[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF55227.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cb4D.bssp"
#ERROR : Can't open dsspfile "2e1rA.bssp"
#ERROR : Can't open dsspfile "2c5zA.bssp"
#ERROR : Can't open dsspfile "3degC.bssp"
#ERROR : Can't open dsspfile "2brvX.bssp"
#ERROR : Can't open dsspfile "2bm1A.bssp"
#ERROR : Can't open dsspfile "2bm0A.bssp"

## Summary of PDB Search
:106
    2e-20  56%  3cb4D  [x.x.x] GTP-BINDING PROTEIN LEPA
    3e-17   6%  2e1rA  [x.x.x] ELONGATION FACTOR 2
    3e-16  14%  2c5zA  [x.x.x] SET DOMAIN PROTEIN 2
    9e-14  51%  3degC  [x.x.x] GTP-BINDING PROTEIN LEPA
    2e-10   7%  2brvX  [x.x.x] HYALURONATE LYASE
    5e-10  12%  2bm1A  [x.x.x] ELONGATION FACTOR G
    2e-09  12%  2bm0A  [x.x.x] ELONGATION FACTOR G
:106

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDAFSAIVHRDNAQWYGNKMTVKLKELIPRQQFEVPVQAAIGSKVIARENIRALRKDVLAKCYGGDISRK
3cb4D           --ALALITHRDNSQNRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYG------
2e1rA           VNILDVTLHADAIHRGGGQIIPTMRR-ATYAGFLLADPKIQEPVFLVEIQCPE---QAVGGIYSVLNKKR
2c5zA           -----------QSQRLEHNWNKFFASFVPNLIKKNPQSKQFD-----HENIKQCAKDIVKILTTKELSSR
3degC           -DALALITHRDNSQNRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQL----------------
2brvX           -DGMFYLYNGDLSHYSDGYWPTVNPYKMPGTTETDAKRADSDTGKVLPSAFVGTSKLDDANATA------
2bm1A           MGDVIGDLNARR----GQILGMEPRGNAQVIRAFVPLAEMFGYATDLRSKTQG-----------------
2bm0A           MGDVIGDLNARR----GQILGMEPRGNAQVIRAFVPLAEMFGYATDLRSKTQG-----------------


                         .         .         *         .         .         .         .:140
query           RKLLEKQKAGKKRMKNIGSVEVPQEAFVAALSTxxx
3cb4D           ------------------------------------
2e1rA           GQVVSEEQRPGTPLFTV-KAYLPVNESF--------
2c5zA           APPDDLTKGKRHKVKEFINSYM--------------
3degC           ------------------------------------
2brvX           TMDFTNWNQTLTAHKSWFMLKDKIAFLGSNIQN---
2bm1A           ------------------------------------
2bm0A           ------------------------------------