKLHLAMLVLDQGKLDLNQTVILQNTWAPIMKAYQGDEFSVPVQQLLQYSVSHS
3bydA           ---------RFAMCSTGKVMAAAAVLSESNEVVNKRLEIKKSDLVVWSPITHLQSGMTLAELSAAALQYS
1bueA           ---------RFPLCSSFKGFLAAAGSQDNRLNLNQIVNYNTRSLEFHSPITTKDNGMSLGDMAAAALQYS
2dnsE           KKMPMTGDHLFRIASCTKSFIATGLHLDGTVDLDEPITRWFPDLPKAAQMPVRILLNHLPDFETSMPMIS
3dw0B           YRAEER----FPLCSSFKGFLAAAVLSQQQGLLDTPIRYGKNALVPWSPISYLTTGMTVAELSAAAVQYS
3cjmA           ---------EFYTASTIKVPLTLVADTVASKKWTDLIPNAEEDYEEGTGIINIQPEYPLKTLQEYAITYS
2blsA           AKKPVTQQTLFELGSVSKTFTGVLGGARGEIKLSDPTYWPELTAKQWNGITLLHLATKSSSDLLRFYQNW
3dtmA           ----------FPMMSTFKVLLCGAILDAGQEQLGRRIHYSQNDLVEYSPVTHLTDGMTVRELCSAAITMS
1bzaA           ---------RFAMCSTSKVMAAAAVLSESDHLLNQRVEIKKSDLVNYIAEKHVNGTMTLAELGAAALQYS
3brmA           -------WNVSFTQSISKVISFIAACSRGIPYVLDRVDVEGALTIASILPGESAYEKLEFLYSVETLIGK
2dnsA           KFNKMPMTGDFRIASCTKSFIATGLLVQDGVDLDEPITRWFPDLPKAAQMPVRILLNHR-----SGLPDF
2dnsC           KFNKMPMTGDFRIASCTKSFIATGLHQDGTVDLDEPITRWFPDLPKAAQMPVRILLNHR-----SGLPDF
1dkiC           SFMESYVEQIKENKKLDSTYAQPVVKSLLDSKGIHYNQGNPYNLLTPEKVKPGEQSFVGQHAATGSVATA
2e8iA           PDD------RHLLMSVSKSLCGTVVGDEGRIDPAQPVTVPELAGSVYDGPSVLQVLDMQIDYVDPASEVQ
2bc3B           ----------------------------------------------------------------------
2efuE           KFNPMTGDHLFRIASCTKSFIATGLVQDGTVDLDEPITRWFPDLPKAAQMPVR-----------ILLNHR
3bq8B           ----------------------------------------------------------------------
2dcfA           PDD------RHLLMAVSKSLCGTVVGALVDIDPAQPVTEYV----PELAGSVYDGPSVLQDYVDPASEVQ
2bsbA           ----------------------------------------------------------------------
2d0aA           ----------------------------------------------------------------------
2bc3A           ----------------------------------------------------------------------
1ci9A           REAGRPMREDFRLASVTKPIVALAVLVARGLALDAPVTRWLPEFRPRLADGSEPLVTIHHLTHTSGLGYW
2efuF           KMPMTGDH-LFRIASCTKSFIATGLH--------------------------------------------
3brmB           -DGTIHAGDWNVSQSISKVISFIAACSRGIPYVLDRVDVEPPFNPAGALTIA----SILPGESAYEKLEF


                         .         .         +         .         .         .         .:490
query           CNTTFADISTNLEPGQLKNVAKQFGLGIDYQIPGLDTMTGSVPAGDIVLDRTESGYGQGLDLASPFGMAL
2bg1A           WNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIES-----------------LPMGGGIEVTVAQHTN
3dwkC           FNIPALKAWQSVKQNAGNDAPKKFAAKLGLNYEGDIGPSEVLG--------------GSASEFSPTQLAS
3dwkD           FNIPALKAWQSVKQNAGNDAPKKFAAKLGLNYEGDIGPSEVLGGSA--------------SEFSPTQLAS
3dwkB           FNIPALKAWQSVKQNAGNDAPKKFAAKLGLNYEGDIGPSEVLG--------------GSASEFSPTQLAS
