[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF54857.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3eiwA.bssp"
#ERROR : Can't open dsspfile "3eixA.bssp"
#ERROR : Can't open dsspfile "1efdN.bssp"
#ERROR : Can't open dsspfile "3be6A.bssp"
#ERROR : Can't open dsspfile "3be6B.bssp"
#ERROR : Can't open dsspfile "2chuB.bssp"
#ERROR : Can't open dsspfile "2chuA.bssp"

## Summary of PDB Search
:314
    2e-33  20%  3eiwA  [x.x.x] HTSA PROTEIN
    5e-33  20%  3eixA  [x.x.x] HTSA PROTEIN
    5e-31  20%  1efdN  [c.92.2] FERRICHROME-BINDING PERIPLASMIC PROTEIN
    1e-29  20%  3be6A  [x.x.x] PUTATIVE IRON COMPOUND-BINDING PROTEIN OF ABC
    2e-28  18%  3be6B  [x.x.x] PUTATIVE IRON COMPOUND-BINDING PROTEIN OF ABC
    2e-21  19%  2chuB  [x.x.x] ENTEROCHELIN UPTAKE PERIPLASMIC BINDING PROTEIN
    2e-13  17%  2chuA  [x.x.x] ENTEROCHELIN UPTAKE PERIPLASMIC BINDING PROTEIN
:314

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQRIVAXXXXXXXXXX
3eiwA           -------------------------------------------------------KRIVVLEYSFADALA
3eixA           -------------------------------------------------------KRIVVLEYSFADALA
1efdN           -------------------------------------------------------NRIVALEWLPVELLL
3be6A           -------------------------------------------------------KRIVSLHDLDITIPL
3be6B           ----------------------------------------------------------------------
2chuB           -------------------------------------------------------SKVVILDLGILDTFD
2chuA           -------------------------------------------------------SKVVILDLGILDTFD


                         .         .         *         .         .         .         .:140
query           XXXITPVGVAAAKNSDLIPQFLKDRFSADMDLDSIADCGLRQSPDIEAIANLNPTLICANSRADEEVLNK
3eiwA           ALDVKPVGIADDGKKKRIIKPVRE------KIGDYTSVGTRKQPNLEEISKLKPDLIIADSSRHKGINKE
3eixA           ALDVKPVGIADDGKKKRIIKPVRE------KIGDYTSVGTRKQPNLEEISKLKPDLIIADSSRHKGINKE
1efdN           ALGIVPYGVADTINYRLWVSEPPL-------PDSVIDVGLRTEPNLELLTEMKPSFMVWSAGYSPEMLAR
3be6A           IELVPPVASHGRTRPDG-SHFIRSGALLVDFDNSSIAFIGTADIDIEAIVAAKPDLIITEPTR-NTPIER
3be6B           ---VPPVASHGRTRPDGSHFIRSGALTGVDFDNSSIAFIGTADIDIEAIVAAKPDLIITEPTRNT-PIER
2chuB           ALKLNDKVVGVPAKNL--PKYLQQ-------FKNKPSVGGVQQVDFEAINALKPDLIIISGRQSKFY-DK
2chuA           ALKLNDKVVGVPAKNL---PKYLQQF------KNKPSVGGVQQVDFEAINALKPDLIIISGRQSKFYDKL


                         +         .         .         .         .         *         .:210
query           LRTIAPVVTGEGGGENWKQDLLTIAEAAGQKEKAETLLKSYEDSAAEIAANQPANPPTVSFLRTKDQEFQ
3eiwA           LNKIAPTLSFDGDYKQNINSFKTIAKALNKEKEGEKRLAEHDKLINKYKDEIKFRNQKVLPAVVAKAGLL
3eixA           LNKIAPTLSFDGDYKQNINSFKTIAKALNKEKEGEKRLAEHDKLINKYKDEIKFDNQKVLPAVVAKAGLL
1efdN           IAPGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLAQYEDFIRSMKPRFVKARPLLLTTLIDPRHML
3be6A           LEKIAPTVSIDHLKGGAPEIYRKLAELTGTQSQLAILERRYQAQINALKATLDSQKITVSVIQANQGKIN
3be6B           LEKIAPTVSIDHLKGGAPEIYRKLAELTGTQSQLAILERRYQAQINALKATLDSQKITVSVIQANQGKIN
2chuB           LKEIAPTLFNANFLSSFENNVLSVAKLYGLEKEALEKISDIKNEIEKAKS-IVDEDKKALIILTNSNKIS
2chuA           KETLFVGLDNANFLSSFENNVLSVAKLYGLEKEALEKISDIKNEIEKAKS-IVDEDKKALIILTNSNKIS


                         .         .         .         +         .         .         .:280
query           MYGAQSMAGTVAADCGYARPENQQFTDTAGQDLSAELIAQADADWLFYGMKEGNINPEDTPLWTSLKAVQ
3eiwA           AHPNYSYVGQFLNELGFKNALSDDVTKGLSKYLDTEHLADLNPERMIIMTDHAKKDSQEDATWKKLNAVK
3eixA           AHPNYSYVGQFLNELGFKNALSDDVTKGLSKQLDTEHLADLNPERIITDHAKKDSAEQEDATWKKLNAVK
1efdN           VFGPNSLFQEILDEYGIPNAWQGETNFWGSTAVSIDRLAAYKDVDVLCFDHDNSKDMDATPLWQAMPFVR
3be6A           VHSYHSL-GRVLRDAGFRFPPLIESIPEGGRDVSAERLPELDADFVFATWRGDTGGKPQDGWCQFLTACR
3be6B           VHSYHSLGRVLRDAGF-RFPPLIESIPEGGRDVSAERLPELDADFVFATWRGDTGGKPQDGWCQFLTACR
2chuB           AFGPQSRFGIIHDVLGINAVDEN---IKVGKSINSEFILEKNPDYIFVVDRNVILGNKERALVAKTKAAQ
2chuA           AFGPQSRFGIIHDVLGI----NAVDENIKGKSINSEFILEKNPDYIFVVDRNVILGNKERALVAKTKAAQ


                         .         *         .         .         .         .         +:350
query           SNQAIPVDGDSWYLNASLVSAEIILQGLKDxxxx
3eiwA           NNRVDIVDRDVWARSRGLISSEEMAKELVE----
3eixA           NNRVDIVDRDVWARSRGLISSEEAKE--------
1efdN           AGRFQRVPAVWFY--GATLSAMHFVRVLDN----
3be6A           SGRYVLISREEAI---------------------
3be6B           SGRYVLISREEAI---------------------
2chuB           NKKIIYLDPEYWY---------------------
2chuA           NKKIIYLDPEYWY---------------------