[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF55378.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1axeA.bssp"
#ERROR : Can't open dsspfile "1a71A.bssp"
#ERROR : Can't open dsspfile "1axgA.bssp"
#ERROR : Can't open dsspfile "1d1sA.bssp"
#ERROR : Can't open dsspfile "1ee2A.bssp"
#ERROR : Can't open dsspfile "1d1tA.bssp"
#ERROR : Can't open dsspfile "1e3eA.bssp"
#ERROR : Can't open dsspfile "1cdoA.bssp"
#ERROR : Can't open dsspfile "3cosA.bssp"
#ERROR : Can't open dsspfile "1e3eB.bssp"
#ERROR : Can't open dsspfile "1e3lB.bssp"
#ERROR : Can't open dsspfile "3cosD.bssp"
#ERROR : Can't open dsspfile "1e3lA.bssp"
#ERROR : Can't open dsspfile "2dfvA.bssp"
#ERROR : Can't open dsspfile "2b83A.bssp"
#ERROR : Can't open dsspfile "2dphA.bssp"
#ERROR : Can't open dsspfile "2dq4A.bssp"
#ERROR : Can't open dsspfile "2d8aA.bssp"
#ERROR : Can't open dsspfile "1bxzA.bssp"
#ERROR : Can't open dsspfile "2cf5A.bssp"
#ERROR : Can't open dsspfile "1e3jA.bssp"
#ERROR : Can't open dsspfile "2eerB.bssp"
#ERROR : Can't open dsspfile "2b5wA.bssp"
#ERROR : Can't open dsspfile "3b70A.bssp"
#ERROR : Can't open dsspfile "2eerA.bssp"
#ERROR : Can't open dsspfile "2b5vA.bssp"
#ERROR : Can't open dsspfile "3b6zA.bssp"
#ERROR : Can't open dsspfile "2eihA.bssp"
#ERROR : Can't open dsspfile "2cdaA.bssp"
#ERROR : Can't open dsspfile "2cdbC.bssp"
#ERROR : Can't open dsspfile "2dm6A.bssp"
#ERROR : Can't open dsspfile "2cd9A.bssp"
#ERROR : Can't open dsspfile "2cdaB.bssp"
#ERROR : Can't open dsspfile "2cd9B.bssp"
#ERROR : Can't open dsspfile "2cdbA.bssp"
#ERROR : Can't open dsspfile "2cdbB.bssp"
#ERROR : Can't open dsspfile "2c0cA.bssp"
#ERROR : Can't open dsspfile "2c0cB.bssp"
#ERROR : Can't open dsspfile "2dg2A.bssp"
#ERROR : Can't open dsspfile "1ch6A.bssp"
#ERROR : Can't open dsspfile "2ebjA.bssp"
#ERROR : Can't open dsspfile "2a33B.bssp"
#ERROR : Can't open dsspfile "1dl5B.bssp"
#ERROR : Can't open dsspfile "1dlgA.bssp"
#ERROR : Can't open dsspfile "3c85C.bssp"
#ERROR : Can't open dsspfile "2bhtD.bssp"
#ERROR : Can't open dsspfile "3c3pB.bssp"
#ERROR : Can't open dsspfile "3eeqB.bssp"
#ERROR : Can't open dsspfile "3c85B.bssp"
#ERROR : Can't open dsspfile "2bhtB.bssp"
#ERROR : Can't open dsspfile "2eguA.bssp"
#ERROR : Can't open dsspfile "2cqwA.bssp"
#ERROR : Can't open dsspfile "3e8wA.bssp"
#ERROR : Can't open dsspfile "3ci9B.bssp"
#ERROR : Can't open dsspfile "3ci9A.bssp"
#ERROR : Can't open dsspfile "2bryA.bssp"
#ERROR : Can't open dsspfile "3dwgB.bssp"

## Summary of PDB Search
:366
    1e-49  27%  1axeA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    7e-48  27%  1a71A  [b.35.1 - c.2.1] LIVER ALCOHOL DEHYDROGENASE
    7e-46  27%  1axgA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    3e-45  25%  1d1sA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE CLASS IV SIGMA CHAIN
    6e-45  27%  1ee2A  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    1e-44  24%  1d1tA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE CLASS IV SIGMA CHAIN
    9e-43  28%  1e3eA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    3e-42  25%  1cdoA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    1e-41  28%  3cosA  [x.x.x] ALCOHOL DEHYDROGENASE 4
    2e-41  27%  1e3eB  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    3e-40  27%  1e3lB  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    6e-39  28%  3cosD  [x.x.x] ALCOHOL DEHYDROGENASE 4
    1e-38  27%  1e3lA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    6e-37  19%  2dfvA  [x.x.x] PROBABLE L-THREONINE 3-DEHYDROGENASE
    3e-36  15%  2b83A  [x.x.x] NADP-DEPENDENT ALCOHOL DEHYDROGENASE
    4e-36  14%  2dphA  [x.x.x] FORMALDEHYDE DISMUTASE
