[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF55333.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dxlA.bssp"
#ERROR : Can't open dsspfile "2bk4B.bssp"
#ERROR : Can't open dsspfile "2bc0A.bssp"
#ERROR : Can't open dsspfile "2c76B.bssp"
#ERROR : Can't open dsspfile "2a87A.bssp"
#ERROR : Can't open dsspfile "2a87B.bssp"
#ERROR : Can't open dsspfile "2c75B.bssp"
#ERROR : Can't open dsspfile "2c72A.bssp"
#ERROR : Can't open dsspfile "1cl0A.bssp"
#ERROR : Can't open dsspfile "1e6eC.bssp"
#ERROR : Can't open dsspfile "2b9wA.bssp"
#ERROR : Can't open dsspfile "3eanC.bssp"
#ERROR : Can't open dsspfile "2bk4A.bssp"
#ERROR : Can't open dsspfile "1b37B.bssp"
#ERROR : Can't open dsspfile "2b76M.bssp"
#ERROR : Can't open dsspfile "2c73A.bssp"
#ERROR : Can't open dsspfile "1b37A.bssp"
#ERROR : Can't open dsspfile "1dncA.bssp"
#ERROR : Can't open dsspfile "3d1cA.bssp"
#ERROR : Can't open dsspfile "2c76A.bssp"
#ERROR : Can't open dsspfile "1cjcA.bssp"
#ERROR : Can't open dsspfile "1eehA.bssp"
#ERROR : Can't open dsspfile "3dk9A.bssp"
#ERROR : Can't open dsspfile "2b76A.bssp"
#ERROR : Can't open dsspfile "3c4nA.bssp"
#ERROR : Can't open dsspfile "2bc1A.bssp"
#ERROR : Can't open dsspfile "2cduB.bssp"
#ERROR : Can't open dsspfile "2c75A.bssp"
#ERROR : Can't open dsspfile "3cukA.bssp"
#ERROR : Can't open dsspfile "3c4aA.bssp"
#ERROR : Can't open dsspfile "1e0dA.bssp"
#ERROR : Can't open dsspfile "3ctyB.bssp"
#ERROR : Can't open dsspfile "2e4gA.bssp"
#ERROR : Can't open dsspfile "2e4gB.bssp"
#ERROR : Can't open dsspfile "3cp8A.bssp"
#ERROR : Can't open dsspfile "3ctyA.bssp"
#ERROR : Can't open dsspfile "3bg6A.bssp"
#ERROR : Can't open dsspfile "2cyjA.bssp"
#ERROR : Can't open dsspfile "2c72B.bssp"
#ERROR : Can't open dsspfile "1an9A.bssp"
#ERROR : Can't open dsspfile "2cduA.bssp"
#ERROR : Can't open dsspfile "3eanF.bssp"
#ERROR : Can't open dsspfile "2c73B.bssp"
#ERROR : Can't open dsspfile "3cpjG.bssp"
#ERROR : Can't open dsspfile "2culA.bssp"
#ERROR : Can't open dsspfile "2apgA.bssp"
#ERROR : Can't open dsspfile "1ebdA.bssp"
#ERROR : Can't open dsspfile "1bhyA.bssp"
#ERROR : Can't open dsspfile "1d5tA.bssp"
#ERROR : Can't open dsspfile "2dkhA.bssp"
#ERROR : Can't open dsspfile "3d4oA.bssp"
#ERROR : Can't open dsspfile "3eanD.bssp"
#ERROR : Can't open dsspfile "3cgvA.bssp"
#ERROR : Can't open dsspfile "3eanA.bssp"
#ERROR : Can't open dsspfile "2a8xA.bssp"
#ERROR : Can't open dsspfile "3cnsA.bssp"
#ERROR : Can't open dsspfile "3bi4B.bssp"
#ERROR : Can't open dsspfile "3d4oC.bssp"
#ERROR : Can't open dsspfile "3cgcA.bssp"
#ERROR : Can't open dsspfile "3coxA.bssp"
#ERROR : Can't open dsspfile "2cfyA.bssp"
#ERROR : Can't open dsspfile "3bi2A.bssp"
#ERROR : Can't open dsspfile "3cpiG.bssp"
#ERROR : Can't open dsspfile "3cpiH.bssp"
#ERROR : Can't open dsspfile "1cc6A.bssp"
#ERROR : Can't open dsspfile "1cc4A.bssp"
#ERROR : Can't open dsspfile "1bf3A.bssp"
#ERROR : Can't open dsspfile "1d7yA.bssp"
#ERROR : Can't open dsspfile "1aogB.bssp"
#ERROR : Can't open dsspfile "2du8A.bssp"
#ERROR : Can't open dsspfile "2ardA.bssp"
#ERROR : Can't open dsspfile "3bi4A.bssp"
#ERROR : Can't open dsspfile "3c96A.bssp"
#ERROR : Can't open dsspfile "2dw4A.bssp"
#ERROR : Can't open dsspfile "3djdB.bssp"
#ERROR : Can't open dsspfile "1e6eA.bssp"
#ERROR : Can't open dsspfile "2ejrA.bssp"
#ERROR : Can't open dsspfile "3cntB.bssp"
#ERROR : Can't open dsspfile "1bzlA.bssp"
#ERROR : Can't open dsspfile "3cnsB.bssp"
#ERROR : Can't open dsspfile "3b3rA.bssp"
#ERROR : Can't open dsspfile "2bxrA.bssp"
#ERROR : Can't open dsspfile "2bxsA.bssp"
#ERROR : Can't open dsspfile "1coyA.bssp"
#ERROR : Can't open dsspfile "1d7lA.bssp"
#ERROR : Can't open dsspfile "3cp8D.bssp"
#ERROR : Can't open dsspfile "3djeB.bssp"
#ERROR : Can't open dsspfile "2bi7A.bssp"
#ERROR : Can't open dsspfile "3cnjA.bssp"
#ERROR : Can't open dsspfile "3d8xA.bssp"
#ERROR : Can't open dsspfile "3blyA.bssp"
#ERROR : Can't open dsspfile "3bi2B.bssp"
#ERROR : Can't open dsspfile "3bg7A.bssp"
#ERROR : Can't open dsspfile "1cj3A.bssp"
#ERROR : Can't open dsspfile "2e1mA.bssp"
#ERROR : Can't open dsspfile "3cnpA.bssp"
#ERROR : Can't open dsspfile "1cj2A.bssp"
#ERROR : Can't open dsspfile "3dghB.bssp"
#ERROR : Can't open dsspfile "2e5vA.bssp"
#ERROR : Can't open dsspfile "3dl2B.bssp"
#ERROR : Can't open dsspfile "2dpoA.bssp"
#ERROR : Can't open dsspfile "3cirA.bssp"
#ERROR : Can't open dsspfile "3cphG.bssp"
#ERROR : Can't open dsspfile "3cphH.bssp"
#ERROR : Can't open dsspfile "2dkiA.bssp"
#ERROR : Can't open dsspfile "3dghA.bssp"
#ERROR : Can't open dsspfile "2dwcB.bssp"
#ERROR : Can't open dsspfile "1dy2A.bssp"
#ERROR : Can't open dsspfile "3djdA.bssp"
#ERROR : Can't open dsspfile "1dobA.bssp"
#ERROR : Can't open dsspfile "3cgbA.bssp"
#ERROR : Can't open dsspfile "1aogA.bssp"
#ERROR : Can't open dsspfile "3e1tA.bssp"
#ERROR : Can't open dsspfile "1b8sA.bssp"
#ERROR : Can't open dsspfile "3dh9A.bssp"
#ERROR : Can't open dsspfile "2amfE.bssp"
#ERROR : Can't open dsspfile "2aefB.bssp"
#ERROR : Can't open dsspfile "1b73A.bssp"
#ERROR : Can't open dsspfile "3cesD.bssp"
#ERROR : Can't open dsspfile "2czgA.bssp"
#ERROR : Can't open dsspfile "1cc2A.bssp"

## Summary of PDB Search
:499
    2e-24  14%  1dxlA  [c.3.1 - c.3.1 - d.87.1] DIHYDROLIPOAMIDE DEHYDROGENASE
    2e-21  11%  2bk4B  [x.x.x] AMINE OXIDASE [FLAVIN-CONTAINING] B
    5e-21  12%  2bc0A  [x.x.x] NADH OXIDASE
    1e-19   9%  2c76B  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    1e-19  17%  2a87A  [x.x.x] THIOREDOXIN REDUCTASE
    3e-19  18%  2a87B  [x.x.x] THIOREDOXIN REDUCTASE
    6e-19  11%  2c75B  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    1e-18  11%  2c72A  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    5e-18  17%  1cl0A  [c.3.1 - c.3.1] THIOREDOXIN REDUCTASE
    8e-18  12%  1e6eC  [c.4.1 - c.3.1] NADPH\:ADRENODOXIN OXIDOREDUCTASE
    1e-17  18%  2b9wA  [x.x.x] PUTATIVE AMINOOXIDASE
    3e-17  12%  3eanC  [x.x.x] THIOREDOXIN REDUCTASE 1
    3e-17  12%  2bk4A  [x.x.x] AMINE OXIDASE [FLAVIN-CONTAINING] B
    6e-17  12%  1b37B  [c.3.1 - d.16.1] PROTEIN (POLYAMINE OXIDASE)
    2e-16   9%  2b76M  [x.x.x] FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
    3e-16  11%  2c73A  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    3e-16  13%  1b37A  [c.3.1 - d.16.1] PROTEIN (POLYAMINE OXIDASE)
    4e-16  14%  1dncA  [x.x.x] GLUTATHIONE REDUCTASE
    1e-15  19%  3d1cA  [x.x.x] FLAVIN-CONTAINING PUTATIVE MONOOXYGENASE
    2e-15  11%  2c76A  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    4e-15  11%  1cjcA  [c.4.1 - c.3.1] PROTEIN (ADRENODOXIN REDUCTASE)
    5e-15  13%  1eehA  [c.5.1 - c.72.2 - c.59.1]
    6e-15  13%  3dk9A  [x.x.x] GLUTATHIONE REDUCTASE
    1e-14  10%  2b76A  [x.x.x] FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
    5e-14  10%  3c4nA  [x.x.x] UNCHARACTERIZED PROTEIN DR_0571
    8e-14  12%  2bc1A  [x.x.x] NADH OXIDASE
    8e-14  12%  2cduB  [x.x.x] NADPH OXIDASE
    1e-13  11%  2c75A  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    2e-13   8%  3cukA  [x.x.x] D-AMINO-ACID OXIDASE
    2e-13  11%  3c4aA  [x.x.x] PROBABLE TRYPTOPHAN HYDROXYLASE VIOD
    4e-13   9%  1e0dA  [c.5.1 - c.72.2 - c.59.1]
    1e-12  18%  3ctyB  [x.x.x] THIOREDOXIN REDUCTASE
    1e-12  12%  2e4gA  [x.x.x] TRYPTOPHAN HALOGENASE
    2e-12   8%  2e4gB  [x.x.x] TRYPTOPHAN HALOGENASE
    2e-12  10%  3cp8A  [x.x.x] TRNA URIDINE 5-CARBOXYMETHYLAMINOMETHYL
    3e-12  19%  3ctyA  [x.x.x] THIOREDOXIN REDUCTASE
    4e-12   7%  3bg6A  [x.x.x] PYRANOSE OXIDASE
    4e-12   9%  2cyjA  [x.x.x] HYPOTHETICAL PROTEIN PH1505
    5e-12   9%  2c72B  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    3e-11  12%  1an9A  [c.4.1 - d.16.1] D-AMINO ACID OXIDASE
    4e-11  10%  2cduA  [x.x.x] NADPH OXIDASE
    5e-11  11%  3eanF  [x.x.x] THIOREDOXIN REDUCTASE 1
    9e-11  11%  2c73B  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    9e-11   8%  3cpjG  [x.x.x] RAB GDP-DISSOCIATION INHIBITOR
    1e-10  14%  2culA  [x.x.x] GLUCOSE-INHIBITED DIVISION PROTEIN A-RELATED
    1e-10  17%  2apgA  [x.x.x] TRYPTOPHAN HALOGENASE PRNA
    2e-10  10%  1ebdA  [c.3.1 - c.3.1 - d.87.1] DIHYDROLIPOAMIDE DEHYDROGENASE
    4e-10  10%  1bhyA  [x.x.x] P64K
    9e-10   9%  1d5tA  [c.3.1 - d.16.1] GUANINE NUCLEOTIDE DISSOCIATION INHIBITOR
    1e-09   8%  2dkhA  [x.x.x] 3-HYDROXYBENZOATE HYDROXYLASE
    1e-09  10%  3d4oA  [x.x.x] DIPICOLINATE SYNTHASE SUBUNIT A
    2e-09  12%  3eanD  [x.x.x] THIOREDOXIN REDUCTASE 1
    3e-09  12%  3cgvA  [x.x.x] GERANYLGERANYL REDUCTASE RELATED PROTEIN
    3e-09   9%  3eanA  [x.x.x] THIOREDOXIN REDUCTASE 1
    3e-09  11%  2a8xA  [x.x.x] DIHYDROLIPOYL DEHYDROGENASE
    4e-09  21%  3cnsA  [x.x.x] FMS1
    4e-09  17%  3bi4B  [x.x.x] POLYAMINE OXIDASE FMS1
    3e-08  10%  3d4oC  [x.x.x] DIPICOLINATE SYNTHASE SUBUNIT A
    4e-08  11%  3cgcA  [x.x.x] PYRIDINE NUCLEOTIDE-DISULFIDE OXIDOREDUCTASE,
    6e-08  10%  3coxA  [x.x.x] CHOLESTEROL OXIDASE
    1e-07  11%  2cfyA  [x.x.x] THIOREDOXIN REDUCTASE 1[MASQUE : MEMB(X) 44 / COIL(x)
    2e-07  20%  3bi2A  [x.x.x] POLYAMINE OXIDASE FMS1
    2e-07   7%  3cpiG  [x.x.x] RAB GDP-DISSOCIATION INHIBITOR
    2e-07   9%  3cpiH  [x.x.x] RAB GDP-DISSOCIATION INHIBITOR
    2e-07  15%  1cc6A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    3e-07  15%  1cc4A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    3e-07   9%  1bf3A  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    3e-07  11%  1d7yA  [c.3.1 - c.3.1 - d.87.1] FERREDOXIN REDUCTASE
    4e-07  12%  1aogB  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
    5e-07  12%  2du8A  [x.x.x] D-AMINO-ACID OXIDASE
    5e-07  13%  2ardA  [x.x.x] TRYPTOPHAN HALOGENASE PRNA
    5e-07  17%  3bi4A  [x.x.x] POLYAMINE OXIDASE FMS1
    6e-07  12%  3c96A  [x.x.x] FLAVIN-CONTAINING MONOOXYGENASE
    8e-07  28%  2dw4A  [x.x.x] LYSINE-SPECIFIC HISTONE DEMETHYLASE 1
    8e-07  14%  3djdB  [x.x.x] FRUCTOSYL AMINE: OXYGEN OXIDOREDUCTASE
    1e-06   9%  1e6eA  [c.4.1 - c.3.1] NADPH\:ADRENODOXIN OXIDOREDUCTASE
    2e-06  28%  2ejrA  [x.x.x] LYSINE-SPECIFIC HISTONE DEMETHYLASE 1
    2e-06  20%  3cntB  [x.x.x] FMS1
    2e-06  13%  1bzlA  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE (OXIDIZED
    2e-06  22%  3cnsB  [x.x.x] FMS1
    3e-06  12%  3b3rA  [x.x.x] CHOLESTEROL OXIDASE
    4e-06  28%  2bxrA  [x.x.x] AMINE OXIDASE [FLAVIN-CONTAINING] A
    5e-06  28%  2bxsA  [x.x.x] AMINE OXIDASE [FLAVIN-CONTAINING] A
    5e-06  10%  1coyA  [x.x.x] CHOLESTEROL OXIDASE
    6e-06  14%  1d7lA  [c.3.1 - d.16.1] P-HYDROXYBENZOATE HYDROXYLASE
    6e-06  14%  3cp8D  [x.x.x] TRNA URIDINE 5-CARBOXYMETHYLAMINOMETHYL
    7e-06  13%  3djeB  [x.x.x] FRUCTOSYL AMINE: OXYGEN OXIDOREDUCTASE
    7e-06  14%  2bi7A  [x.x.x] UDP-GALACTOPYRANOSE MUTASE
    7e-06  12%  3cnjA  [x.x.x] CHOLESTEROL OXIDASE
    8e-06  13%  3d8xA  [x.x.x] THIOREDOXIN REDUCTASE 1
    9e-06  10%  3blyA  [x.x.x] PYRANOSE OXIDASE
    9e-06  22%  3bi2B  [x.x.x] POLYAMINE OXIDASE FMS1