2c5wB           RNVPAVETLNKVGLNRAKTFLNGLGIDYP---------SIHYSNAIS----SNTTESDKKYGASSEKMAA
2bg4A           WNIPAYWTYRMLRENGVDVKGYMEKMGYEIPE-----------------YGIESLPMGGGIEVTVAQHTN
2bg4B           WNIPAYWTYRMLRENGVDVKGYMEKMGYEIPEYGIES-----------------LPMGGGIEVTVAQHTN
2c6wB           RNVPAVETLNKVGLNRAKTFLNGLGIDYPSIHYSNAISSNT-------------TESDKKYGASSEKMAA
3czdA           VNNAEKFDLNKMAGNEYVGFSNATFQSRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSIEVTCESASV
1alqA           DNTANNKIIKEIGGKKVKQRLKELGDK---------VTNPVRYEIEL----NYYSPKSKKDTSTPAAFGK
2drwE           KSWTAQEIVDFSFRHGVQKEPWHGMEYSNTGYVLAGMIIAHETGKPAPLGMKDTWVGTHETFPIEREARG
1e4dB           AVPVFQQIAREVGEVRMQKYLKKFSYGNQNISGGIDKF-----------------WLEGQLRISAVNQVE
1e4dA           AVPVFQQIAREVGEVRMQKYLKKFSYG--------NQNISGGID---------KFWLEGQLRISAVNQVE
1e4dC           AVPVFQQIAREVGEVRMQKYLKKFSYGNQNISGGIDK-----------------FWLEGQLRISAVNQVE
1bsgA           DNCAANLMLRELGPAAVTRFVRSLGDRVTRLDRWEPELNSA-------------EPGRVTDTTSPRAITR
1djbA           DNTANNKIIKEI--GGIKKVLKELGDK-VTNPVRYEIEL------------NYYSPKSKKDTSTPAAFGK
1e3uA           AVPVFQQIAREVGEVRMQKYLKKFSYGNQNIS-----------------GGIDKFWLEGQLRISAVNQVE
1djaA           DNTANNKIIKEI--GGIKKVKQRL------KELGDKVTNPVRYEIELN----YYSPKSKKDTSTPAAFGK
3bfeA           DNTAMNKLLAHLGGPGNVTAFARSIGDTTFRLDRKEPELNTAI------------PGDERDTTSPLAMAK
1e3uC           AVPVFQQIAREVGEVRMQKYLKKFSYGNQNISGGIDKF-----------------WLEGQLRISAVNQVE
1bt5A           DNTAANLLLTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIP-------------NDERDTTMPVAMAT
3e2lA           DNAAANLLLKELGPAGLTAFMRSIGDT---------TFRLDRWELELN----SAIPSDARDTSSPRAVTE
1e3uD           AVPVFQQIAREVGEVRMQKYLKKFSYGNQNISGGIDK-----------------FWLEGQLRISAVNQVE
3bffA           DNTAMNKLLAHLGPGNVTAFARSIGDT--TFRLDRKEPELNTAIP-----------GDERDTTSPLAMAK
4blmA           DNAAQNLILKQIGPESLKKELRKIGDE-VTNPERFEPEL------------NEVNPGETQDTSTARALVT
2cc1A           DNTAANLLLKTIGPAAVTAFARSVGDERTRLDRWEVELNSAIP-------------GDPRDTSTPAALAV
2b5rA           DNTAANLLLTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIP-------------NDERDTTMPAAMAT
3dwkA           FNIPALKAWQSVKQNAGNDAPKKFAAKLGLNYEGDIGPSEVLGGSASE--------------FSPTQLAS
1blpA           DNTANNKIIKEIGGKKVKQRLKELGDK-VTNPVRL----------------NYYSPKSKKNTSTPAAFGK
3dw0A           DNAAANLLLKELGPAGLTAFMRSIGDT---------TFRLDRWEL----ELNSAIPGDARDTSSPRAVTE
1dy6A           DNGATNIIMERFLGGPEGMTKFMRSIGDNEFRLDRWEL-----------ELNTAIPGDKRDTSTPKAVAN
3cmzA           DNTAANLLLTTIGPKELTAFLHNMGDH---------VTRLDRWEPELN----EAIPNDERDTTMPAAMAT
1ck3A           DNTAANLLLTTIGPKELTAFLHNMGDHVTRLDRWEPELNEAIP-------------NDERDTTMPVAMAT
1blcA           DNTANNKIIKEI--GGIKKVKQRL------KELGDKVTNPVRYEIELN----YYSPKSKKDTSTPAAFGK