    8e-36  19%  2dq4A  [x.x.x] L-THREONINE 3-DEHYDROGENASE
    2e-34  19%  2d8aA  [x.x.x] PROBABLE L-THREONINE 3-DEHYDROGENASE
    4e-34  16%  1bxzA  [b.35.1 - c.2.1] NADP-DEPENDENT ALCOHOL DEHYDROGENASE
    4e-34  16%  2cf5A  [x.x.x] CINNAMYL ALCOHOL DEHYDROGENASE
    8e-34  18%  1e3jA  [b.35.1 - c.2.1] NADP(H)-DEPENDENT KETOSE REDUCTASE
    1e-33  19%  2eerB  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    2e-31  17%  2b5wA  [x.x.x] GLUCOSE DEHYDROGENASE
    8e-31  13%  3b70A  [x.x.x] ENOYL REDUCTASE
    1e-30  19%  2eerA  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    5e-30  16%  2b5vA  [x.x.x] GLUCOSE DEHYDROGENASE
    1e-29  13%  3b6zA  [x.x.x] ENOYL REDUCTASE
    1e-28  22%  2eihA  [x.x.x] ALCOHOL DEHYDROGENASE
    6e-28  13%  2cdaA  [x.x.x] GLUCOSE DEHYDROGENASE
    1e-27  14%  2cdbC  [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,
    7e-27  13%  2dm6A  [x.x.x] NADP-DEPENDENT LEUKOTRIENE B4 12-
    2e-26  14%  2cd9A  [x.x.x] GLUCOSE DEHYDROGENASE
    2e-26  13%  2cdaB  [x.x.x] GLUCOSE DEHYDROGENASE
    1e-25  14%  2cd9B  [x.x.x] GLUCOSE DEHYDROGENASE
    2e-25  13%  2cdbA  [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,
    3e-25  13%  2cdbB  [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,
    2e-24  19%  2c0cA  [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN
    6e-23  18%  2c0cB  [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN
    7e-20   8%  2dg2A  [x.x.x] APOLIPOPROTEIN A-I BINDING PROTEIN
    5e-14   6%  1ch6A  [x.x.x] GLUTAMATE DEHYDROGENASE
    1e-12   7%  2ebjA  [x.x.x] PYRROLIDONE CARBOXYL PEPTIDASE
    2e-10  10%  2a33B  [x.x.x] HYPOTHETICAL PROTEIN
    2e-08  10%  1dl5B  [c.66.1 - d.197.1] PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE
    2e-08   7%  1dlgA  [d.68.2] UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL TRANSFERASE
    1e-07  10%  3c85C  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    2e-07   9%  2bhtD  [x.x.x] CYSTEINE SYNTHASE B
    3e-07  11%  3c3pB  [x.x.x] METHYLTRANSFERASE
    3e-07   8%  3eeqB  [x.x.x] PUTATIVE COBALAMIN BIOSYNTHESIS PROTEIN G
    2e-06   9%  3c85B  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    6e-06  11%  2bhtB  [x.x.x] CYSTEINE SYNTHASE B
    6e-06  10%  2eguA  [x.x.x] CYSTEINE SYNTHASE
    1e-05   9%  2cqwA  [x.x.x] SUSHI DOMAIN CONTAINING 2
    1e-05   6%  3e8wA  [x.x.x] TAKEOUT-LIKE PROTEIN 1
    2e-05  10%  3ci9B  [x.x.x] HEAT SHOCK FACTOR-BINDING PROTEIN 1
    5e-05  12%  3ci9A  [x.x.x] HEAT SHOCK FACTOR-BINDING PROTEIN 1
    1e-04  10%  2bryA  [x.x.x] NEDD9 INTERACTING PROTEIN WITH CALPONIN HOMOLOGY
    0.001  11%  3dwgB  [x.x.x] CYSTEINE SYNTHASE B
:366

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQTLAAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPXXXXXXXXXXXXXX
1axeA           IKCKAAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTPLPVIAGHEAAGIVESI
1a71A           IKCKAAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTPLPVIAGHEAAGIVESI
1axgA           IKCKAAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTPLPVIAGHEAAGIVESI
1d1sA           IKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICRTDDHVIKGTMVSKFPVIVGHEATGIVESI
1ee2A           IKCKAAVLWEQKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDDHVVSGTLVAPLPVIAGHEAAGIVESI
1d1tA           IKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICRTDDHVIKGTMVSKFPVIVGHEATGIVESI
1e3eA           IKCKAAIAWKTGSPLCIEEIEVSPPKACEVRIQVIATCVCPTDINATDPKKKALFPVVLGHECAGIVESV
1cdoA           IKCKAAVAWEANKPLVIEEIEVDVPHANEIRIKIIATGVCHTDLYHLFEGKHKDFPVVLGHEGAGIVESV
3cosA           IKCKAAIAWEAGKPLCIEEVEVAPPKAHEVRIQIIATSLCHTDATVIDSKFEGLAFIVGHEAAGIVESIG