    1e-05  11%  3bg7A  [x.x.x] PYRANOSE OXIDASE
    1e-05  13%  1cj3A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    1e-05  25%  2e1mA  [x.x.x] L-GLUTAMATE OXIDASE
    2e-05  19%  3cnpA  [x.x.x] FMS1
    2e-05  12%  1cj2A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    2e-05  11%  3dghB  [x.x.x] THIOREDOXIN REDUCTASE 1, MITOCHONDRIAL
    3e-05  11%  2e5vA  [x.x.x] L-ASPARTATE OXIDASE
    4e-05  10%  3dl2B  [x.x.x] UBIQUITIN-CONJUGATING ENZYME E2 VARIANT 3
    4e-05  17%  2dpoA  [x.x.x] L-GULONATE 3-DEHYDROGENASE
    4e-05   6%  3cirA  [x.x.x] FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
    4e-05   9%  3cphG  [x.x.x] RAB GDP-DISSOCIATION INHIBITOR
    5e-05  13%  3cphH  [x.x.x] RAB GDP-DISSOCIATION INHIBITOR
    7e-05  10%  2dkiA  [x.x.x] 3-HYDROXYBENZOATE HYDROXYLASE
    8e-05  11%  3dghA  [x.x.x] THIOREDOXIN REDUCTASE 1, MITOCHONDRIAL
    9e-05  10%  2dwcB  [x.x.x] 433AA LONG HYPOTHETICAL
    1e-04  15%  1dy2A  [d.169.1] COLLAGEN ALPHA1(XV) CHAIN
    2e-04  12%  3djdA  [x.x.x] FRUCTOSYL AMINE: OXYGEN OXIDOREDUCTASE
    2e-04  11%  1dobA  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    2e-04  10%  3cgbA  [x.x.x] PYRIDINE NUCLEOTIDE-DISULFIDE OXIDOREDUCTASE,
    2e-04  13%  1aogA  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
    2e-04  11%  3e1tA  [x.x.x] HALOGENASE
    2e-04  12%  1b8sA  [c.3.1 - d.16.1] PROTEIN (CHOLESTEROL OXIDASE)
    2e-04  12%  3dh9A  [x.x.x] THIOREDOXIN REDUCTASE 1
    3e-04  11%  2amfE  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
    5e-04   9%  2aefB  [x.x.x] CALCIUM-GATED POTASSIUM CHANNEL MTHK
    5e-04  12%  1b73A  [c.78.2 - c.78.2] GLUTAMATE RACEMASE
    5e-04  15%  3cesD  [x.x.x] TRNA URIDINE 5-CARBOXYMETHYLAMINOMETHYL
    6e-04  14%  2czgA  [x.x.x] PHOSPHORIBOSYLGLYCINAMIDE FORMYL TRANSFERASE
    6e-04  12%  1cc2A  [c.3.1 - d.16.1] PROTEIN (CHOLESTEROL OXIDASE)
:499

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTTTEAIYKRTVIVGSGFAGLGMGAQLKRRGDHDFVIIERADDVGGTWRDNTYPGAACDVPSHLYSFSFH
1dxlA           -----------VIIGGGPGGYVAAIKAAQLG-FKTTCIEKRGALGGTCLNVGCIPSKALLYHEAKHSFAN
2bk4B           --------CDVVVVGGGISGMAAAKLLHDS-GLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSYVGPTQ
2bc0A           --------SKIVVVGANHAGTACIKTMLTNY-GDANEIVVFDQNSNISF-------LGGMALWIGEQIAG
2c76B           --------CDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSYVGPTQN
2a87A           --------RDVIVIGSGPAGY-TAALYAARAQLAPLVFEGTSFGGALMT-----------------TTDV
2a87B           --------RDVIVIGSGPAGY-TAALYAARAQLAPLVFEGTSFGGALMT-----------------TTDV
2c75B           -----------VVVGGGISGMAAAKLL-HDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSYVGPTQ
2c72A           --------CDVVVVGGGISGMAAAKLLHDSG-LNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSYVGPTQ
1cl0A           --------SKLLILGSGPAGY-TAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLME
1e6eC           --------PQICVVGSGPAGFYTAQHLLKHHSRAHVDIYEKQLVPFGLV---------------------
2b9wA           ---------RIAIIGAGPAGLAAGMYLEQAGFHDYTILERTDHVGGKCHSPNYHGRRYEMGAIMGVPSYD
3eanC           --------TPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALK--------------------DSRNY
2bk4A           --------CDVVVVGGGISGMAA-AKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSYVGPTQ
1b37B           ---------RVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVEGVNG
2b76M           --SFEYHFHDTVAGGDWLCEQDVVDYFVHHC-PTEMTQLELWGCPWSRRPDGSVNVRRFGGMKIERTWFA
2c73A           --------CDVVVVGGGISGM-AAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSYVGPTQ
1b37A           ---------RVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVEGVNG
1dncA           -----------LVIGGGSGGLASARRAAELGARAAVV--ESHKLGGTCVNVGVPKKVMWNTAVHSEMHDH
3d1cA           ------------IIGAGAAGIG-AITLKDFG-ITDVIILEKGTVGHSFKH--WPKSTRTITPSFAISDTS
2c76A           --------CDVVVVGGGISGMAAAKLLHDSG-LNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSYVGPTQ
1cjcA           --------PQICVVGSGPAGFYTAQHLLKHH-SRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQ
1eehA           --------KNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRMTPPGLDKL-PEAVERHTGSLNDEWLMAAD
3dk9A           -----------LVIGGGSGGLASARRAAELGARAAVV--ESHKLGGTCVVGCVPKKVMWNTAVHSHDHAD
2b76A           HDSFEYHFHDTVAGGDWLCEQDVVDYFVHHC-PTEMTQLELWGCPWSRRPDGSVNVRRFGGMKIERTWFA
3c4nA           -----------VVIGAGRGAACAFYLRQLAPGRSLLLVEEGGLPNEEGATILAPGVWTAQDIPAGQEAQA
2bc1A           --------SKIVVVGANHAGTACIKTMLTNY-GDANEIVVFDQNSNISFLGSGMALWIGEQIAGPEGLFY
2cduB           ---------KVIVVGCTHAGTFAVKQTIADH-PDADVTAYEMNDNISFLSGIALYLGKEIKNNDPRGLFY
2c75A           --------CDVVVVGGGISGMAA-AKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSYVGPTQ
3cukA           ---------RVVVIGAGVIGLSTALCIHERY-HSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLPQEAD
3c4aA           ---------KILVIGAGPAGLVFASQLKQARPLWAIDIVEKNDEQELGWGVVLPGRPGQHPANPLSYLDA
1e0dA           --------KNVVIIGLGLTGLSC-VDFFLARGVTPRVMDTRMTPPGLDKLPEAVERHTGSLNDEWLMAAD
3ctyB           -----------VIVGAGAAGFSAAVYAARSG-FSVAILDKAVAGGLTAEAPLVENYLGFKSIVGSELAKL
2e4gA           MSGKI---DKILIVGGGTAGWMAASYLGKALQGTADITQAPDIPTLGVGEATIPNLQTAFFDFLGIPEDE
2e4gB           --------DKILIVGGGTAGWMAASYLGKALTADITLLQAPDIPTLGVGEATIPNLQTAFFDFLGIPEDE
3cp8A           -----------IVVGAGHAGC-EAALAVARGGLHCLLITSDLSAVARMSCNPAIGGVAKGQITREIDALG
3ctyA           -----------VIVGAGAAGFSAAVYAARSG-FSVAILDKAVAGGLTAEAPLVE----------------
3bg6A           -----------VIVGSGPIGCTY-ARELVGAGYKVAMFDIGEIDSGLKIGAHKKNTVEYQKNIDKFVNVI
2cyjA           ----------------------------------------------------------------------
2c72B           --------CDVVVVGGGISGMAAAKLLHDS-GLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSYVGPTQ
1an9A           ---------RVVVIGAGVIGLSTALCIHERY-HSVLQPLDVKVYADRFTPFTTTDVAAGLWQPYTSEPSN
2cduA           ---------KVIVVGCTHAGTFA-VKQTIADHPDADVTAYEMNDNISFLSGIALYLGKEIKNNDPRGLFY
3eanF           --------TPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALKDSRN-------------YGWKLEDT
2c73B           --------CDVVVVGGGISGMAAAKLLHDSG-LNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSYVGPTQ
3cpjG           -----------IVLGTGITECILSGLLSVDG-KKVLHIDKQDHYGGEAASVTLSQLYEKFKQNPISKEED
2culA           -----------LIVGAGFSGAETAFWLAQKG-VRVGLLTQSLDAVMM-------------PFLPPKPPFP
2apgA           -----------VIVGGGTAGWMAASYLVRALQQQATLIESAAIPRIGVGEATIPSLQKVFFDFLGIPERE
1ebdA           --------QKVTIVEKGNLGGVCLNVGCIP-SKALISASHRYEQAKHSEEMGIKAENVT-IDFAKVQEWK
1bhyA           -----------VVLGGGPGGYSAAFAAADEG-LKVAIVERYKTLGGVCLNVGCIPSKALLHNAAVIDEVR
1d5tA           -----------IVLGTGLTECILSGIMSVNG-KKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPET
2dkhA           -TEAVPSQVDVLIVGCGPAGLTLAAQLAAFPDIRTCIVEQKEGPMELGQADGIACRTMEMFEFADSILKE
3d4oA           --------KHVVIIGGDARQLEIIRKLSTFDAKISLVGDQLDFIGVTKRIDEVDWNTVDAILLPISGTNE
3eanD           --------TPTPLGTRWGLGGTCVNVGCIPK-KLMHQAALLGQALKDSRNYGWKLEDTVKHDWEKMTESV
3cgvA           -----------LVVGGGPGGSTAARYAAKYG-LKTLIEKRPEIGSPVRCGEGLSKGILNEADIKADRSFI
3eanA           --------TPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQ--------------------ALKDSRNY
2a8xA           -----------VVLGAGPGGYVAAIRAAQLG-LSTAIVEPKYWGGVCLNVGCIPSKALLRNAELVHIFTK
3cnsA           --------KKVIIIGAGIAGLKAASTLHQNGIQDCLVLEARDRVGGLQTVTGYQGRKYDIGASWH-HDTL
3bi4B           --------KKVIIIGAGIAGLKAASLHQNGI-QDCLVLEARDRVGGRLQTVTGYQGRKYDIGASWHHDTL
3d4oC           --------KHVVIIGGDARQLEIIRKLSTFD-AKISLVGFDQLDDGFIGVTKRIDEVDWNTVDAILLPIS
3cgcA           ---------NYVIIGGDAAGMSAAMQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARN
3coxA           -TLADGDRVPALVIGSGYGGAVAALRLTQAG-IPTQIVEMGRSWDTPGSDGKIFCGMLNPDKRSMWLADK
2cfyA           --------TPTPLGTRWGLGGTCVNVGCIP--------------KKLMHQAALLGQALQDSRNYGWKVEE
3bi2A           --------KKVIIIGAGIAGLKAASTLHQNGIQDCLVLEARDRVGGLQTVTGYQGRKYDIGAS-WHHDTL
3cpiG           -----------IVLGTGITECILSGLLSVDGKKVLHIDKQDHYGGEAASVTLSQLYEKFKQNPISKEERE
3cpiH           -----------IVLGTGITECILSGLLSVD-GKKVLHIDKQDHYGGEAASVTLSQLYEKFKQNPISKEER
1cc6A           --------TQVAIIGAGPSGLLLGQLLHKAG-IDNVILERQTPDYVLGRIRAGVLEQGMVDLLREAGVDR
1cc4A           --------TQVAIIGAGPSGLLLGQLLHKAG-IDNVILERQTPDYVLGRIRAGVLEQGMVDLLREAGVDR
1bf3A           ------MKTQVAIIGAGPSGLLLGQLLHKAGIDNVILEGMVDLLREAGVDRRMARDGLVHEGVEIAFAGQ
1d7yA           -----ALKAPVVVLGAGLASV-SFVAELRQAGYQGLITVVGDEAERPYDRPPLSKDFMAHGDAEKIRLDC
1aogB           -----------VVIGAGSGGLEAAWNAATLY-KKRVAVIDVQMVHGPPFFSALGGTCVNVGCVPKKLMVT
2du8A           ---------RVVVIGAGVIGLSTALCIHERY-HSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPNN
2ardA           -----------VIVGGGTAGWMAASYLVRALQANITLIESAAIPRIGVGEATIPSLQKVFFDFLGIPERE
3bi4A           --------KKVIIIGAGIAGLKAASLHQNGI-QDCLVLEARDRVGGLQTVTGYQGRKYDIGASWH-HDTL
3c96A           -----------LIAGAGIGGLSCALALHQAGIGKVTLLESSSEIRPLGVGINIQPAAVEALAELEPRGVE
2dw4A           ---------KVIIIGSGVSGLAAARQLQSFG-MDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGL-G
3djdB           --------SSLLIVGAGTWGTSTALHLARRGYTNVTVLDPYPVPSAISAGNDVNKVISSIEVNEILAEEA
1e6eA           --------PQICVVGSGPAGFYTA----QHLLKHHSRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINT
2ejrA           ---------KVIIIGSGVSGLAAARQLQSFG-MDVTLLEARDRVGGRVATFRKGNYVADLGAMVV-TGLG
3cntB           --------KKVIIIGAGIAGLKAASLHQNGI-QDCLVLEARDRVGGLQTVTGYQGRKYDIGASWH-HDTL
1bzlA           -----------VVIGAGSGGLEA-AWNAATLYKKRVAVIDVQMVHGPPFFSALGGTCVNVGCVPKKLMVT
3cnsB           --------KKVIIIGAGIAGLKAASTLHQNGIQDCLVLEARDRVGGLQTVTGYQGRKYDIGASWH-HDTL
3b3rA           -SADNGGYVPAVVIGTGYGAAVSALRLGEAG-VQTLMLEMGQLWNQPGPDGNIFCGMLNPDKRSSWFKNR
2bxrA           -----------VVIGGGISGLSAAKLLTEYG-VSVLVLEARDRVGGRTYTIRNEH---------------
2bxsA           -----------VVIGGGISGLSAAKLLTEYG-VSVLVLEARDRVGGRTYTIRNEH---------------
1coyA           -TLADGDRVPALVIGSGYGGAVAALRLTQAG-IPTQIVEMGRSWDTPGSDGKIFCGMLNPDKRSMTDQPV
1d7lA           --------TQVAIIGAGPSGLLLGQLL-HKAGIDNVILERQTPDYVLGRIRAGVLEQGMVDLLREAGVDR
3cp8D           -----------IVVGAGHAGCEAALAVARGGLHCLLITSDLSAVARMSCNPAIGGVAKGQITREIDALGG
3djeB           -----------LIVGAGTWGTSTALHLARRG-YTNVTVLDPYPVPSAISAGNDVNKVISSGQYSNNKDEI
2bi7A           --------KKILIVGAGFSGAVIGRQLAEK-GHQVHIIDQRDHIGGNSYDARDSETNVMVHVYGPHIFHT
3cnjA           -----------VVIGTGYGAAVSALRLGEAG-VQTLMLEMGQLWNQPGPDGNI----FCGMLNPDKRSSW
3d8xA           --------NKVTIIGSGPAAHTAAIYLARAE-IKPILYEGMMANGIAAGGQLTTTTEIENFPGFPDGLTG
3blyA           -----------VIVGSGPIGCTYARELVGAGYKVAMFDIGEIDSGLKIGAHKKNTVEYQKNIDKFVNVIQ
3bi2B           --------KKVIIIGAGIAGLKAASTLHQNGIQDCLVLEARDRVGGLQTVTGYQGRKYDIGASWH-HDTL
3bg7A           -----------VIVGSGPIGCTYARELVGAG-YKVAMFDIGEIDSGLKIGAHKKNTVEYQKNIDKFVNVI
1cj3A           ------MKTQVAIIGAGPSGL-LLGQLLHKAGIDNVILERQTPDEVLGRIRAGVLEQGMVDLLREAGVDR
2e1mA           --------KRILIVGAGIAGLVAGDLLTRAG-HDVTILENANRVGGRIKTFHAKKGEPSPFADPA---QY
3cnpA           --------KKVIIIGAGIAGLKAASLHQNGI-QDCLVLEARDRVGGRLQTVTGYQG----------RKYD
1cj2A           --------TQVAIIGAGPSGLLLGQLLHKAG-IDNVILERRTPDYVLGRIRAGVLEQGMVDLLREAGVDR
3dghB           -----------IVIGGGSAGLACAKEAVLN-GARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQ
2e5vA           --------KKVTLISKRIDGG-STPIAKGGVAASVGSDDSPELHAQDTIRV--GDGLCDVKTVNYVTSEA
3dl2B           --------NKITVVGGGELGIACTLAISAKG-IADRLVLLDLSEGTKGATMDLEIFNLISKDLSASAHSK
2dpoA           ---------DVLIVGSGLVGRSWAMLFASG-GFRVKLYDIEPRQITGALEN-------------------
3cirA           --SFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPW------------SRRPDGSVNVRRF
3cphG           -----------IVLGTGITECILSGLLSVD-GKKVLHIDKQDHYGGEAASVTLSQLYEKFKQNPISKEER
3cphH           -----------IVLGTGITECILSGLLSVD-GKKVLHIDKQDHYGGEAASVTLSQLYEKFKQNPISKEER
2dkiA           -TEAVPSQVDVLIVGCGPAGLTLAAQLAAFP-DIRTCIVEQKEGPMELGQADGIACRTMEMFEAFEFADS
3dghA           -----------IVIGGGSAGLACAKEAVLN-GARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQ
2dwcB           --------QKILLLGSGELGKEIAIEAQRLGVEVVAVDRYANAPAMQVAHRSYVGNMMDKDFLWSVVERE
1dy2A           ----AGLLSTFAFLSSHLQDLSTVVRKAER--FGLPIVNLKGQVLFNNWDSIFSGDGGQFNTHIPIYSFD
3djdA           --------SSLLIVGAGTWGTSTALHLARRGYTNVTVLDPYPVPSAISAGNDVNKVISSEVNEILAEEAF
1dobA           -----------AIIGAGPSGL-LLGQLLHKAGIDNVILERQTPDYVLGRIRAGVLEQGMVDLLREAGVDR
3cgbA           -----------VIIGGDAAGSAAQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVK
1aogA           -----------VVIGAGSGGL-EAAWNAATLYKKRVAVIDVQMVHGPPFFSALGGTCVNVGCVPKKLMVT
3e1tA           -----------IVIGGGPGGSTLASFVAMRG-HRVLLLEREAFPRHQIGESLLPATVHGICAMLGLTDEM
1b8sA           -----------VVIGTGYGAAVSALRLGEAG-VQTLMLEMGQLWNQPGPDGNIF----CGMLNPDKRSSW
3dh9A           -----------IVIGGGSAGLAC-AKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQ
2amfE           --------MKIGIIGVGKMASAIIKGLKQTP-HELIISGSSLERSKEIAEQ-LALPYAMSHQDLIDQVDL
2aefB           --------RHVVICGWSESTLECLRELRGSE-VFVLAEDENVRKKVLRSGANFVHGDPTRVSDLEKANV-
1b73A           ---------KIGIFDSGVGGLTVLKAIRNR-YRKVDIVYLGDTARVPYGIRSKDTIIRYSLECAGFLKDK
3cesD           -----------IIIGGGHAGTEAAMAAARMG-QQTLLLTHNIDTLGQMSCN--PAIGGIGKGHLVKEVDA
2czgA           --------QKILLLGSGELGKEIAIEAQRLG-VEVVAVDRYANAPAMQVAHRSYVGNMMDKDFLWSVVER
1cc2A           -----------VVIGTGYGAAVSALRLGEAG-VQTLMLEMGQLWNQPGPDGNIF----CGMLNPDKRSSW


                         .         .         *         .         .         .         .:140
query           PNPNWSQVFSPGPEIQTYLQNFAQDEGLLPHLHFNRNMNNARWDEKEGRWHITTPGQVYIAQFLITGTGH
1dxlA           HGVKVSNVEIDLAAMMGQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKFVSPIEGENTVVKGKHIIIATGS
2bk4B           NRIKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWRTMDDMGREIPSDAPWKAP-
2bc0A           PEGLFYSDKEELESLGAKVYMESPVQSIDYDAKTVTALVDGKNHVETYDKLIFATGSQPIPPIKGAEIKE
2c76B           RILRLAKELGLETYKVNEVERLIHHVKGKSYPFFPPVWNPITYLDHNNFWRTMDDMGRE--IPSDAPWKA
2a87A           ENYPGFRNGITGPELMDEMREQALRFGADLRMEDVESV----SLHGPLKSVVTADGQTHRARAVILAMGA
2a87B           ENYPGFRNGITGPELMDEMREQALRFG----ADLRMEDVESVSLHGPLKSVVTADGQTHRARAVILAMGA
2c75B           NRIKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWRTMDDMGREIPSD--APWKA
2c72A           NRILELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWRTMDDMGRE--IPSDAPWKA
1cl0A           RMHEHATKFE----------------------TEIIFDHINKVDLQNRPFRLNGDNGEYTCDALIIATGA
1e6eC           -RFGVAPDHPEVKNVINTFTQTARS----DRCAFYGNVEVGRDVTVQELQDAYHAVVLSYGAEDHQALDI
2b9wA           TIQEIMDRTGDKVDGPKLRREFLHEDGEIYVPEKDPVRGPQVMAAVQKLGLLATKYQGYDANGHYNKVHE
3eanC           GWKLEDTVKHDWEKMTESVQNHIGSLNWGYRVALREKKVVYENAYGKFIGPHKGKEKVYSAERFLIATGE
2bk4A           NRIKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWRTMDDMGREIPSDAPWKAP-
1b37B           ---GKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIEMGEKLSATLHASGRDDMSI
2b76M           ADKTGFHMLHTLFQTS---LQFPQIQRFDEHFVLDILVDDGHVRGLVAMNMMEGTLVQIRANAVVMATGV
2c73A           NRIKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWRTMDDMGREIPSDAP--WKA
1b37A           GKMNP---IWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIEMGEKLSATLHASGRDDMSI
1dncA           ADYGFPSCEGKWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHADPKPTIEVSGKKYTAPHILIATG-
3d1cA           PAFTFNEEHISGETYAEYLQVVANHYEL----NIFENTVVTNISADDAYYTIATTTETYHADYIFVATGD
2c76A           NRIKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWRTMDDGREIPSDAPWKAPLA
1cjcA           TARSD-------------------------RCAFYGNVEVGRDVTVQELQDAYHAVVLSYGAEDHQALDI
1eehA           LIVASPGIALAHPSLSAAADAGIEIVGDIELFCREAQAPIVAITGSNGKSTVTTLVYVLELSSFQLETTS
3dk9A           YGFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKSIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGG
2b76A           ADKTGFHML---HTLFQTSLQFPQIQRFDEHFVLDILVDDGHVRGLVAMNMMEGTLVQIRANAVVMATGG
3c4nA           EWTREQLLGALGSGKTLEVEDRPLLHLLPAGEGSGLTPTLDALADFPEALALRLPVARVDPRALTYRPGS
2bc1A           SDKEELESLGAKVYMESPVQSIDYDAKTVTALVDGKNHVETYDKLIFATGSQPILPPIKGAEIKEGSLE-
2cduB           SSPEELSNLGA-----------------NVQMRHQVTNVDPETKTIKVKDLITNEEKTEAYDKLIMTTGK
2c75A           NRIKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWRTMDDMGREIPSDAP--WKA
3cukA           WSQQTFDYLLSHVHSPNAENLGLFLISGYNEAIPDPSWKDTVLGFRKLTPRELDMFPDYGYGWFHTSLIL
3c4aA           PERLNPQFLEDFKLVHHNEPSLSTGVLLCGVERRGLVHALRDKCRSQGIAIRFESLPLADYDLVVLANGV
1e0dA           LIVASPGIALAHPSLSAAADAGIEIVGDIELFCREAQAPIVAITGSNGKSTVTTLVGEMAKAAGVNVGGN
3ctyB           F---ADHAANYAKIR--------------------EGVEVRSIKKTQGGFDIETNDDTYHAKYVIITTG-
2e4gA           WMRECNASYKVAIKFINWRTAGEGTSEARELDGGPDHFYHSFGLLKYHEQIP------------------
2e4gB           WMRECNASYKVAIKFINWRTAGEGTSEARELDGGPDHFYHSFGLLKYHEQIPLSHYWFDRSYRGKTVEPF
3cp8A           TGIQFRMLNRSKGPAMHSPRAQADKTQYSLYMRRIVEHEPNIDLLQDTVIGVVTVRSGRAIQAKAAILAC
3ctyA           --NYLGFKSIVGSELAKLFADHAANYA---KIREGVEVRSIKKTQGG--FDIETNDDTYHAKYVIITTG-
3bg6A           QGQLMSVSVPVNTLVVDTLSPTSWQASTFFVRNGSNPEQDPLRNLSVGGMSTHWTCATPRFDREQRPLLV
2cyjA           -----------------------------------------------VRFGLVKIGKEFDHDIVIYPSGR
2c72B           NRILRLAKELGLETYKVNEVEIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWRTMDDMGREIPSDAPWKA
1an9A           PQEANWNQQTFNYLLSHIGSPNAANMGLTPVSGYNLFREAVPDPYWKDMVLGFRMFPDYRYGWFNTSLIL
2cduA           SSPEELSNLGANV----------------QMRHQVTNVDPETKTIKVKDLITNEEKTEAYDKLIMTTGSK
3eanF           VKHDWEKMTESVQNHIGSLNWGYRVALREKKVVYENAYGKFIGPHKIMATNNKGKEKVYSAERFLIATGE
2c73B           NRILR-LAKELGLETYKVNRLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWRTMDDMGREIPSDAPWKA
3cpjG           LIPKFLMANGELTNILIHTDVTRYVDFKQVSGSYVFKQGKIYKVPANEIEAISSPLMGIFEKRRMKKFLE
2culA           PSLLERAYDPKDERVWAFHARAKYLLEGLRPLHLFQATATGLLLEGNRVVGVTWEGPPARGEKVVLAVGS
2apgA           WMPQVNGAFKAAIKFVNWRKSPDPSRDDHFYHLFGNVPNCDGVPLTHYWLR-------------------
1ebdA           ASVVKKLTGGVEGLLKGNKVEIVKGEAYFVDANTVRVVNGDSAQTYTFKNAIIATGSRP-----------
1bhyA           HLAANGIKYPEPELDIDMLRAYKDGVVSRLTGGLAGMAKSRKVDVIQGDGQFLDPHHLTGEKKIVAFKNC
1d5tA           MGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGLMGMFEKRRFRKFLVFVANFDE
2dkhA           ACWINDVTFWKPDPGQPGRIARHGRVQDTEDGLSEFPHVILNQARVHDHYLERMRNSPSRLEPHYARRVL
3d4oA           AGKVDTIFSNESIVLTEEIEKTPNHCVVYSGISNTYLNQCKKTNRTLVKLERDDIA--------------
3eanD           QNHIGSLNWGYRVALREKKVVYENAYGKFIGPHKIMATNNKGKEKVYSAERF-----------------L
3cgvA           ANEVKGARIYGPSEKRPHLAALAAKAGADVWVKSPALGVIKENGKVAGAKIRHNNEIVDVRAKVIAADGF
3eanA           GWKLEDTVKHDWEKMTESVQNHIGSLNWGYRVALREKKVVYENAYGKFIGPHKIMATNNKGKEKVYSAER
2a8xA           DAKAFGISGEV-TFDYGIAYDRSRKVAEGRVAGVHFLKKNKITEIHGYGTFADANTLLVDDGGTESVTFD
3cnsA           TNPLFLEEAQLSLN--DGRTRFVFDDDNFIYIDEERGRVDHDKELLLEIVD-------------------
3bi4B           TNPLFLEEAQLSLNDGRTRFVFDDDNFIYIDEERGRVDHDKELLLEIVDNEM------------------
3d4oC           GTNEAGKVDTIFSNESIVLTEEIEKTPNHCVVYSGISNTYLNQCKKTNRTLV------------------
3cgcA           VKTFRDKYGID------------------AKVRHEVTKVDTEKKIVYAEHTKTKDVFEFSYDRLLIATG-
3coxA           INKSIDRYVGVLDSERFSGIKVYQGRGVGGGSLVNGGMAVRNYFEEILPSVDSNEMYNKYFPRANTGLGV
2cfyA           TVKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYENA-YGQFIGPHRIKATNNKGKEKIYSAERFLIAT
3bi2A           TNPLFLEEAQLSLNDGRTRFVFDDDNFIYIDEERGRVDHDKELLLEIVDNEM------------------
3cpiG           SKFGKDRDWNVDLIPKFLMANGELTNILIHTDVTRYVDFKQVSGSYVEIEAISSPLMGIFEKRRMKKFLE
3cpiH           ESKFGKDRDWNVDLIPKFLMANGELTNILIHTDVTRYVDFKQVSGSYVFKQGKIYKVPANEIEAISSPLM
1cc6A           RMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEARE-------------------
1cc4A           RMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEARE-------------------
1bf3A           RRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREASGATTDLQGERPYVTFERDGERLRLDCDYIAGCDGFH
1d7yA           KRA---------------------------PEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGTLVLATGA
1aogB           GAQYMEHLRESAGFGWEFDRTTLRAEWKNLIAVKDEAVLNINKSYDEMFRD-------------------
2du8A           PQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPKLTPRELDMFPDYGYGWFHTSLILEG
2ardA           WMPQVNGAFKAAIKFVNWRKSPDPSRDDHFYHLFGNVPNCDGVPLTHYWLRKREQGFQQPMEYACYPQPG
3bi4A           TNPLFLEEAQLSLNDGRTRFVFDDDNFIYIDEERGRVDHDKELLLEIVDNEMSKFAELEFHQHLGVSDCS
3c96A           AGNAYPQYSIHRGELQMILLAAVRERLGQQAVRTGLGVERIEERDGRVLIGARDGPQALGADVLVGADGI
2dw4A           GNPMA-----------------------------------------------------------------
3djdB           FNGWKNDPLFKPYYHDTGLLSACSQEGLDRLNLVELTRPEQFRKLAPEGV--------------------
1e6eA           FTQTARSDRCAFYGNVEVGRDVTVQELQDAYHAVVLSYGAEDHQALDIPGEELPGVFSARAFVGWYNGLP
2ejrA           GNPMA-----------------------------------------------------------------
3cntB           TNPLFLEEAQLSLNDGRTRFVFDDDNFIYIDEERGRVDHDKEL---------------------------
1bzlA           GAQYMEHLRESAGFGWEFDRTTLRAEWKNLIAVKDEAVLNINKSYDEMFRD-------------------
3cnsB           TNPLFLEEAQLSLNDGRTRFVFDDDNFIYIDEERGRVDHDKEL---------------------------
3b3rA           TEAPL-----------------------------------------------------------------
2bxrA           ----------------------------------------------------------------------
2bxsA           ----------------------------------------------------------------------
1coyA           SNFMGFGINKSIDRYVGVLDKVYQGRGVGGGSLVNGGMAVTNYFEEILPSVDSNEMYNKYFPRANTGLGV
1d7lA           RMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEARE-------------------
3cp8D           EMGKA------------IDATGIQFRMLNRSKGPAMHSPRAQADKTQYSLYMRRIVEHEPNIDLLQDTVI
3djeB           EVNEILAEEAFNGWKNDPLFKPYYHDTGLLSACSQEGLDRLGVRVRPGED--------------------
2bi7A           DNETV---------------WNYVNKHAEMMPYVNRVKATVNGQVFSLPINLHTINQFFSKTCSPDEARA
3cnjA           FKNRTEAPLGSFLWLDVVNRNIDPYAGVLDRVNYD-----------------------------------
3d8xA           SELMDRMREQSTKFGTEIITETVSKVDLSSKPFKLWTEFNEDAEPVTTDAIILATGA-------------
3blyA           GQLMSVSVPVNTLVVDTLSPTSWQASTFFVRNGSNPEQDPLRNLSGQAVTRVVGGMSTHWTCATPRFDRE
3bi2B           TNPLFLEEAQLSLNDGRTRFVFDDDNFIYIDEERGRVDHDKEL---------------------------
3bg7A           QGQLMSVSVPVNTLVVDTLSPTWQASTFFVRNGSNPEQDPLRNLSGQAVWTCATPRFDREQRPLLVKDDA
1cj3A           RMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREASGATTVYQAAEVRLHDLQ
2e1mA           AEAGAMRLPSFHPLTLALIDKLGLKRRLFFNVDIDPQT--------------------------------
3cnpA           IGASW--HHDTLTNPLFLEEAQLSLNDGRTRFVFDDD---------------------------------
