[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF55235.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2eduA.bssp"
#ERROR : Can't open dsspfile "2axtU.bssp"
#ERROR : Can't open dsspfile "3c1yA.bssp"
#ERROR : Can't open dsspfile "2duyA.bssp"
#ERROR : Can't open dsspfile "2bgwA.bssp"
#ERROR : Can't open dsspfile "2a1jB.bssp"
#ERROR : Can't open dsspfile "1d8lA.bssp"
#ERROR : Can't open dsspfile "1dgtB.bssp"
#ERROR : Can't open dsspfile "3bz1U.bssp"
#ERROR : Can't open dsspfile "1bpeA.bssp"
#ERROR : Can't open dsspfile "1c7yA.bssp"
#ERROR : Can't open dsspfile "1b22A.bssp"
#ERROR : Can't open dsspfile "3e0dA.bssp"
#ERROR : Can't open dsspfile "2bhnB.bssp"
#ERROR : Can't open dsspfile "2bhnA.bssp"
#ERROR : Can't open dsspfile "2bgwB.bssp"
#ERROR : Can't open dsspfile "2a1jA.bssp"
#ERROR : Can't open dsspfile "3c5gB.bssp"
#ERROR : Can't open dsspfile "1bnoA.bssp"
#ERROR : Can't open dsspfile "1dgsA.bssp"
#ERROR : Can't open dsspfile "2csdA.bssp"
#ERROR : Can't open dsspfile "2abkA.bssp"
#ERROR : Can't open dsspfile "1cukA.bssp"
#ERROR : Can't open dsspfile "1dk2A.bssp"
#ERROR : Can't open dsspfile "2bhnC.bssp"
#ERROR : Can't open dsspfile "1bvsA.bssp"
#ERROR : Can't open dsspfile "1bvsB.bssp"

## Summary of PDB Search
:196
    2e-13  43%  2eduA  [x.x.x] KINESIN-LIKE PROTEIN KIF22
    1e-12  25%  2axtU  [x.x.x] PHOTOSYSTEM II 12 KDA EXTRINSIC PROTEIN
    2e-10  18%  3c1yA  [x.x.x] DNA INTEGRITY SCANNING PROTEIN DISA
    2e-10  45%  2duyA  [x.x.x] COMPETENCE PROTEIN COMEA-RELATED PROTEIN
    2e-09  29%  2bgwA  [x.x.x] XPF ENDONUCLEASE
    3e-09  19%  2a1jB  [x.x.x] DNA EXCISION REPAIR PROTEIN ERCC-1
    1e-08  19%  1d8lA  [b.40.4 - a.60.2] PROTEIN (HOLLIDAY JUNCTION DNA HELICASE
    1e-08  12%  1dgtB  [x.x.x] DNA LIGASE
    2e-08  21%  3bz1U  [x.x.x] PHOTOSYSTEM II 12 KDA EXTRINSIC PROTEIN
    3e-08  24%  1bpeA  [x.x.x] DNA POLYMERASE BETA
    6e-08  23%  1c7yA  [b.40.4 - a.60.2 - a.5.1] HOLLIDAY JUNCTION DNA HELICASE RUVA
    7e-08  15%  1b22A  [a.60.4] DNA REPAIR PROTEIN RAD51
    2e-07  25%  3e0dA  [x.x.x] DNA POLYMERASE III SUBUNIT ALPHA
    2e-07  21%  2bhnB  [x.x.x] XPF ENDONUCLEASE
    1e-06  29%  2bhnA  [x.x.x] XPF ENDONUCLEASE
    2e-06  33%  2bgwB  [x.x.x] XPF ENDONUCLEASE
    2e-06  18%  2a1jA  [x.x.x] DNA REPAIR ENDONUCLEASE XPF
    7e-06  21%  3c5gB  [x.x.x] DNA POLYMERASE LAMBDA
    9e-06  21%  1bnoA  [a.60.6 (1dk3A)] DNA POLYMERASE BETA
    2e-05  26%  1dgsA  [d.142.2 - b.40.4 - a.60.2] DNA LIGASE
    1e-04  19%  2csdA  [x.x.x] TOPOISOMERASE V
    2e-04  26%  2abkA  [x.x.x] ENDONUCLEASE III
    3e-04  31%  1cukA  [x.x.x] RUVA PROTEIN
    3e-04  21%  1dk2A  [a.60.6] DNA POLYMERASE BETA
    3e-04  20%  2bhnC  [x.x.x] XPF ENDONUCLEASE
    4e-04  26%  1bvsA  [b.40.4 - a.60.2 - a.5.1] PROTEIN (HOLLIDAY JUNCTION DNA
    7e-04  31%  1bvsB  [b.40.4 - a.60.2 - a.5.1] PROTEIN (HOLLIDAY JUNCTION DNA
:196

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVAK
2eduA           ----------------------------------------------------------------------
2axtU           ----------------------------------------------------------------------
3c1yA           ----------------------------------------------------------------------
2duyA           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------
2a1jB           ----------------------------------------------------------------------
1d8lA           ----------------------------------------------------------------------
1dgtB           -------------------------------------------------------------------TLH
3bz1U           ----------------------------------------------------------------------
1bpeA           ----------------------------------------------------------------------
1c7yA           ----------------------------------------------------------------------
1b22A           ----------------------------------------------------------------------
3e0dA           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2a1jA           ----------------------------------------------------------------------
3c5gB           ----------------------------------------------------------------------
1bnoA           ----------------------------------------------------------------------
1dgsA           ----------------------------------------------------------------------
2csdA           ----------------------------------------------------------------------
2abkA           ----------------------------------------------------------------------
1cukA           ----------------------------------------------------------------------
1dk2A           ----------------------------------------------------------------------