2bcfA           GNDAANTLAHLGGQDVTVAKNAKAAT-LGATSTHATTPSGLDG-------------PGGSGASTAHDLVV
3bfdA           DNTAMNKLLAHLGPGNVTAFARSIGDTTFRLDRKEPELNTAIP-------------GDERDTTSPLAMAK
3e2kA           DNAAANLLLKELGPAGLTAFMRSIGDT---------TFRLDRWEL----ELNSAIPSDARDTSSPRAVTE
3c5aA           DNAAANLLLKELGPAGLTAFMRSIGDT---------TFRLDRWEL----ELNSAIPGDARDTSSPRAVTE
1e25A           DNVACDLLFLVGGPAALHDYIQSMGIKETAVVANEAQMHADDQ-------------VQYQNWTSMKGAAE
3bydA           DNTAMNKMISYLGPEKVTAFAQSIGDV---------TFRLDRTEPA----LNSAIPGDKRDTTTPLAMAE
1bueA           DNGATNIILERYIGGGMTKFMRSIGDE-DFRLDRWELDLN------------TAIPGDERDTSTPAAVAK
2dnsE           DKSTAQEIVDFSFRHGVQKEPWHGMEYSNTGYVLAGMIIAHEPYSDHLRSRIFAPLGMWVGTHETFPIER
3dw0B           DNAAANLLLKELGPAGLTAFMRSIGDT---------TFRLDRWEL----ELNSAIPGDARDTSSPRAVTE
3cjmA           DNIAKNLYDTLGGDAKAKREYQRYLHK-------------------------------------------
2blsA           QNSSIGLFGALAVKPMQTRVFQPLKLNHTWINVPPAEEWGYREGKAVHVSPGALDAEAYGVKSTIEDMAW
3dtmA           DNTAANLLLTTIGPKGLTAFLHNMGDHVT-------------RLDRWEPELNEAIPNDERDTTTPVAMAT
1bzaA           DNTAMNKLIAHLGPDKVTAFARSLGD-------------ETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQ
3brmA           RPRI----------HEEVFRSEWETAHRNRALAYYLKETNFLEAEVEETLEVYLKQC---AESTTEDIAL
2dnsA           ETSMPMISDKSWTAQEIVDFSFRHGVQKEPWHGMEYSNTGYVLAGMIIAHETGKPYSDHLRIFAPLGMTF
2dnsC           ETSMPMISDKSWTAQEIVDFSFRHGVQKEPWHGMEYSNTGYVLAGMIIAHETGKPYSDHLRIFAPLGMTF
1dkiC           TAQIMKYHNYPNKGLKDYTYTLSSNNP-------------------------------------------
2e8iA           THDRSAGWRTRRHGDPADTYEFLTTLRGDGSTGEQYCSANTDVLAWIVERVTGLRYVEALSTYLWAKLDA
2bc3B           ----------------------------------------------------------------------
2efuE           SGLPDFETSMPMISDKSWTAQEDFSFRHGVQKEPWHGMEYSNTGYVLAGMIIAHETGKPYSIFAPLGMTF
3bq8B           ----------------------------------------------------------------------
2dcfA           THDRSAGWRTRRHGDPADTYEFLTTLR---GDGSTGEFQYCSANTDVLAWIVERGFANGGVSCTARDLAR
2bsbA           ----------------------------------------------------------------------
2d0aA           ----------------------------------------------------------------------
2bc3A           ----------------------------------------------------------------------
1ci9A           LLEGAGSVYDRL----------------------------------------------------------
2efuF           ----------------------------------------------------------------------
3brmB           LYSVETLIGKRPRIHEEVFRSEWETAHRNRALAYYLKETNFLE--AEVEETLEVYLKQCA-ESTTEDIAL


                         *         .         .         .         .         +         .:560
query           VASTAATGSVPTPTLISGHETVASEEVPALDPEVLANVQRMMKSVVNDGTARGMRQTGGQIYAKTGEAEI