1e3eB           IKCKAAIAWKTGSPLCIEEIEVSPPKACEVRIQVIATCVCPTDINATDPKKKALFPVVLGHECAGIVESV
1e3lB           IKCKAAIAWKTGSPLCIEEIEVSPPKACEVRIQVIATCVCHTDINATDPKKKALFPVVLGHECAGIVESV
3cosD           IKCKAAIAWEAGKPLCIEEVEVAPPKAHEVRIQIIATSLCHTDATVIKFEGLAFPVIVGHEAAGIVESIG
1e3lA           IKCKAAIAWKTGSPLCIEEIEVSPPKACEVRIQVIATCVCHTDINATDPKKKALFPVVLGHECAGIVESV
2dfvA           ----VAIKTKPGYGAELVEVDVPKPGPGEVLIKVLATSICGTDLHIYEWNEWAQKPPQIGHEVAGEVVEI
2b83A           -----GFAMLGINKLGWIEKERPVAGSYDAIVRPLAVSPCTSDITVFEGALGDRKNMILGHEAVGEVVEV
2dphA           ----SVVYHGTRDLPYPKLEHNNRKLEHAVILKVVSTNICGSDQHIYRGRFIVPKGHVLGHEITGEVVEK
2dq4A           ----ALAKLAPEEGLTLVDRPVPEPGPGEILVRVEAASICGTDLHIWKWDARIRPPLVTGHEFSGVVEAV
2d8aA           ----VAIKTKPGYGAELVEVDVPKPGPGEVLIKVLATSICGTDLHIYEWNEWAQKPPQIGHEVAGEVVEI
1bxzA           ----GFAMLSIGKV-GWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHILGHEAVGEVVEVG
2cf5A           ERKTGWAARDPSGILSPYTYTLRETGPEDVNIRIICCGICHTDLHQTKNDLGMSYPMVPGHEVVGEVVEV
1e3jA           --NLSAVLYK-QNDLRLEQRPIPEPKEDEVLLQMAYVGICGSDVHYYEHDFIVKDPMVIGHEASGTVVKV
2eerB           ----AMRLVEIGKPLKLEDIPIPKPKGSQVLIKIEAAGVCHSDVHMRQGRFGNLLPVTLGHEIAGRIEEV
2b5wA           ----AIAVKRGEDRPVVIEKPRPEPESGEALVRTLRVGVCGTDHEVIAHGGFPEGEDHLVLGHEAVGVVV
3b70A           ----ALTVNDHDEVTVWNAAPCPMLPRDQVYVRVEAVAINPSDTKMRGQFATPWAFLGTDYAGTVVAVGS
2eerA           ----AMRLVEIGKPLKLEDIPIPKPKGSQVLIKIEAAGVCHSDVHMRQGRFGNLLPVTLGHEIAGRIEEV
2b5vA           -----AIAVKRGRP-VVIEKPRPEPESGEALVRTLRVGVDGTDHEVIAGGHGGFDHLVLGHEAVGVVVDP
3b6zA           ----ALTVNDHDEVTVWNAAPCPMLPRDQVYVRVEAVAINPSDTKMRG--QFATPWAFLGTDYAGTVVAV
2eihA           ----AVVMRARGGPLEVADLPVPEPGPKEVRVRLKAAALNHLDVWVRKGVASPKLPHVLGADGSGVVDAV
2cdaA           ----AIIVKPPNAGVQVKDVDEKKDSYGKIKIRTIYNGICGTDREIVNGKLKGKDFLVLGHEAIGVVEES
2cdbC           ----AIIVKPPNAGVQVKDVDEKKDSYGKIKIRTIYNGICGADREIVNGKLKDFLV--LGHEAIGVVEES
2dm6A           MVKAKSWTKPTQSDFELKTVELPPLKNGEVLLEALFLSVDPYMRIASKRLKEGAVM--------------
2cd9A           ----AIIVKPPNAGVQVKDVDEKKDSYGKIKIRTIYNGICGTDREIVNGKLTLSKGKDFLVLGHEAIGVV
2cdaB           ----AIIVKPPNAGVQVKDVDEKLDSYGKIKIRTIYNGICGTDREIVNGKLGKD-FLVLGHEAIGVVEES
2cd9B           ----AIIVKPPNAGVQVKDVDEKKDSYGKIKIRTIYNGICGTDREIVNGKLTLGDFLVLGHEAIGVVEES
2cdbA           ----AIIVKPPNAGVQVKDVDEKKDSYGKIKIRTIYNGICGADREIVNGKLKGKDFLVLGHEAIGVVEES
2cdbB           ----AIIVKPPNAGVQVKDVDEKLDSYGKIKIRTIYNGICGADREIVNGKLGKD-FLVLGHEAIGVVEES
2c0cA           ----------REAVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDP-----------------
2c0cB           ----KLVVTRLSPNTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDP-----------------
2dg2A           ----------------------------------------------------------------------
1ch6A           RNRVRGILRIIKPCNHVLSLSFPIRRDDGSWEVIEGYRAQHSHQRSVDEVKALASLMTYKCAVVDVPFGG
2ebjA           ----------------------------------------------------------------------
2a33B           ----------------------------------------------------------------------
1dl5B           ----------------------------------------------------------------------
1dlgA           ----------IDTTMKLLTQLGTKVERGSVWIDASNVNNFSAPYDLVKTMRASIWA--------------
3c85C           ----------------------------------------------------------------------
2bhtD           ----------------------------------------------------------------------
3c3pB           ----------------------------------------------------------------------
3eeqB           ----------------------------------------------------------------------
3c85B           ----------------------------------------------------------------------
2bhtB           ----------------------------------------------------------------------
2eguA           ----------------------------------------------------------------------