1cj2A           RMARD--------GLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREASGATTVYQAA
3dghB           ASLLGEAVHEAAAYGWNVDDKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDK-------------------
2e5vA           KNVIETFESWGFEFEEDLRLEGGHTKRRVLHIIEDRLVEIRVKDGKVTGFVTEKRGLVEDVDKLVLATGG
3dl2B           VVIFTVNSQSYLDVVQSNVDMFRALVPALGHYSQHMTYVTWKLSTFPANRVIGIGCNLDSQRLQYIITEQ
2dpoA           ----------------------------------------------------------------------
3cirA           GGMKIERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLDILVDDGHVRG-----LVAMNMMEGTLV
3cphG           ESKFGKDRDWNVDLIPKFLMANGELTNILIHTDVTRYVDFKQVSGSYVFKQGKIYKVPANEIEAIKKFLE
3cphH           ESKFGKDRDWNVDLIPKFLMANGELTNILIHTDVTRYVDFKQVSGSYVFKQ-------------------
2dkiA           ILKEACWINDVTFWKPDPGQPGRIARHGRVQDTEDGLSEFPHVILNQARVHDHYLERMRNSPSRLEPHYA
3dghA           ASLLG-----------------------------------------------------------------
2dwcB           KPDAIIPEIEAINLDALFEFEKDGYFVVPNARATWIAMHR-ERLRETLVKEAKVP---------------
1dy2A           GR--------------------------------------------------------------------
3djdA           NGWKNDPLFKPYYHDTGLLSACSQEGLDRLEDPNLVELTRPEQFRKLAPEGVLQGDFPGWKGYFARSGAG
1dobA           RMARD-------GLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREACGATTVYQAAE
3cgbA           TFRDKYGIDAKVRHE--------------------VTKVDTEKKIVYAEHTKTKDVFEFSYDRLLIATGV
1aogA           GAQYMEHLRESAGFGWEFDRTTLRAEWKNLIAVKDEAVLNINKSYDEMFRD-------------------
3e1tA           KRAGFPIKRGGTFRWGKEPEPWTFGFTRHPDDPYGFAYQVERARFDDMLLR-------------------
1b8sA           FKNRTEAPLGSFLWLDVVNRNIDPYAGVLDRVNY------------------------------------
3dh9A           ASLLGEAVHEAAAYGWNVDDKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDK-------------------
2amfE           VILGIKPQ--LFETVLKPLHFKQPIISMAAGISLQRLATFVGQDLPLLRIMPNMNAQILQSSTALTGNAL
2aefB           --RGARAVIVDLESDSETIHCILGIRKIDESVRIIERYENIEQLRMAGADQVISPFVISGRLMSRSIDDG
1b73A           GVDII-----------------------------------------------------------------
3cesD           LGGLMAK-AIDQAGIQFRILNASKGPAVRATRAQADRVLYRQAVRTALENQPNLMIFQQAVEDLIVEND-
2czgA           EKPDA--IIPEIEAINLDALFEFEKDGVPNARATWIAMHR------------------------------
1cc2A           FKNRTEAPLGSFLWLDVVNRNIDPYAGVLDRVNY------------------------------------


                         +         .         .         .         .         *         .:210
query           LADESYPTIPGLESFTGEKFHSARWDHNVSLKGKRIGVVGTGASAIQIVPEMAKIASELVVFQRTPSYII
1dxlA           -----DVKSLPGVTIDEKKIVSSTGALALSEIPKKLVVIGAGYIGLEMGSVWGRIGSEVTVVEFASEIVP
2bk4B           -LAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIFSTTNGGQE
2bc0A           GSLEFEATLENLQFVKLYQNSADVIAKLENKDIKRVAVVGAGYIGVELAEAFQRKGKEVVLIDVVDTCLA
2c76B           PLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQE
2a87A           AAR--YLQVPGEQELLGRGVSSCATCDGFFFRDQDIAVIGGGDSAMEEATFLTRFARSVTLVHRRDEFRA
2a87B           AA--RYLQVPGEQELLGRGVSSCATCDGFFFRDQDIAVIGGGDSAMEEATFLTRFARSVTLVHRRD----
2c75B           PLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQE
2c72A           PLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQE
1cl0A           --SARYLGLPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRA
1e6eC           PGEELPGVFSARAFVGWYNGLPENRELAPDLSCDTAVILGQGNVALDVARILLTPPDHLEKTDITEAALG
2b9wA           DLMLPFDEFLALNGCEAARDLWINPFT-------------------------------------------
3eanC           RP--RYLGIPGDKEYCISSDDLFSLPY----CPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRG
2bk4A           -LAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIFSTTNGGQE
1b37B           LAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVY
2b76M           YRYNTNGGIVTGDGMGMALSHGVPLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKNGYRYLQDYGM
2c73A           PLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQE
1b37A           LAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVY
1dncA           -GMPSTPHESQIPGA--SLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLR
3d1cA           --------YNFPKKPFKYGIHYSEIEDFDNFNKGQYVVIGGNESGFDAAYQLAKNGSDIALYTSPSVRLS
2c76A           EEWDNMTMKELLDKLCWTESAKQLATLFV---NLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQE
1cjcA           PGEELPGVFSARAFVGWYNGLPENRELAPDLSCDTAVILGQGNVALDVARILLTPPDHLEKTDITEAALG
1eehA           SLQAVAATILNVTEDHMDRYPFGLQQYRRIYENAKVCVVNADDALTMPIRGAD--ERCVSFGVNMGDYHL
3dk9A           MPS----TPHESQIPGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLR
2b76A           -AGRVYRYNTNGGIVTGDGMGMALSHGVPFVQYHPTGLPGSGILMTEGCRGEGGILVNKNGYRYLQDYGM
3c4nA           LA--------------------------------------------------------------------
2bc1A           ----FEATLENLQFVKLYQNSADVIAKLENKDIKRVAVVGAGYIGVELAEAFQRKGKEVVLIDVVDTCLA
2cduB           PTVPPIPGIDSSRVYLCKNYNDAKKLFEEAPKAKTITIIGSGYIGAELAEAYSNQNYNVNLIDGHERVLY
2c75A           PLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQE
3cukA           EGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVNCTGVWAGALQRDPLLQPGRGQIMKVDAPW
3c4aA           NHKTAHFTEALVPQVDYGRNKYIWYGTSQLFDQNLVFRTHGKDIFIAHAYKYSDTSTFIVECSEETYARA
1e0dA           IGLPALMLLDDECELYVLELSSFQLETTSSLQAVAATILNVTEDFGLQQYRAAKL----RIYENAKVCVV
3ctyB           -TTHKHLGVKGESEYFGKGTSYCSTCDGYLFKGKRVVTIGGGNSGAIAAISMSEYVKNVTIIEYMPKYMC
2e4gA           ----------------------------------------------------------------------
2e4gB           DYACYKEPVILDANRSPRRLDGSKVTNYAWHFDAHLVADFLRRFATEKLGVRHVEDRVEHVQRDANGNIE
3cp8A           GTFLNGLIHIGMDHFPGGRSTAEPPVE---GLTESLASLGFSFGRLKTGTPPRIDSRSVDYTIVTEQPGD
3ctyA           -TTHKHLGVKGESEYFGKGTSYCSTCDGYLFKGKRVVTIGGGNSGAIAAISMSEYVKNVTIIEYMPKYMC
3bg6A           KDDADADDAEWDRLYTKAESYFQTGTDQFKESIRHNLVLNKLTEEYKGQRDFQQIPLAATRRSPTFVEWS
2cyjA           IE--RRMKEISKKKHGTSHKLDPEEEKYLVEDFDVLLVGTGIYGMLSLLPESKKLVEDKEVIEKPTKEAL
2c72B           PLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQE
1an9A           EGRKYLQWLTERLTERGVKFFLRKVESFEEVARGGADVIINCTG--VWAGVLQPDPLLQPGRGQIIKVDA
2cduA           PTVPPIPGIDSSRVYLCKNYNDAKKLFEEAPKAKTITIIGSGYIGAELAEAYSNQNYNVNLIDGHERVLY
3eanF           -----RPRYLGI-PGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRG
2c73B           PLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQE
3cpjG           WISSYKEDDLSTHQGLDLDKNTMDEVYYKFGLGNSTKEFIGHAMALWTNDDYLQQPARPSFERILLYCQS
2culA           FLGARLFLGGVVEEAGRLSEASYPDLLE---DLSRLGFRFVEREGEVPPGYRVRYLAFHPEEWEEKTFRL
2apgA           ----------------------------------------------------------------------
1ebdA           ----IELPNFK---FSNRILDSTGALNLGE-VPKSLVVIGGGYIGIELGTAYANFGTKVTILEGAGEILS
1bhyA           IIAAGSRVTKLPFIPEDPRIIDSSGALALKEVPGKLLIIGGGIIGLEMGTVYSTLGSRLDVVEMMDGLMQ
1d5tA           NDPKTFEGVDQNTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETINIKLYSESLAR------
2dkhA           DVKVDHGAADYPVTVTLERCDAAHAGQIETVQARYVVGCDGARSNVRRAIGRQLVGDSANQAWGVMDVLA
3d4oA           ----------------------------------------------------------------------
3eanD           IATGERPRYLGIP-GDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRG
3cgvA           ESEFGRWAGLKSVILARNDIISALQYRINVDVDPDYTDFYLGSIAPAGYIWVFPKGEGANVGIGSSIN--
3eanA           FATGERPRYLGIPGDKEYCISS-DDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILL-R
2a8xA           NAIIATGSSTRLVPGTSLSANVVTYEEQILSRELPKSIIIAGAGAIEFGYVLKNYGVDVTIVEFLPRALP
3cnsA           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3d4oC           ----------------------------------------------------------------------
3cgcA           -VRPVMPEWEGRDLQGVHLLAERILKTLETNKVEDVTIIGGGAIGLEMAETFVELGKKVRMIERNDHIGT
3coxA           NNIDQAWFESTEWYKFARTGRKTAQRSGFTTAFVPNVYDFEYMKKEAAGQVTKSGLGGEVIYGNNA----
2cfyA           GERPRYLGIPGDKEY----CISSDDLFSLPYCPGKTLVVGAS----------------------------
3bi2A           ----------------------------------------------------------------------
3cpiG           WISSYKEDDLSTHQGLDLDKNTMDEVYYKFGLGNSTKEFIGHAMALWTNDDYLQQPARPSFERILLYCQS
3cpiH           GIFSYKEDDLSTHQGLDLDKNTMDEVYYKFGLGNSTKEFIGHAMALWTNDDYLQQPARPSFERILLYCQS
1cc6A           ----------------------------------------------------------------------
1cc4A           ----------------------------------------------------------------------
1bf3A           GISRQSIPAERLKVFERVYPFGWLGLLADTPPVSHELIYANHPRGFALCSQRSATRSRYYVQVPLTEKVE
1d7yA           APRALP--TLQGATHTLRTLEDARRIQAGLRPQSRLLIVGGGVIGLELAATARTAGVHVSLVETQPRLMS
1aogB           ----------------------------------------------------------------------
2du8A           KNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVNCTGVWAGALQRDPLLQPGRGQIMKVDAPWMK
2ardA           ALDGKLAPCLSDGTRQMSHAWHFDAHL-------------------------------------------
3bi4A           FFQLV-----------------------------------------------------------------
3c96A           HSAVRAHLHPDPLSHGGITMWRGVTEFDRFLDGKTMIVANDE--HWSRLVAYPISARHAAEGKSLVNWVC
2dw4A           ----------------------------------------------------------------------
3djdB           ----------------------------------------------------------------------
1e6eA           ENRELAPDLSCDTAVILGQGNVALDVARILLTPPDHLEKTDITEAALGALRQSRVKTVWIVGRRGPLQVA
2ejrA           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
1bzlA           ----------------------------------------------------------------------
3cnsB           ----------------------------------------------------------------------
3b3rA           ----------------------------------------------------------------------
2bxrA           ----------------------------------------------------------------------
2bxsA           ----------------------------------------------------------------------
1coyA           NNIDQAWFESTEWYKFARTGRKTAQRSGFTTAFVPNVYDFEYMKKEAA--GQVTKSGLG-----------
1d7lA           ----------------------------------------------------------------------
3cp8D           GVSANSGKFSSVTVRSGRAIQA------------------------------------------------
3djeB           ----------------------------------------------------------------------
2bi7A           LAEKGDSTIADPQTFEEEALRFIGKELYEAFFKGYTIKQWGMQPSELPASILKRLPVRFNYDDNYFNHKF
3cnjA           ----------------------------------------------------------------------
3d8xA           --SAKRMHLPGEETYWQKGISACAVCDGAVPINKPLAVIGGGDSACEEAQFLTKYGSKVFMLVRKDHLRA
3blyA           QADDAEWDRLYTKAESYFQTGTDQFKESIRHNLVLNKLTEEYKGQRDFQQIPLAATRRSPTFVEWSSANT
3bi2B           ----------------------------------------------------------------------
3bg7A           DADDAEW-DRLYTKAESYFQTGTDQFKE-SIRHNLVLNKLTEEYKGQRDFQQIPLAATRRSPTFVEWSSA
1cj3A           GERPYVTFERDGERLRLDCDYIAGCDGFHGISRQSIPA--------------------------------
2e1mA           ----------------------------------------------------------------------
3cnpA           ----------------------------------------------------------------------
1cj2A           EVRLHDLQGERPYVTFERDGERLRLDC-------------------------------------------
3dghB           ----------------------------------------------------------------------
2e5vA           --YSYLYEYSSTQSTNIGDGMAIAFKAGTILADMEFVQFHPTVTSLDGEVFLLTETLRGEGAQIINE---
3dl2B           GEDKVLTWSGQEEVVSHTSQVQLSNRAMELLRVKGQRSWSVGLSVADMVDSIVNNKKKVHSVSALAKGYY