2bg1A           GYQTLANNGVYHQKHVIVVYEYQDKPVQVYSKATATIMQGLLREVLSSRVTTTFKSNLTDWIGKTGTTNQ
3dwkC           AFAAIANGGTYNNAHSIQKVVTRDGETIAMSDYTAYMLAEMLKGTFKPYGSYGHGVSGVNMGAKTGTGTY
3dwkD           AFAAIANGGTYNNAHSIQKVVTRDGETIAMSDYTAYMLAEMLKGTFKPYGSAYGHGVSGNMGAKTGTGTY
3dwkB           AFAAIANGGTYNNAHSIQKVVTRDGETIAMSDYTAYMLAEMLKGTFKPYGAYGHGVSGVNMGAKTGTGTY
2c5wB           AAAFANGGTYYKPMYIHKVVFFSNVGTRAMKETTAYMMTDMMKTVLTYGTGRNAYLAWLPQAGKTGTSNY
2bg4A           GYQTLANNGVYHQKHVISKIEAADGRVVVYSKATATIMQGLLREVLSSRVTTTFKSNLTDWIGKTGTTNQ
2bg4B           GYQTLANNGVHQKHVISKIEAADGRVVYVYSKATATIMQGLLREVLSSRVTTTFKSNLTDWIGKTGTTNQ
2c6wB           AAAFANGGTYYKPMYIHKVVFSSNVGTRAMKETTAYMMTDMMKTVLTYGTGRNAYLAWLPQAGKTGTSNY
3czdA           MAATLANGGFCPIT-----------GERVLSPEAVRNTLSLMHSCGMYDF-SGQFAFHVGLPAKSGVAG-
1alqA           TLNKLIANGKLSK------------------ENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQA--
2drwE           YMHAPVDGVWDSTEWFPLSGANAAGDMRILDQKRLWEMKDNIKPAFFPGSNTVMRYGSSELKGHLGQI--
1e4dB           FLESLYLNKLSAS------------------KENQLIVKEALVTEAAPEYLVHSK----TGFSGVGTE--
1e4dA           FLESLYLNKLSAS------------------KENQLIVKEALVTEAAPEYLVHSKTGFS----GVGTESN
1e4dC           FLESLYLNK------------------LSASKENQLIVKEALVTEAAPEYLVHSKTGFSGV--GT----E
1bsgA           TYGRLVLDALNPRDRRLLTSW-------------------LLANTTSGDRFRAGLPDDWTLGDKTGAGRY
1djbA           TLNKLIANGKLSK------------------ENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAIT
1e3uA           FLESLYLNKLSAS------------------KENQLIVKEALVTEAAPEYLVH----SKTGFSGVG--TE
1djaA           TLNKLIANGKLSK------------------ENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAIT
3bfeA           SLRKLTLGDALAGPQRAQL------------------VDWLKGNTTGGQSIRAGLPAHWVVGDKTGAGDY
1e3uC           FLESLYLN------------------KLSASKENQLIVKEALVTEAAPEYLVHSK--TGFSGVGTE----
1bt5A           TLRKLLTGEL-------------------LTLASRQQLIDWMEADKVAGPLLRSALAGWFIADKSGAGER
3e2lA           SLQKLTLGSAL-------------------AAPQRQQFVDWLKGNTTGNHRIRAAVADWAVGDKTGTC--
1e3uD           FLESLYLNKLSAS------------------KENQLIVKEALVTEAAPEYLVHSKT--GFSGVGTE----
3bffA           SLRKLTLGDALAGPQRAQL------------------VDWLKGNTTGGQSIRAGLPAHWVVGDKTGACDY
4blmA           SLRAFALE-------------------DKLPSEKRELLIDWMKRNTTGDALIRAGVPGWEVADKTGAASY
2cc1A           GYRAILAG-------------------DALSPPQRGLLEDWMRANQTSSM-RAGLPEGWTTADKTGSGDY
2b5rA           TLRKLLTGELLTL------------------ASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGER
3dwkA           AFAAIANGGTYNAHSIQKVVTRDGETIEAMSDYTAYMLAEMLKGTFKPYGSAYGHGVSGNMGAKTGTGTY
1blpA           TLNKLIANGKLSK------------------ENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAIT
3dw0A           SLQKLTLG-------------------SALAAPQRQQFVDWLKGNTTGNHRRAAVPADWAVGDKTGTC--
1dy6A           SLNKLALG-------------------NVLNAKVKAIYQNWLKGNTTGDARIRASVADWVVGDKTGSCGY
3cmzA           TLRKLLTGELLTP------------------ASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGER
1ck3A           TLRKLLTGEL-------------------LTLASRQQLIDWMEADKVAGPLLRSALAGWFIADKSGAGER
1blcA           TLNKLIANGKLSK------------------ENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAIT
2bcfA           IFRAAANP-------------------VFAQIIAEPSAFPSDEQLIV-NQDELLQRYPGAIGGKTGYTNA
3bfdA           SLRKLTLG------------------DALAGPQRAQLVDWLKGNTTGGQSIRAGLPAHWVVGDKTGACDY
3e2kA           SLQKLTLG-------------------SALAAPQRQQFVDWLKGTTGNHRIRAAVPADWAVGDKTGTC--
3c5aA           SLQKLTLG-------------------SALAAPQRQQFVDWLKGNTTGNHRRAAVPADWAVGDKTGTC--
1e25A           ILKKFEQKT------------------QLSETSQALLWKWMVETTTGPERLKGLLPAGTVVAHKTGTSQI
3bydA           SLRKLTLG-------------------NALGEQQRAQLVTWLKGNTTGGQIRAGLPASWAVGDKTGAGDY
1bueA           SLKTLALGNILSEHEKETYQTW------------------LKGNTTGAARIRASVPSDWVVGDKTGSCGA
2dnsE           EARGYMHAWDSPLSGANAAGDMVSLNALFDGRILDQKRLWEMKDNIKPAFFPGSNTVANGHGLLLMRYGS
3dw0B           SLQKLTLG-------------------SALAAPQRQQFVDWLKGNTTGNHIRAAVPADWAVGDKTGTCG-
3cjmA           ----------------------------------------------------------------------
2blsA           VQSNLKPLDINEKTLQQGIQLAQSRYWMYQGLGWEMLDWPVNPDSIINGSDNKIALAARPVKAITPPTPA
3dtmA           TLRKLLTGELLTPASRQQLMDW------------------MEADKVAGPLLRSVLPAGWFIADKSGAGER
1bzaA           TLKNLTLG-------------------KALAETQRAQLVTWLKGNTTSASIRAGLPKSWVVGDKTGSGDY
3brmA           IGLILAHDGYHPIR-----------HEQVIPKDV-AKLAKALLTCGYNASGKYAAFVG--VPAKS-----
2dnsA           PIEREARGYMHAAADDENPQWDVSGAGDPVDGVWDSTEWFPLSGANAAGD--------------------
2dnsC           PIEREARGYMHAAADDENPQWDVSGAGDPVDGVWDSTEWFPLSGANAAGDM----VSTPRDIVKFLNALF
1dkiC           ----------------------------------------------------------------------
2e8iA           DRDDTTGFGFAHGGVSCTARDLDGGVAPGGRVVSEDWVRRVLAGGSHEMTDKGFTNTFPDGSYTRQWWTG
2bc3B           ------------------------GSTFIVTAGADGALTGTYESANAERYVLTGRYDSAPATDGSGTALG
2efuE           PIEREARGYMHAGVWDSTEWFPLSGANAALDQKRLWEMKDNIKPAFFPGSNTVANGHGLLLMRYGSSELK
3bq8B           ----------------------------------------------------------------------
2dcfA           VGRMMLDGGVAPGGRVVSEDWVRRVLAGGSHEAMTDKGFTNTFPDGSYTRQWWCTGNERGNVSGIG----
2bsbA           ----------------------------------------SFIGSTENDVGPSQGSYSLPFVYDTGYNIG
2d0aA           -----------------------SNYVIQADQQLLDALRAHYEGALSDGALFAVKRPDVITAYRSGKVLF
2bc3A           ------------------------GSTFIVTAGADGALTGTYESGNESRYVLTGRYDSAPATDGSGTALG