2cqwA           ----------------------------------------------------------------------
3e8wA           ----------------------------------------------------------------------
3ci9B           ----------------------------------------------------------------------
3ci9A           ----------------------------------------------------------------------
2bryA           ----------------------------------------------------------------------
3dwgB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXKPDDKVVLGFNSCGQCLKCLGGKPAYCEKFYDRNFACTRDDGSTAFSEDGEQVGSHFFGQSTF
1axeA           GEGVTTVRPGDKVIPLWTQCGKCRVCKHPEGNFCLKNDLSMPRGTMQDGTSRFTCRGKPIH-HFLGTSTF
1a71A           GEGVTTVRPGDKVIPLWTQCGKCRVCKHPEGNFCLKNDLSMPRGTMQDGTSRFTCRG-KPIHHFLGTSTF
1axgA           GEGVTTVRPGDKVPLFTPQCGKCRVCKHPEGNFCLKNDLSMPRGTMQDGTSRFTCRG-KPIHHFLGTSTF
1d1sA           GEGVTTVKPDKVIPLFLPQCRECNACRNPDGNLCI-RSDITGRGVLADGTTRFTCKGKPVH-HFMNTSTF
1ee2A           GEGVTTVRPGDKVIPLFIQCGKCSVCKHPEGNLCL-KNLSMPRGTMQDGTSRFTCRGKPIH-HFLGTSTF
1d1tA           GEGVTTVKPGDKVPLFLPQCRECNACRNPDGNLCIRSDITGRGVLADGTTRFTCKGKPVHHFLNTS--TF
1e3eA           GPGVTNFKPGDKVIPFFAQCKRCKLCLSPLTNLCGFKYPTIDQELMEDRTSRFTCKGRSI-YHFMGVSSF
1cdoA           GPGVTEFQPGEKVIPLFIQCGECRFCQSPKTNQCVKGWANESPDVMSPKETRFTCKG-RKVLQFLGTSTF
3cosA           PGVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKISNLKSPALMEDKTSRFTCKGKPV-YHFFGTSTF
1e3eB           GPGVTNFKGDKVIPFFAPQCKRCKLCLSPLTNLCGKLRNFKYPTLMEDRTSRFTCKGRSI-YHFMGVSSF
1e3lB           GPGVTNFKPGDKIPFFAPQCKRCKLCLSPLTNLCGFKYPTIDQELMEDRTSRFTCKGRSI-YHFMGVSSF
3cosD           PGVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKISPASDQQLMEDKTSRFTCKGKPV-YHFFGTSTF
1e3lA           GPGVTNFKPDKVIPFFAPQCKRCKLCLSPLTNLCGKLYPTIDQELMEDRTSRFTCKGRSI-YHFMGVSSF
2dfvA           GPGVEGIEVGDYVSVETHVCGKCYACRRGQYHVCQNTKIF----------------------GVDTDGVF
2b83A           GSEVKDFKPGDRIVPCTTPDWRSLEVQAGFPQHSNGMLAGW-------------------KFSNFKDGVF
2dphA           GSDVELMDIGDLVSVPFNACGRCRNCKEARSDVCENNLVNPDADLGAFGFDLKGWSG-----------GQ
2dq4A           GPGVRRPQVDHVSLESHIVCHACPACRTGNYHVCLNTQI----------------------LGVDRDGGF
2d8aA           GPGVEGIEVGDYVSVETHVCGKC----------------------------------YTKIFGVDTDGVF
1bxzA           SEVKDFKPGDRVVVPAITPDWRTSEVQRGYHQHSGGMLAGWKF-----------------SNVKDGVFGE
2cf5A           GSDVSKFTVGDIVGVGVGCCGGCSPCERDLEQYCPKKIWSYNDVYIN---------------GQPTQGGF
1e3jA           GKNVKHLKKGDRVAVEPGPCRRCQFCKEGKYNLCPDL---------------------TFCATPPDDGNL
2eerB           GDEVVGYSKGDLVAVNPWGEGNCYYCRIGEEHLCDSPR----------------------WLGINYDGAY
2b5wA           DPNDTELEEGDIVVPRPPASGTNEYFERDQPDMAPDGMYFERGIVGAHG-------------------YM
3b70A           DVTHIQ-VGDRVYGAQNEMCPRTPDQGAFSQYTVTR---------------------GRVWAKIPKGLSF
2eerA           GDEVVGYSKGDLVAVNPWGEGNCYYCRIGEEHLCDSPR----------------------WLGINYDGAY
2b5vA           NDTELEEGDIVVPTVRRPASGTNEYFERDQPDMAPDGMYFERG-------------------IVGAHGYM
3b6zA           GSDVTHIQVGDRVYGAQNMCPRTPDQGAFSQYTV---TRGRVWAKIPKGLSF------------------
2eihA           GPGVEGFAPGDEVVINPGLCGRCERCLAGEDNLCP--RYQIL--------------------GEHRHGTY
2cdaA           YHGFSQGDLVMPVNRRG--CGICRNCLVGRPDFCETGEFGEAGIHKMDGFMREWWYDDPK-YLVKIPKSI
2cdbC           YHGFSQGDLVMPV--NRRGCGICRNCLVGRPDFCETGEFGEAGIHKMDGFMREWWYDDPK-YLVKIPKSI
2dm6A           --------MGQQVARVVESKNSAFPA--GSIVLAQ---------------------------SGWTTHFI
2cd9A           EESYHGFSQGDLVMPVNRGCGICRNCLVGRPDFCETGEFGEAGIHKMDGFMREWWYDDP-KYLVKIPKSI
2cdaB           YHGFSQGDLVMPVNRRG--CGICRNCLVGRPDFCETGEFGEAGIHKMDGFMREWWYDDPK-YLVKIPKSI
2cd9B           YHGFSQGDLVMPVN--RRGCGICRNCLVGRPDFCETGEFGE-------------------AGIHKMDGFM
2cdbA           YHGFSQGDLVMPVN--RRGCGICRNCLVGRPDFCETGEFGEAGIHKMDG-------------------FM