2dpoA           ----------------------------------------------------------------------
3cirA           -QIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHGVPLRDMEFVQYHPAGLPGSGILMTEGCRGE
3cphG           WISSYKEDDLSTHQGLDLDKNTMDEVYYKFGLGNSTKEFIGHAMALWTNDDYLQQPARPSFERILLYCQS
3cphH           ----------------------------------------------------------------------
2dkiA           RRVLDVKVDHGAADYPVTVTLERCDAA-------------------------------------------
3dghA           ----------------------------------------------------------------------
2dwcB           ----------------------------------------------------------------------
1dy2A           ----------------------------------------------------------------------
3djdA           WA--------------------------------------------------------------------
1dobA           VRLHDLQGERPYVTFERDGERLRLDCDYI-----------------------------------------
3cgbA           RPVPEWEGRDLQGVHLLKTIPDAERILKTLETNKVEDVTIIGGGAIGLEATFVELGKKVRIERNDH----
1aogA           ----------------------------------------------------------------------
3e1tA           ----------------------------------------------------------------------
1b8sA           ----------------------------------------------------------------------
3dh9A           ----------------------------------------------------------------------
2amfE           VSQELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYLFIEALAKAGVKN---------------
2aefB           YEAMFVQDVLAEESTRR--MVEVPIPEGSKLEGVSVLDA-------------------------------
1b73A           ----------------------------------------------------------------------
3cesD           ----------------------------------------------------------------------
2czgA           ----------------------------------------------------------------------
1cc2A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PRMERKYTDGEKRLFQRNPHVIENLRSELFWGGENTFAQRRAIPRFLAEGKKLALDHLAAQVSDEELRAK
1dxlA           TMDAEIRKQFQRSLEKQGMKFKLKTKVVGVDTSGD-----------------------------------
2bk4B           RKFVGGSGQVSERIMDLLGDRVKL----------------------------------------------
2bc0A           GYYDRDLTDLMAKNMEEHGIQLA-----------------------------------------------
2c76B           RKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQTREN---------------------------------
2a87A           SK------IMLDRARNNDKIRFLTNHTVVAVDGDTTVTGLRVRDTNTGAETTLPVTGV------------
2a87B           --EFRASKIMLDRARNNDKIRFLTNHTVVAVDGDTTVTGLRVRDTNTGAETTLPVTGV------------
2c75B           RKFVGGSGQVSERIMDLLGDRVKL----------------------------------------------
2c72A           RKFVGGSGQVSERIMDLLGDRVKLERPVIYI---------------------------------------
1cl0A           EKILIKRLMDKVENGNIILHTNRTLEEVTGDQMG-VTGVRLRDTQNSDNIESLDVAGL------------
1e6eC           ALRQSRVKTVWIVGRRGPLQVAFTIKELREMIQLPGTRPMLDPADFLGLQDRIKEAARPRKRLMELLLRT
2b9wA           ----------------------------------------------------------------------
3eanC           FDQDMANKIGEHMEEHGIKFIRQFVPTKIIEAGTPGRLKVTAKSTNSEETIEDEFNTV------------
2bk4A           RKFVGGSGQVSERIMDLLGD--------------------------------------------------
1b37B           YLAGQYLKTDDKSGKIVDPRLQLNKVVREIK---------------------------------------
2b76M           GPETPLGEPKNKYMELGPRDKVSQAFWHEWRKG-------------------------------------
2c73A           RKFVGGSGQVSERIMDLLGDRV------------------------------------------------
1b37A           YLAGQYLKTDDKSGKIVDPRLQLNKVVREIK---------------------------------------
1dncA           SFDSMISTNCTEELENAGVEVLKF----------------------------------------------
3d1cA           PYTRQRLGNVIKQGARIENVH-------------------------------------------------
2c76A           RKFVGGSGQVSERIMDLLGD--------------------------------------------------
1cjcA           AGRRGPLQVAFTIKELREMIQLPGTRPMLDPADFLGLQDRIKEAARPRKRLMELLLRTATEKPGVEEAAR
1eehA           TWLRVKGVLNVKEMKLSGQHNYTN----------------------------------------------
3dk9A           SFDSMISTNCTEELENAGVEVLKFKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVDCL------------
2b76A           GPETPLGEPKNKYMELGPRDKVSQAFWHEWRKGNT-----------------------------------
3c4nA           ----------------------------------------------------------------------
2bc1A           GYYDRDLTDLMAKNMEEHGIQLA-----------------------------------------------
2cduB           KYFDKEFTDILAKDYEAHGVNL------------------------------------------------
2c75A           RKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQTR-----------------------------------
3cukA           MKHFILTHDPERGIYNSPYIIPGTQTVTLGGIFQLGNWSELNNIQDHNT---------------------
3c4aA           RLGESEEASAEYVAKVFQAE--------------------------------------------------
1e0dA           NADDALTMPIADERCVSFGVNMGDYHLNHQQGETWLR---------------------------------
3ctyB           ENAYVQEIKKRNIPYIMNAQVTEI----------------------------------------------
2e4gA           ----------------------------------------------------------------------
2e4gB           SVRTATGRVFDADLFVDCSGFRGLLINKAMEEPFLDMSDHLLN---------------------------
3cp8A           VD--------------------------------------------------------------------
3ctyA           ENAYVQEIKKRNIPYIMNAQVTE-----------------------------------------------
3bg6A           SANTVFDLQNRPNTDAPEERFNLFPAVACER---------------------------------------
2cyjA           KLLEELWGKRILAIIH------------------------------------------------------
2c72B           RKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQTREN---------------------------------
1an9A           PWLKNFIITHDLERGIYNSPYIIPGLQAVTLGGTFQVGNWNEINNI------------------------
2cduA           KYFDKEFTDILAKDYEAHGVNLVLGSKVAAFEEVDDEIITKSDIAILCIGFRPNTELLKGKV--------
3eanF           FDQDMANKI-GEHMEEHGIKFIRQ----------------------------------------------
2c73B           RKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQTR-----------------------------------
3cpjG           VARYGKSPYLYPMYGLGELPQGFARLSAIYGGTYMLDTPIDEV---------------------------
2culA           KRLEGLYAVGLCV---------------------------------------------------------
2apgA           ----------------------------------------------------------------------
1ebdA           GFEKQMAAIIKKRLKKKGVEVVTNALAKGAEEREDGVTVTY-----------------------------
1bhyA           GADRDLVKVWQKQNEYRFDNIMVNTKTVAVEPKED-----------------------------------
1d5tA           ----------------------------------------------------------------------
2dkhA           VTDFPDVRYKVAIQSEQGNVLIIPREGGHLVRFYVEM-DNITVEQLIATAQRVLHPYKLEVKNVPWWSVY
3d4oA           ----------------------------------------------------------------------
3eanD           FDQD------------------------------------------------------------------
3cgvA           WIHNRFELKNYLDRFIENHPGLKKGQDIQLVTGGVSVSKVKPITPGLLVG--------------------
3eanA           GFDQDMANKIGEHMEEHGIKFIRQ----------------------------------------------
2a8xA           NEDADVSKEIEKQFKKLGVTILTATKVESIADGGSQV---------------------------------
3cnsA           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3d4oC           ----------------------------------------------------------------------
3cgcA           IYDGDMAEYIYKEADKHHIEILTN----------------------------------------------
3coxA           ----------------------------------------------------------------------
2cfyA           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------
3cpiG           VARYGKS---------------------------------------------------------------
3cpiH           VARYGKS---------------------------------------------------------------
1cc6A           ----------------------------------------------------------------------
1cc4A           ----------------------------------------------------------------------
1bf3A           DWSDERFWTELKARLPAEVAEKLVTGPSLEKS--------------------------------------
1d7yA           RAAPATLADFARYHAAQGVDLRFERSVTGSVDGVVLLDDGTRIA--------------------------
1aogB           ----------------------------------------------------------------------
2du8A           HFILTHDPERGIYNSPYIIPGTQTVTLGGIF---------------------------------------
2ardA           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3c96A           MVPSAAVGQLDNEADWNRDGRLEDVLPFFAD---------------------------------------
2dw4A           ----------------------------------------------------------------------
3djdB           ----------------------------------------------------------------------
1e6eA           FTIKELREMIQLPGTRPMLDPADFLGLQDRIKEAARPRKRLMELLLRTATEKPGVEEAARRASASR---A
2ejrA           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
1bzlA           ----------------------------------------------------------------------
3cnsB           ----------------------------------------------------------------------
3b3rA           ----------------------------------------------------------------------
2bxrA           ----------------------------------------------------------------------
2bxsA           ----------------------------------------------------------------------
1coyA           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
3cp8D           ----------------------------------------------------------------------
3djeB           ----------------------------------------------------------------------
2bi7A           QGMPKCGYTQMIKSILNHENI-------------------------------------------------
3cnjA           ----------------------------------------------------------------------
3d8xA           STIMQKRAEKNEKIEILYNTVALE----------------------------------------------
3blyA           VFDLQNR---------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
3bg7A           NTVFDLQNRPNTDAPEERFNLFPAVACERVVR--------------------------------------
1cj3A           ----------------------------------------------------------------------
2e1mA           ----------------------------------------------------------------------
3cnpA           ----------------------------------------------------------------------
1cj2A           ----------------------------------------------------------------------
3dghB           ----------------------------------------------------------------------
2e5vA           ----------------------------------------------------------------------
3dl2B           DINSEVF---------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
3cirA           GGIRDKVSQAFWHEWRKGNTISTP----------------------------------------------
3cphG           VAR-------------------------------------------------------------------
3cphH           ----------------------------------------------------------------------
2dkiA           ----------------------------------------------------------------------
3dghA           ----------------------------------------------------------------------
2dwcB           ----------------------------------------------------------------------
1dy2A           ----------------------------------------------------------------------
3djdA           ----------------------------------------------------------------------
1dobA           ----------------------------------------------------------------------
3cgbA           ----------------------------------------------------------------------