1ci9A           ----------------------------------------------------------------------
2efuF           ----------------------------------------------------------------------
3brmB           IGLILAHD---------GYHPIRHEQV---IPKDVAKLAKALLTCGYNASGKYAAFVG--VPAKSG----


                         .         .         .         *         .         .         .:630
query           NEGSHAWFTGYREDDIAFATLVVLGGGSEAAAAVTDQFFVKLDELRxxxxxxxxxxxxxxxx
2bg1A           DE--NMWLMLSTPRLTLGGWIGHDQAGYSNNSNYMAHLV-----------------------
3dwkC           NAAKDVWINGFTP-QYTMSVWM----------------------------------------
3dwkD           GAETYSQYNLPDNA--AKDVWINGFTPQYTMSVWMGF-------------------------
3dwkB           GAETYSQYNL--PDNAAKDVWINGFTPQYTMSVWMGF-------------------------
2c5wB           TDEEDELFAGYTRKYSMAVWTGYSNRGLTVAAKVYRSMMTYLSEGS----------------
2bg4A           DE--NMWLMLSTPRLTLGGWIGHDQAGYSNNSNYMAHLVNAI--------------------
2bg4B           DE--NMWLMLSTPRLTLGGWIGHDQAGYSNNSNYMAHLVNAI--------------------
2c6wB           TDEEDELFAGYTRKYSMAVWTGYSNRGLTVAAKVYRSMMTYLSEGS----------------
3czdA           ------GILLVVPNVMGMMCWSPPKMGNSVKGIHFCHDLVSL--------------------
1alqA           ITYASRNDVAF---------------------------------------------------
2drwE           PGHTSIMGRDE-ETGAALMLIQNSDFESFYLKGVNEPVDRVLEAIK----------------
1e4dB           SNPGVAWWVGWVEKETEVYFFAFNESKLPLRKSIPTKIMESEGII-----------------
1e4dA           PG--VAWWVGWVEKETEVYFFAFNESKLPLRKSIPTKIMESEGII-----------------
1e4dC           SNPGVAWWVGWEKETEVYFFAFNMDSKLPLRKSIPTKIMESEGII-----------------
1bsgA           GTNNDAGVTWPPGRPIVLTVLTAKTEQDAARDDGL---------------------------
1djbA           YASRNDVAFVYPKGQSEPIVLVIF--------------------------------------
1e3uA           SNPGVAWWVGWVEKETEVYFFAFNMDKLPLRKSIPTKIMESEGII-----------------
1djaA           YASRNDVAFVYPKGQSEPIVLVIF--------------------------------------
3bfeA           GTTNDIAVIWPEDRAPLVLVTYFTQPQQDAKWR-----------------------------
1e3uC           SNPGVAWWVGWEKETEVYFFAFNMDSKLPLRKSIPTKIMESEGII-----------------
1bt5A           GSRGIIAALGPDGKSRIVVIYTTGSQRNRQIAEIGASLI-----------------------
3e2lA           GVYGTANDYAVPTGRAPIVLAVYTRAPNKDDKH-----------------------------
1e3uD           SNPGVAWWVGWEKETEVYFFAFNMDSKLPLRKSIPTKIMESEGII-----------------
3bffA           GTTNDIAVIWPEDRAPLVLVTYFTQPQQDAKWR-----------------------------
4blmA           GTRNDIAIIWPPKGPVVLAVLSSRDKKDAKYDDKL---------------------------
2cc1A           GSTNDAGIAFGPDGQ-RLLLVMMTRSQAHDPKAEN---------------------------
2b5rA           GSRGIIAALGPDGKPSRIVVIYTTGSQATMDER-----------------------------
3dwkA           NLPDNAAKDVW---------------------------------------------------
1blpA           YASRNDVAFVYPKGQSEPIVLVIF--------------------------------------