2bhnC           ----------------------------------------------------------------------
1bvsA           ----------------------------------------------------------------------
1bvsB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PGLVTLAEGSRVADALAIAGTLPDADLTALNLAQLLVDGTQIHVLAIGEVQPISVDAAATSASGLISLNT
2eduA           ----------------------------------------------------------------LDLLNE
2axtU           -----------------------------------------------------VVDEKLGTAYGKIDLNN
3c1yA           ---------------------TAQNILQDFITRREPSPISISRVLGYDVQQAAQLDDVL--------VSA
2duyA           -----------------------------------------------------------------VSLNE
2bgwA           --------------------------------------------------------------------RE
2a1jB           ---------------------------------------------------------LLMEKLEQDF-VS
1d8lA           -------------------------------------------TNGVGPKLALAILSGMSAQQFVNAVER
1dgtB           NESYIEELDIRIGDWVHKAGGV-IPEVLRVLKERRTGKERPIRWPEACPEHRLVKEGKVCPAKRFEAIRH
3bz1U           ------------------------------------------------------NVVDEKLGTAKIDLNN
1bpeA           ----------------------------------------------------------------------
1c7yA           -------------------------------------------------------------------VER
1b22A           ----------------------------------------------------------------------
3e0dA           ------------------------------------------------PVLPPDVNRSGFDFK---VVGE
2bhnB           -----------------RYRGRERSLYAAMAALQLDYGIRLMNTMDPKGTALVIESLARLSTRRLSDVRE
2bhnA           ---------------------------------------------------------------------E
2bgwB           ----------------------------------------------------------------------
2a1jA           ----------------------------------------------------------------------
3c5gB           -------------------------------------------------TEKLEVLAKAINALKSFHKPV
1bnoA           -------------------------------------------------------------------LNG
1dgsA           -------------------------------------------------------------------LYH
2csdA           ------------------------------------------------DEHGLSPDAADELIEHFESIAG
2abkA           ----------------------------------------------------------------------
1cukA           ----------------------------------------------------------------------
1dk2A           --------------------------------------------------------------------NG
2bhnC           -------------------------------------------LQSFPGIGRRTAERILERFGSLERFFT
1bvsA           -------------------------------------------------------------------LAD
1bvsB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ATVADLVTLPGVGEKTAQAIIDFRESNGGFSTVEDLLQVKGIGPSKFEQISGLVSP
2eduA           GSARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQMESF------
2axtU           TNIAAFIQYRGLYPTLAKLIVK----NAPYESVEDVLNIPGLTERQKQILRENLE-
3c1yA           RGYRLLKTVARIPLSIGYNVVRMFKTLDQIASVEDLKKVEGIGEKRARAI------
2duyA           ASLEELA-LPGIGPVLARRIVEGR----PYARVEDLLKVKGIGPATLERLRPYLRP
2bgwA           WQLYILQSFPGIGRRTAERILERFGSLERFASKAEISKVEGIGEKRAEEI------
2a1jB           RVTECLTTVKSVNKTDSQTLLTTFGSQLIAASREDLALCPGLGPQKARRL------
1d8lA           EEVGALVKLPGIGKKTAERLIVEMKDRFKGLHGDLF--------------------
1dgtB           YASRKAMDIEGLGEKLIERLLEKGLVRDVALRKEDLLGLERMGEKSAQNL------
3bz1U           TNIAAFIQYRGLYPTLAKLIVK----NAPYESVEDVLNIPGLTERQKQIL------
1bpeA           DMLVELANFGAEAKKLPEKIDEFLATGKTSSSINFLTRVTGIGPSAARKL------
1c7yA           EEVGALVKLPGIGKKTAERLIVEMKDRFKGLHGDLFTPAADLVL------------
1b22A           ----SRLEQCGINANDVKKLEEAGFHTVEYAPKKELINIKGISEAKADKI------
3e0dA           EILFGLSAVKNVGEMAARAILEERERGGPFKSLGDFLKEQVVNKRALE--------
2bhnB           WQLYILQSFPGIGRRTAERILERFGSLERFFTAAEISKVEGIGEKRAEEI------
2bhnA           WQLYILQSFPGIGRRTAERILERFGSLERFASKAEISKVEGIGEKRAEEI------
2bgwB           -----LQSFPGIGRRTAERILERFGSLERFASKAEISKVEGIGEKRAEEI------
2a1jA           -----LLKMPGVNAKNCRSLMHHVKNIAEALSQDELTSILG-NAANAKQL------
3c5gB           TSYQEACSIPGIGKRMAEKIIEILESGHSVPVLELFSNIWGAGTKTAQMW------
1bnoA           GITDMLVELANFEKNVSQAIHKYNKYPHKIKSGAEAKKLPGVGTKIAEKIDEFL--
1dgsA           LRKEDLLGLERMGEKSAQNLLRQIEEHRGLERLLYALGLPGVGEVLARNL------
2csdA           ILATDLEEIERMYEEGRLSEEAYRAAVE--IQLAELTKKEGVGR------------
2abkA           EDRAALEALPGVGRKTANVVLNTAFGWPTIAVDTHIFRVQFAPGKNVEQV------
1cukA           -----LIKTNGVGPKLALAILSGMSAQQFVNEVGALVKLPGIGKKTAERL------
1dk2A           GITDMLVELANFEKNVSQAIHKYNKYPHKIKSGAEAKKLPGVGTKIAEKI------
2bhnC           ASKAEISKVEGIGEKRAEEIKKI---------------------------------
1bvsA           SDVASLTRVPGIGRRGAERIVLEGPVNAVRGSVVEALVGLGFAAKQAEEA------
1bvsB           -----LLSVSGVGPRLAMATLAVHDAAALRQDVASLTRVPGIGRRGAERI------