1aogA           ----------------------------------------------------------------------
3e1tA           ----------------------------------------------------------------------
1b8sA           ----------------------------------------------------------------------
3dh9A           ----------------------------------------------------------------------
2amfE           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
1b73A           ----------------------------------------------------------------------
3cesD           ----------------------------------------------------------------------
2czgA           ----------------------------------------------------------------------
1cc2A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LTPSYEPGCKRVLISNTYYPALQSPITTLEASALSSINGSTVRAASGEEYELDILIFATGFEATEPPYAQ
1dxlA           ----------------------------------------------------------------------
2bk4B           ----------------------------------------------------------------------
2bc0A           ----------------------------------------------------------------------
2c76B           ----------------------------------------------------------------------
2a87A           ----------------------------------------------------------------------
2a87B           ----------------------------------------------------------------------
2c75B           ----------------------------------------------------------------------
2c72A           ----------------------------------------------------------------------
1cl0A           ----------------------------------------------------------------------
1e6eC           ATEKPGVEAWGLRFFRSPQQVLPSPGRRAAGIRLAVTRLRAVPTGDVEDLPCGLVLSSIGYKSRPIDPSV
2b9wA           ----------------------------------------------------------------------
3eanC           ----------------------------------------------------------------------
2bk4A           ----------------------------------------------------------------------
1b37B           ----------------------------------------------------------------------
2b76M           ----------------------------------------------------------------------
2c73A           ----------------------------------------------------------------------
1b37A           ----------------------------------------------------------------------
1dncA           ----------------------------------------------------------------------
3d1cA           ----------------------------------------------------------------------
2c76A           ----------------------------------------------------------------------
1cjcA           WGLRFFRSPQQVLPSPDGRRAAGIRLAVTRLEG-IGEATRAVPTGDVEDLPCGLVLSSIGYKSRPIDPSV
1eehA           ----------------------------------------------------------------------
3dk9A           ----------------------------------------------------------------------
2b76A           ----------------------------------------------------------------------
3c4nA           ----------------------------------------------------------------------
2bc1A           ----------------------------------------------------------------------
2cduB           ----------------------------------------------------------------------
2c75A           ----------------------------------------------------------------------
3cukA           ----------------------------------------------------------------------
3c4aA           ----------------------------------------------------------------------
1e0dA           ----------------------------------------------------------------------
3ctyB           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
2e4gB           ----------------------------------------------------------------------
3cp8A           ----------------------------------------------------------------------
3ctyA           ----------------------------------------------------------------------
3bg6A           ----------------------------------------------------------------------
2cyjA           ----------------------------------------------------------------------
2c72B           ----------------------------------------------------------------------
1an9A           ----------------------------------------------------------------------
2cduA           ----------------------------------------------------------------------
3eanF           ----------------------------------------------------------------------
2c73B           ----------------------------------------------------------------------
3cpjG           ----------------------------------------------------------------------
2culA           ----------------------------------------------------------------------
2apgA           ----------------------------------------------------------------------
1ebdA           ----------------------------------------------------------------------
1bhyA           ----------------------------------------------------------------------
1d5tA           ----------------------------------------------------------------------
2dkhA           EIGQRICAKYDDVVDAVATPDSPLPRVFIAGDACHTHSPKAGQGMNFSMQDSFNLGWKLAAVLRKQCAPE
3d4oA           ----------------------------------------------------------------------
3eanD           ----------------------------------------------------------------------
3cgvA           ----------------------------------------------------------------------
3eanA           ----------------------------------------------------------------------
2a8xA           ----------------------------------------------------------------------
3cnsA           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3d4oC           ----------------------------------------------------------------------
3cgcA           ----------------------------------------------------------------------
3coxA           ----------------------------------------------------------------------
2cfyA           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------
3cpiG           ----------------------------------------------------------------------
3cpiH           ----------------------------------------------------------------------
1cc6A           ----------------------------------------------------------------------
1cc4A           ----------------------------------------------------------------------
1bf3A           ----------------------------------------------------------------------
1d7yA           ----------------------------------------------------------------------
1aogB           ----------------------------------------------------------------------
2du8A           ----------------------------------------------------------------------
2ardA           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3c96A           ----------------------------------------------------------------------
2dw4A           ----------------------------------------------------------------------
3djdB           ----------------------------------------------------------------------
1e6eA           WGLRFFRSPQQVLPSPDGRRAAGIRLAVTRLEG-IGEATRAVPTGDVEDLPCGLVLSSIGYKSRPIDPSV
2ejrA           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
1bzlA           ----------------------------------------------------------------------
3cnsB           ----------------------------------------------------------------------
3b3rA           ----------------------------------------------------------------------
2bxrA           ----------------------------------------------------------------------
2bxsA           ----------------------------------------------------------------------
1coyA           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
3cp8D           ----------------------------------------------------------------------
3djeB           ----------------------------------------------------------------------
2bi7A           ----------------------------------------------------------------------
3cnjA           ----------------------------------------------------------------------
3d8xA           ----------------------------------------------------------------------
3blyA           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
3bg7A           ----------------------------------------------------------------------
1cj3A           ----------------------------------------------------------------------
2e1mA           ----------------------------------------------------------------------
3cnpA           ----------------------------------------------------------------------
1cj2A           ----------------------------------------------------------------------
3dghB           ----------------------------------------------------------------------
2e5vA           ----------------------------------------------------------------------
3dl2B           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
3cirA           ----------------------------------------------------------------------
3cphG           ----------------------------------------------------------------------
3cphH           ----------------------------------------------------------------------
2dkiA           ----------------------------------------------------------------------
3dghA           ----------------------------------------------------------------------
2dwcB           ----------------------------------------------------------------------
1dy2A           ----------------------------------------------------------------------
3djdA           ----------------------------------------------------------------------
1dobA           ----------------------------------------------------------------------
3cgbA           ----------------------------------------------------------------------
1aogA           ----------------------------------------------------------------------
3e1tA           ----------------------------------------------------------------------
1b8sA           ----------------------------------------------------------------------
3dh9A           ----------------------------------------------------------------------
2amfE           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
1b73A           ----------------------------------------------------------------------
3cesD           ----------------------------------------------------------------------
2czgA           ----------------------------------------------------------------------
1cc2A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LIDGCDGLNLSEHWERGMQAYQSVAVAGFPNLLSINGPNTSLGHNSIVYIIESQIEYILGAMDYMSAIGA
1dxlA           ----------------------------------------------------------------------
2bk4B           ----------------------------------------------------------------------
2bc0A           ----------------------------------------------------------------------
2c76B           ----------------------------------------------------------------------
2a87A           ----------------------------------------------------------------------