3dw0A           GVYGTANDYAVPTGRAPIVLAVYTRKDDKHSEAV----------------------------
1dy6A           GTANDYAVIWPKNRPLIVSIYTTRKSKDDKHSDKT---------------------------
3cmzA           GSRGIIAALGPDGKPSRIVVIYTTGSRNRQIAEIGASLI-----------------------
1ck3A           GSRGIIAALGPDGKPSRIVVIYTTGSRDRQIAEIGASLI-----------------------
1blcA           YASRNDVAFVYQSEPIVLVIFT----------------------------------------
2bcfA           ARKTFVGAAARGGRRLVIAYGLVKEGGPTYWD------------------------------
3bfdA           GTTNDIAVIWPEDRAPLVLVTYFTQPQQDAKWR-----------------------------
3e2kA           GVYGTANDYAVPTGRAPIVLAVYTRKDDKHSEAV----------------------------
3c5aA           GVYGTANDYAVPTGRAPIVLAVYTRAPNKDDKH-----------------------------
1e25A           KTAATNDLGIILLPDGRPLLVAVFVKNEAIIAQVAQTAY-----------------------
3bydA           GTTNDIAVIWPENHAPLVLVTYFTQPQQDAKSR-----------------------------
1bueA           YGTANYAVVWPKNRPLIISVYTTKNEKEAKHEDKV---------------------------
2dnsE           SETSIMGRDEETGAALMLIQNSGAGDFESFYLKGVNEPV-----------------------
3dw0B           -VYGTANDYAVPTGRAPIVLAVYTRKDDKHSEAV----------------------------
3cjmA           --------------------------------------------------------------
2blsA           VRGGFGSYVAFPEKELGIVMLANKNYPNPARVDAAWQIL-----------------------
3dtmA           GSRGIVAALGPDGKPSRIVVIYTTGSQATMDEL-----------------------------
1bzaA           GTTNDIAVIWPENHAPLVLVTYFTQPEQKAERR-----------------------------
3brmA           --------------------------------------------------------------
2dnsA           --------------------------------------------------------------
2dnsC           DGR-----------------------------------------------------------
1dkiC           --------------------------------------------------------------
2e8iA           NERGNVSGIGIPLTDSVIVKLSWPDPDTEHWHRLQNGIL-----------------------
2bc3B           W--TVAWKNNYRNGAEARINTQWLLTSGTTEANAWKSTLVGHDTFT----------------
2efuE           GPGHTSIMGRDEETGAALMLIQNSGAGDFYLKGVNEPVDRVLEAIK----------------
3bq8B           --------------------------------------------------------------
2dcfA           --IHGQNLWLDPLTDSVIVKLSWPDPDTEHWHRLQNGIL-----------------------
2bsbA           YQNAWHISGGF---------------------------------------------------
2d0aA           GKAAEQEAAKW---------------------------------------------------
2bc3A           W--TVAWKNNYRNA------------------------------------------------
1ci9A           --------------------------------------------------------------
2efuF           --------------------------------------------------------------
3brmB           --------------------------------------------------------------