2cdbB           YHGFSQGDLVMPVNRRG--CGICRNCLVGRPDFCETGEFGEAGIHKMDGFMREWWYDDPK-YLVKIPKSI
2c0cA           -------SVKPPFDIGFEGIGEVVAL--------------------GLSASARYTVGQAV--AYMAPGSF
2c0cB           -------SVKPPFDIGFEGIGEVVAL--------------------GLSASARYTVGQ--AVAYMAPGSF
2dg2A           -----------------------------------------------------------------KYLSQ
1ch6A           AKAGVKINPKNYTDEDLEITRRFTMELAKKGFIGPGVPNMSTGEREMSWIADTYASTIGHY-DINAHACV
2ebjA           -------------------------------------------------------------TGFEPFGSL
2a33B           ----------------------------------------------------------------------
1dl5B           --------------------------------------------------------SDHIAKAFLEREEF
1dlgA           ----------------------------------------------------------------------
3c85C           ----------------------------------------------------------------------
2bhtD           -------------------------------------------------------------EQTIGNTPL
3c3pB           --------------------------------------------------------------------RI
3eeqB           ----------------------------------------------------------------------
3c85B           ----------------------------------------------------------------------
2bhtB           -------------------------------------------------------------EQTIGNTPL
2eguA           ------------------------------------------------------RTVNSI-TELIGDTPA
2cqwA           -------RCGAQDGLCSPTCSGLGTCCEDFLDYCLEILP-----------------------SSGSMMGG
3e8wA           ----------------------------------------------------------------------
3ci9B           ----------------------------------------------------------------------
3ci9A           ----------------------------------------------------------------------
2bryA           ----------AHDHFETFQAQLCQDVLSSFQGLCR------ALGVESGGGLSQYHKIKAQLNYWSAKSLW
3dwgB           -----------------------------------------------DSLLQALGNTPLVGLQRLSPRWD


                         +         .         .         .         .         *         .:210
query           ANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILNSLGVRAGDTVAVFGXXXXXXXXXXXXXXXXX
1axeA           SQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGA
1a71A           SQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTQGSTCAVFGLGGAGLSVIMGCKAAGA
1axgA           SQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTQGSTCAVFGLGGAGLSVIMGCKAAGA
1d1sA           TEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGYGAAVKTGKVKPGSTCVVFGLGGVGLSVIMGCKSAGA
1ee2A           SQYTVVDEISVAKIDAASPLEKVCLVGCGFSTGYGSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGA
1d1tA           TEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGYGAAVKTGKVKPGSTCVVFGLGGVGLSVIMGCKSAGA
1e3eA           SQYTVVSEANLARVDDEANLERVCLIGCGFSSGYGAAINTAKVTPGSTCAVFGLGCVGLSAIIGCKIAGA
1cdoA           SQYTVVNQIAVAKIDPSAPLDTVCLLGCGVSTGFGAAVNTAKVEPGSTCAVFGLGAVGLAAVMGCHSAGA
3cosA           SQYTVVSDINLAKIDDDANLERVCLLGCGFSTGYGAAINNAKVTPGSTCAVFGLGGVGLSAVMGCKAAGA
1e3eB           SQYTVVSEANLARVDDEANLERVCLIGCGFSSGYGAAINTAKVTPGSTCAVFGLGCVGLSAIIGCKIAGA
1e3lB           SQYTVVSEANLARVDDEANLERVCLIGCGFSSGYGAAINTAKVTPGSTCAVFGLGCVGLSAIIGCKIAGA
3cosD           SQYTVVSDINLAKIDDDANLERVCLLGCGFSTGYGAAINNAKVTPGSTCAVFGLGGVGLSAVMGCKAAGA
1e3lA           SQYTVVSEANLARVDDEANLERVCLIGCGFSSGYGAAINTAKVTPGSTCAVFGLGCVGLSAIIGCKIAGA
2dfvA           AEYAVVPAQNIWKNPKSIPPEYATLQEP---LGNAVDTVLAGPISGKSVLITGAGPLGLLGIAVAKASGA
2b83A           GEYFHVNDMNLAILPKDMPLENAVMITDMMTTGFHG-AELADIQMGSSVVVIGIGAVGLMGIAGAKLRGA
2dphA           AEYVLVPYADYMLLKFGDKEQAMEKIKDLTLISDILPCVSAGVKPGSHVYIAGAGPVGRCAAAGARLLGA
2dq4A           AEYVVVPAENAWVNPKDLPFEVAAILEPFGNAVHTVYAGSG---VSGKSVLITGAGPIGLMAAMVVRASG