2a87B           ----------------------------------------------------------------------
2c75B           ----------------------------------------------------------------------
2c72A           ----------------------------------------------------------------------
1cl0A           ----------------------------------------------------------------------
1e6eC           PFDPKLGPNMEGRVVDVPGLYCSGWVKRGPTGVITTTMTDSTGQILLQDLKAGHL---------------
2b9wA           ----------------------------------------------------------------------
3eanC           ----------------------------------------------------------------------
2bk4A           ----------------------------------------------------------------------
1b37B           ----------------------------------------------------------------------
2b76M           ----------------------------------------------------------------------
2c73A           ----------------------------------------------------------------------
1b37A           ----------------------------------------------------------------------
1dncA           ----------------------------------------------------------------------
3d1cA           ----------------------------------------------------------------------
2c76A           ----------------------------------------------------------------------
1cjcA           PFDPKLGPNMEGRVVDVPGLYCSGWVKRGPTGVITTTMTD--SFLTGQILLQDLKAGHLPSGPRPGSAFI
1eehA           ----------------------------------------------------------------------
3dk9A           ----------------------------------------------------------------------
2b76A           ----------------------------------------------------------------------
3c4nA           ----------------------------------------------------------------------
2bc1A           ----------------------------------------------------------------------
2cduB           ----------------------------------------------------------------------
2c75A           ----------------------------------------------------------------------
3cukA           ----------------------------------------------------------------------
3c4aA           ----------------------------------------------------------------------
1e0dA           ----------------------------------------------------------------------
3ctyB           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
2e4gB           ----------------------------------------------------------------------
3cp8A           ----------------------------------------------------------------------
3ctyA           ----------------------------------------------------------------------
3bg6A           ----------------------------------------------------------------------
2cyjA           ----------------------------------------------------------------------
2c72B           ----------------------------------------------------------------------
1an9A           ----------------------------------------------------------------------
2cduA           ----------------------------------------------------------------------
3eanF           ----------------------------------------------------------------------
2c73B           ----------------------------------------------------------------------
3cpjG           ----------------------------------------------------------------------
2culA           ----------------------------------------------------------------------
2apgA           ----------------------------------------------------------------------
1ebdA           ----------------------------------------------------------------------
1bhyA           ----------------------------------------------------------------------
1d5tA           ----------------------------------------------------------------------
2dkhA           LLHTYSSERQVVAQ--------------------------------------------------------
3d4oA           ----------------------------------------------------------------------
3eanD           ----------------------------------------------------------------------
3cgvA           ----------------------------------------------------------------------
3eanA           ----------------------------------------------------------------------
2a8xA           ----------------------------------------------------------------------
3cnsA           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3d4oC           ----------------------------------------------------------------------
3cgcA           ----------------------------------------------------------------------
3coxA           ----------------------------------------------------------------------
2cfyA           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------
3cpiG           ----------------------------------------------------------------------
3cpiH           ----------------------------------------------------------------------
1cc6A           ----------------------------------------------------------------------
1cc4A           ----------------------------------------------------------------------
1bf3A           ----------------------------------------------------------------------
1d7yA           ----------------------------------------------------------------------
1aogB           ----------------------------------------------------------------------
2du8A           ----------------------------------------------------------------------
2ardA           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3c96A           ----------------------------------------------------------------------
2dw4A           ----------------------------------------------------------------------
3djdB           ----------------------------------------------------------------------
1e6eA           PFDPKLGVVPNMEGRVVPGLYCSGWVKRGPTGVITTTMTD--SFLTGQILLQDLKAGHLPSGPRPGSAFI
2ejrA           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
1bzlA           ----------------------------------------------------------------------
3cnsB           ----------------------------------------------------------------------
3b3rA           ----------------------------------------------------------------------
2bxrA           ----------------------------------------------------------------------
2bxsA           ----------------------------------------------------------------------
1coyA           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
3cp8D           ----------------------------------------------------------------------
3djeB           ----------------------------------------------------------------------
2bi7A           ----------------------------------------------------------------------
3cnjA           ----------------------------------------------------------------------
3d8xA           ----------------------------------------------------------------------
3blyA           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
3bg7A           ----------------------------------------------------------------------
1cj3A           ----------------------------------------------------------------------
2e1mA           ----------------------------------------------------------------------
3cnpA           ----------------------------------------------------------------------
1cj2A           ----------------------------------------------------------------------
3dghB           ----------------------------------------------------------------------
2e5vA           ----------------------------------------------------------------------
3dl2B           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
3cirA           ----------------------------------------------------------------------
3cphG           ----------------------------------------------------------------------
3cphH           ----------------------------------------------------------------------
2dkiA           ----------------------------------------------------------------------
3dghA           ----------------------------------------------------------------------
2dwcB           ----------------------------------------------------------------------
1dy2A           ----------------------------------------------------------------------
3djdA           ----------------------------------------------------------------------
1dobA           ----------------------------------------------------------------------
3cgbA           ----------------------------------------------------------------------
1aogA           ----------------------------------------------------------------------
3e1tA           ----------------------------------------------------------------------
1b8sA           ----------------------------------------------------------------------
3dh9A           ----------------------------------------------------------------------
2amfE           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
1b73A           ----------------------------------------------------------------------
3cesD           ----------------------------------------------------------------------
2czgA           ----------------------------------------------------------------------
1cc2A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           SIIEPTAEAEEAYVEHIQRNAVGTVWLDGGCNSWYVDQRTGRLxxxxxxxxxxxxxxxxxxxxxxxxxxx
1dxlA           ----------------------------------------------------------------------
2bk4B           ----------------------------------------------------------------------
2bc0A           ----------------------------------------------------------------------
2c76B           ----------------------------------------------------------------------
2a87A           ----------------------------------------------------------------------
2a87B           ----------------------------------------------------------------------
2c75B           ----------------------------------------------------------------------
2c72A           ----------------------------------------------------------------------
1cl0A           ----------------------------------------------------------------------
1e6eC           ----------------------------------------------------------------------
2b9wA           ----------------------------------------------------------------------
3eanC           ----------------------------------------------------------------------
2bk4A           ----------------------------------------------------------------------
1b37B           ----------------------------------------------------------------------
2b76M           ----------------------------------------------------------------------
2c73A           ----------------------------------------------------------------------
1b37A           ----------------------------------------------------------------------
1dncA           ----------------------------------------------------------------------
3d1cA           ----------------------------------------------------------------------
2c76A           ----------------------------------------------------------------------
1cjcA           KALLDSRGVWPVSFSDWEKLDAEEVSRSGKPRELLDPQEMLRL---------------------------
1eehA           ----------------------------------------------------------------------
3dk9A           ----------------------------------------------------------------------
2b76A           ----------------------------------------------------------------------
3c4nA           ----------------------------------------------------------------------
2bc1A           ----------------------------------------------------------------------
2cduB           ----------------------------------------------------------------------
2c75A           ----------------------------------------------------------------------
3cukA           ----------------------------------------------------------------------
3c4aA           ----------------------------------------------------------------------
1e0dA           ----------------------------------------------------------------------
3ctyB           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
2e4gB           ----------------------------------------------------------------------
3cp8A           ----------------------------------------------------------------------
3ctyA           ----------------------------------------------------------------------
3bg6A           ----------------------------------------------------------------------
2cyjA           ----------------------------------------------------------------------
2c72B           ----------------------------------------------------------------------
1an9A           ----------------------------------------------------------------------
2cduA           ----------------------------------------------------------------------
3eanF           ----------------------------------------------------------------------
2c73B           ----------------------------------------------------------------------
3cpjG           ----------------------------------------------------------------------
2culA           ----------------------------------------------------------------------
2apgA           ----------------------------------------------------------------------
1ebdA           ----------------------------------------------------------------------
1bhyA           ----------------------------------------------------------------------
1d5tA           ----------------------------------------------------------------------
2dkhA           ----------------------------------------------------------------------
3d4oA           ----------------------------------------------------------------------
3eanD           ----------------------------------------------------------------------
3cgvA           ----------------------------------------------------------------------
3eanA           ----------------------------------------------------------------------
2a8xA           ----------------------------------------------------------------------
3cnsA           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3d4oC           ----------------------------------------------------------------------
3cgcA           ----------------------------------------------------------------------
3coxA           ----------------------------------------------------------------------
2cfyA           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------
3cpiG           ----------------------------------------------------------------------
3cpiH           ----------------------------------------------------------------------
1cc6A           ----------------------------------------------------------------------
1cc4A           ----------------------------------------------------------------------
1bf3A           ----------------------------------------------------------------------
1d7yA           ----------------------------------------------------------------------
1aogB           ----------------------------------------------------------------------
2du8A           ----------------------------------------------------------------------
2ardA           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3c96A           ----------------------------------------------------------------------
2dw4A           ----------------------------------------------------------------------
3djdB           ----------------------------------------------------------------------
1e6eA           KALLDSRGVWPVSFSDWEKLEVSRGQASGKPREKLDPQEMLRL---------------------------
2ejrA           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
1bzlA           ----------------------------------------------------------------------
3cnsB           ----------------------------------------------------------------------
3b3rA           ----------------------------------------------------------------------
2bxrA           ----------------------------------------------------------------------
2bxsA           ----------------------------------------------------------------------
1coyA           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
3cp8D           ----------------------------------------------------------------------
3djeB           ----------------------------------------------------------------------
2bi7A           ----------------------------------------------------------------------
3cnjA           ----------------------------------------------------------------------
3d8xA           ----------------------------------------------------------------------
3blyA           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
3bg7A           ----------------------------------------------------------------------
1cj3A           ----------------------------------------------------------------------
2e1mA           ----------------------------------------------------------------------
3cnpA           ----------------------------------------------------------------------
1cj2A           ----------------------------------------------------------------------
3dghB           ----------------------------------------------------------------------
2e5vA           ----------------------------------------------------------------------
3dl2B           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
3cirA           ----------------------------------------------------------------------
3cphG           ----------------------------------------------------------------------
3cphH           ----------------------------------------------------------------------
2dkiA           ----------------------------------------------------------------------
3dghA           ----------------------------------------------------------------------
2dwcB           ----------------------------------------------------------------------
1dy2A           ----------------------------------------------------------------------
3djdA           ----------------------------------------------------------------------
1dobA           ----------------------------------------------------------------------
3cgbA           ----------------------------------------------------------------------
1aogA           ----------------------------------------------------------------------
3e1tA           ----------------------------------------------------------------------
1b8sA           ----------------------------------------------------------------------
3dh9A           ----------------------------------------------------------------------
2amfE           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
1b73A           ----------------------------------------------------------------------
3cesD           ----------------------------------------------------------------------
2czgA           ----------------------------------------------------------------------
1cc2A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxx
1dxlA           ---------
2bk4B           ---------
2bc0A           ---------
2c76B           ---------
2a87A           ---------
2a87B           ---------
2c75B           ---------
2c72A           ---------
1cl0A           ---------
1e6eC           ---------
2b9wA           ---------
3eanC           ---------
2bk4A           ---------
1b37B           ---------
2b76M           ---------
2c73A           ---------
1b37A           ---------
1dncA           ---------
3d1cA           ---------
2c76A           ---------
1cjcA           ---------
1eehA           ---------
3dk9A           ---------
2b76A           ---------
3c4nA           ---------
2bc1A           ---------
2cduB           ---------
2c75A           ---------
3cukA           ---------
3c4aA           ---------
1e0dA           ---------
3ctyB           ---------
2e4gA           ---------
2e4gB           ---------
3cp8A           ---------
3ctyA           ---------
3bg6A           ---------
2cyjA           ---------
2c72B           ---------
1an9A           ---------
2cduA           ---------
3eanF           ---------
2c73B           ---------
3cpjG           ---------
2culA           ---------
2apgA           ---------
1ebdA           ---------
1bhyA           ---------
1d5tA           ---------
2dkhA           ---------
3d4oA           ---------
3eanD           ---------
3cgvA           ---------
3eanA           ---------
2a8xA           ---------
3cnsA           ---------
3bi4B           ---------
3d4oC           ---------
3cgcA           ---------
3coxA           ---------
2cfyA           ---------
3bi2A           ---------
3cpiG           ---------
3cpiH           ---------
1cc6A           ---------
1cc4A           ---------
1bf3A           ---------
1d7yA           ---------
1aogB           ---------
2du8A           ---------
2ardA           ---------
3bi4A           ---------
3c96A           ---------
2dw4A           ---------
3djdB           ---------
1e6eA           ---------
2ejrA           ---------
3cntB           ---------
1bzlA           ---------
3cnsB           ---------
3b3rA           ---------
2bxrA           ---------
2bxsA           ---------
1coyA           ---------
1d7lA           ---------
3cp8D           ---------
3djeB           ---------
2bi7A           ---------
3cnjA           ---------
3d8xA           ---------
3blyA           ---------
3bi2B           ---------
3bg7A           ---------
1cj3A           ---------
2e1mA           ---------
3cnpA           ---------
1cj2A           ---------
3dghB           ---------
2e5vA           ---------
3dl2B           ---------
2dpoA           ---------
3cirA           ---------
3cphG           ---------
3cphH           ---------
2dkiA           ---------
3dghA           ---------
2dwcB           ---------
1dy2A           ---------
3djdA           ---------
1dobA           ---------
3cgbA           ---------
1aogA           ---------
3e1tA           ---------
1b8sA           ---------
3dh9A           ---------
2amfE           ---------
2aefB           ---------
1b73A           ---------
3cesD           ---------
2czgA           ---------
1cc2A           ---------