2d8aA           AEYAVVPAQNIWKNPKSIPPEYATLQEP---LGNAVDTVLAGPISGKSVLITGAGPLGLLGIAVAKASGA
1bxzA           FFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHG-AELADIELGATVAVLGIGPVGLMAVAGAKLRGA
2cf5A           AKATVVHQKFVVKIPEGMAVEQAAPLLCAGVTVYSPLSHFGLKQPGLRGGILGLGGVGHMGVKIAKAMGH
1e3jA           ARYYVHAADFCHKLPDNVSLEEGALLEPLSVGVHACRRA---GVQLGTTVLVIGAGPIGLVSVLAAKAYG
2eerB           AEYVLVPHYKYLYKLRRLSAVEAAPLTCSGVTTYRAVRKASLDPSKTLVVIGAGGGLGTMAIQIAKAVSG
2b5wA           SEFFTSPEKYLVRIPRSQAELGFLIEPISITEEHAYASRSAFDWDPSSAFVLGLLTLAMLKVDDKGYENL
3b70A           EQAAALPAGISTAGLAMKLLGLP-------LPSPSADQPPTHSKPVYVLVYGGSTATATVTMQMLRLSGY
2eerA           AEYVLVPHYKYLYKLRRLSAVEAAPLTCSGVTTYRAVRKASLDPSKTLVVIGAGGGLGTMAIQIAKAVSG
2b5vA           SEFFTSPEKYLVRIPRSQAELGFLIEPISITEKALEASRSAFDWDPSSAFVLGNGSLGLLTLAMLKVDDK
3b6zA           -------EQAAALPAGISTAGLAMKLLGLPLPSPSADQPP-THSKPVYVLVYGGSTATATVTMQMLRLSG
2eihA           AEYVVLPEANLAPKPKNLSFEEAAAIPLTFLTAWQMVVDKLGVRPGDDVLVMAAGSGVSVAAIQIAKLFG
2cdaA           EDIGILA-------QPLADIEKSIEEILEVQKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGL
2cdbC           EDIGILA-------QPLADIEKSIEEILEVQKRVPVWTCDDGTLNCRKVLVVG-TGPIGVLFTLLFRTYG
2dm6A           SDGKGLEKLLTEWPDKLPLSLALGTIGMPGLTAYFGLLEVCGVKGGETVLVSAAAGAVGSVVGQIAKLKG
2cd9A           EDIGILA-------QPLADIEKSIEEILEVQKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGL
2cdaB           EDIGILA-------QPLADIEKSIEEILEVQKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGL
2cd9B           REWWYDDPKYLVKIPKLADIEKSIEEILEVQKRVPVWTCDDGTLNCRKVLVVG-TGPIGVLFTLLFRTYG
2cdbA           REWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVDGTLNCRKVLVVGTGPIGVLFTLLFRTYG
2cdbB           EDIGILA-------QPLADIEKSIEEILEVQKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGL
2c0cA           AEYTVVPASIATPVPSVKPEYLTLLVSG--TTAYISLKELGGLSEGKKVLVTAAAGGTGQFAMQLSKKAK
2c0cB           AEYTVVPASIATPVPSVKPEYLTLLVSGTTAYISLK--ELGGLSEGKKVLVTAAAGGTGQFAMQLSKKAK
2dg2A           EEAQAVDQELFNEYQFSVDQLELAGLSCA--TAIAKAYPPTSSKSPPTVLVIGNNGGDGLVCARHLKLFG
1ch6A           TGKPISQGGIHGRISAT-----------------------------------------------------
2ebjA           EHNPSQALLDLLPSEVDGKPLRKAVLPVDAEALGEALEDLHREGPKAVLHLGLAEDRPVLTLERLAVNLL
2a33B           ------------------------------SQGKKSSYQDAAVDLGNELVVYGGGSIGLGLVSQAVHDGG
1dl5B           LTKSYPLSYVYEDIVLVSYDDGEEYSTSSQPSLMALFMEWVGLDKGMRVLEIGGGTGYNAAVMSRVVGEK
1dlgA           ----------------------------------------------------------------------
3c85C           ------------------------------------------INPGHAQVLILGGRIGTGAYDELRARYG
2bhtD           VKLQRMGPDNGSEVWL--KLEGNNPAGSVDRAALSMIVEAERIKPGDVLIEATSGNTGIALAMIAALKGY
3c3pB           GAYLDGLLPEADPVVAAEQIARERNIPIVDRQTGRLLYLLARIKQPQLVVVPGDGLGCASWWFARAISIS
3eeqB           ----------------------------------------------------------------------
3c85B           ------------------------------------------INPGHAQVLILGGRIGTGAYDELRARYG
2bhtB           VKLQRMGPDNGSEV--WLKLEGNNPAGSVDRAALSMIEKRGRIKPGDVLIEAT--SGNTGIALAMIAALK
2eguA           NRIVDEDSADVYLKLEFMNPGSSVKDRIALAMIEAAEKAG-KLKPGDTIVEPGNTGIGLAMVAAAKGYKA
2cqwA           KDFVVQHLKWTDPSGPS-----------------------------------------------------
3e8wA           ----------------------------------------------------------------------
3ci9B           ----------------------------------------------------------------------
3ci9A           ----------------------------------------------------------------------
2bryA           AKLDKRASQPVYQQ--------------------------------------------------------
3dwgB           DGRDGPHVRLWAKLED-RNPTGSIKDRPAVRMIEQA-EADGLLRPGATILEPTSGNTGISLAMAARLKGY


                         .         .         .         +         .         .         .:280
query           XXXXXVDIHNSRLEMAKELGATHTINSKDEDPAEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTV
1axeA           ARIIGVDINKDKFAKAKEVGATECVNPQDYKPIQEVLTEMSNGVDFSFEVIGRLDTMVTALSCCQEAYGV
1a71A           ARIIGVDINKDKFAKAKEVGATECVNPQDYKPIQEVLTEMSNGVDFSFEVIGRLDTMVTALSCCQEAYGV
1axgA           ARIIGVDINKDKFAKAKEVGATECVNPQDYKKPIQLTEMSNGGVDFSFEVIGRLDTMVTALSCCQEAYGV
1d1sA           SRIIGIDLNKDKFEKAMAVGATECISPKDSTKPSEVLSEMTGNNVGFEVIGHLETMIDALASCHMNYGTS
1ee2A           ARIIGVDINKDKFAKAKEVGATECVNPQDYKKQEVLTEMSNGGVDFSFEVIGRLDTMVAALSCCQEAYGV
1d1tA           SRIIGIDLNKDKFEKAMAVGATECISPKDSTPISEVLSEMTGNVGYTFEVIGHLETMIDALSCHMNYGTS
1e3eA           SRIIAIDINGEKFPKAKALGATDCLNPRELDKPVQITELTAGGVDYSLDCAGTAQTLKAAVDCTVLGWGS
1cdoA           KRIIAVDLNPDKFEKAKVFGATDFVNPNDHSEPISLSKMTNGGVDFSLECVGNVGVMRNALESCLKGWGV
3cosA           SRIIGIDINSEKFVKAKALGATDCLNPRDLHKPIVIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGS
1e3eB           SRIIAIDINGEKFPKAKALGATDCLNPRELDKPDVITELTAGGVDYSLDCAGTAQTLKAAVDCTVLGWGS
1e3lB           SRIIAIDINGEKFPKAKALGATDCLNPRELDKQDVITELTAGGVDYSLDCAGTAQTLKAAVDCTVLGWGS
3cosD           SRIIGIDINSEKFVKAKALGATDCLNPRDLHKPIQIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGS
1e3lA           SRIIAIDINGEKFPKAKALGATDCLNPRELDKQDVITELTAGGVDYSLDCAGTAQTLKAAVDCTVLGWGS
2dfvA           YPVIVSEPSDFRRELAKKVGADYVINPFEEDVVKEVDITDGNGVDVFLEFSGAPKALEQGLQAVTPAGRV
2b83A           GRIIGVGSRPICVEAAKFYGATDILNYKNGHIVDQVMKLTNGGVDRVIMAGGGSETLSQAVSMVKPGGII
2dphA           ACVIVGDQNPERLKLLSDAGFETIDLRNSAPLRDQIDQIGKPEVDCGVDAETPNGALNSLFDVVRAGGAI
2dq4A           AGPILVSDPNPYRLAFARPYADRLVNPLEEDLLEVVRRVTGSGVEVLLEFSGNEAAIHQGLMALIPGGEA
2d8aA           YPVIVSEPSDFRRELAKKVGADYVINPFEEDVVKEVDITDGNGVDVFLEFSGAPKALEQGLQAVTPAGRV
1bxzA           GRIIAVGSRPVCVDAAKYYGATDIVNYKDGPIESQIMNLTGKGVDAAIIAGGNADIMATAVKIVKPGGTI
2cf5A           HVTVISSSNKKREEALQDLGADDYVIGSDQAKMSELA----DSLDYVIDTVPVHHALEPYLSLLKLDGKL
1e3jA           AFVVCTARSPRRLEVAKNCGADVTLVVDPAKEIERIRSAIGDLPNVTIDCSGNEKCITIGINITRTGGTL
2eerB           ATIIGVDVREEALEAAKRAGADYVINASSQDPVSEIRRITQGKADAVIDLNNSEKTLSIYPYVLAKQGKY
2b5wA           YCLGRRDRPDPTIDIIEELDATYVDSRQT---PVEDVPDVYEQMDFIYEATGFPKHAIQSVQALAPNGVG
3b70A           IPIA--TCSPHNFDLAKSRGAEEVFDYRAPNLAQTIRTYTKNNLRYALDCITNVESTTFCFAAIGRAGGH
2eerA           ATIIGVDVREEALEAAKRAGADYVINASSQDPVEIRRITQGKGADAVIDLNNSEKTLSIYPYVLAKQGKY
2b5vA           GYENLYDRPDPTIDIIEELDATYVDSRQT---PVEDVPDVYEQMDFIYEATGFPKHAIQSVQALAPNGVG
3b6zA           YIPI-ATCSPHNFDLAKSRGAEEVFDYRAPNLAQTIRTYTKNNLRYALDCITNVESTTFCFAIGRAGGHY
2eihA           ARVIATAGSEDKLRRAKALGADETVNYTHPDWPKEVRRLTGGKGADKVVDHTGALYFEGVIKATANGGRI
2cdaA           EVWM-ANRREPTEVEQTVIEETKTNYYNSSNGYDKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVL
2cdbC           LEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVL
2dm6A           CKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNSLEEALKKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKI
2cd9A           EVWM-ANRREPTEVEQTVIEETKTNYYNSSNGYDKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVL
2cdaB           EVWM-ANRREPTEVEQTVIEETKTNYYNSSNGYDKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVL
2cd9B           LEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVL
2cdbA           LEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVL
2cdbB           EVWM-ANRREPTEVEQTVIEETKTNYYNSSNGYDKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVL
2c0cA           CHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVGTVLKQEYPEGVDVVYESVG-GAMFDLAVDALATKGRL
2c0cB           CHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVGTVLKQEYPEGVDVVYESVG-GAMFDLAVDALATKGRL
2dg2A           YQPTIYYPKRPNKPLFTGLVTQCQKDIPFLGE---PPEPVDELYELVVDAIFGFSFKGILSVLSGLTVPI
1ch6A           ----------------------------------------------------------------------
2ebjA           DFPRPDRGRVLEDLPIVPGGPLA---LPARFPVKPVLARWEAGIPGRPSLSAGSYLCYLSLYRLPEEVPV
2a33B           RHVIGIIPKGETVGEVRAVADHQRKAEAKHSDAFIALPGGYGTLEELLEVITWAQLGIH-------DKPV
1dl5B           GLVVSVEYSRKICEIAKRNVERLGIENVIFVCGDGYYGVPEFSYDVIFVTVGVDEVPETWFTQLKEGGRV
1dlgA           -----GTDRITIEGVERLGGGVYRVLPDRIETGTFLVAAAISGGKIVCRNAQ-PDTLDAVLAKLREAGAD
3c85C           KISLGIEIREEAAQQHRSEGRNVISG--DATDPDFWERILDTGHVKLVLLAPHHQGNQTALEQLQRRNYK
2bhtD           RMK--LLMPDERRAAMRAYGAELIMEGARDLALEMANRGEGKLLDQFNNPDNPKAHYTTTGPEIWTGGRI
3c3pB           SRVV-IDPDRDNVEHARRLHDNGLIDRVELQVGDPLGIAAGQRIDILFDCVFNGADVLERNRCLAKNALL
3eeqB           -----TKLSIERIANILIAKIINPENIVKINAAL----LRDESICIDGINVNFPENIKVCSYIISLRDKE
3c85B           KISLGIEIREEAAQQHRSEGRNVISGDATDP--DFWERILDTGHVKLVLLAPHHQGNQTALEQLQRRNYK
2bhtB           GYRMKLLMPDNRRAAMRAYGAELIEGARDEMANRGEGKLL---DQFNNPDNPKAHYTTTGPEIWQTGGRI
2eguA           VLVMPDTMSLERRNLLRAYGAELVLTPGAQGMRGAIAKVREHGYFMPTTGKEIVEQMGDQLDA-------
2cqwA           ----------------------------------------------------------------------
3e8wA           -----------KKNIEVDFHLTVKGHYTAGGRILILPITGGQMKLKLKNIHIHLVVSY-EMEKDAEGVDH
3ci9B           ------------------------VQDLTSVVQTLLQQMQDKFQTISDQIIGRIDDMSSRIDDL------
3ci9A           ------------------------KTVQDSVVQTLLQQMQDKFQTISDQIIGRIDDMSSRIDDL------
2bryA           ----------------------------------------------------------------------
3dwgB           RLICVMPENTSVRQLLELYGAQIIFSAANTA---------------------------------------


                         .         *         .         .         .         .         +:350
query           GLVGAPAPGAEATFEVGASLVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLVRTYPLEHINDAF
1axeA           SVIVGVPPDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLIHVLPFEKINEGF
1a71A           SVIVGVPPDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLIHVLPFEKINEGF
1axgA           SVIVGVPPDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLIHVLPFEKINEGF
1d1sA           VVVGVP-PSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQLIHVLPFKKISEGF
1ee2A           SVIVGVPPDSQNLSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLIHVLPFEKINEGF
1d1tA           VVVGVP-PSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQLIHVLPFKKISEGF
1e3eA           CTV--VGAKVDEMTIPTVDVILGRSINGTFFGGWKSVDSVPNLVSDYKNKKFDLDLLVHALPFESINDAI
1cdoA           SVLVGW-TDLHDVATRPIQLIAGRTWKGSMFGGFKGKDGVPKMVKAYLDKKVKLDEFIHRMPLESVNDAI
3cosA           CTFIGVAAGSKGLTVFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALVHTLPFDKISEAF
1e3eB           CTV--VGAKVDEMTIPTVDVILGRSINGTFFGGWKSVDSVPNLVSDYKNKKFDLDLLVHALPFESINDAI
1e3lB           CTV--VGAKVDEMTIPTVDVILGRSINGTFFGGWKSVDSVPNLVSDYKNKKFDLDLLVHALPFESINDAI
3cosD           CTFIGVAAGSKGLTVFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALVHTLPFDKISEAF
1e3lA           CTVVGAKV--DEMTIPTVDVILGRSINGTFFGGWKSVDSVPNLVSDYKNKKFDLDLLVHALPFESINDAI
2dfvA           SLLGLY-PGKVTIDFNNLIIFKALTIYGITGRH--LWETWYTVSRLLQSGKLNLDPIIKYKGFDKYEEAF
2b83A           SNINYHGSGDALLIPRVEWGCGMAHKTIKGGLCPGGRLRAEMLRDMVVYNRVDLSKLVVYHGFDHIEEAL
2dphA           GIPGIY-VGSDPDPVNKDAGSGRLHLIRIMTGMAPVTNYNRHLTEAILWDQMLSKVMNEVITLDQAPDGY
2dq4A           RILGIP-SDPIRFDLAGELVMRGITAFGIAGRR--LWQTWMQGTALVYSGRVDLSPLLHRLPLSRYREAF
2d8aA           SLLGLY-PGKVTIDFNNLIIFKALTIYGITGRH--LWETWYTVSRLLQSGKLNLDPIIKYKGFDKYEEAF
1bxzA           ANVNYFGEGEVLPVPRLEWGCGMAHKTIKGGLCPGGRLRMERLIDLVFYKRVDPSKLVVFRGFDNIEKAF
2cf5A           ILMG--VINNPLQFLTPLLM---LGRKVITGSFIGSMKETEEMLEFCKEKGLSS--IIEVVKMDYVNTAF
1e3jA           MLVGMGSQMVTVPL------VNACAREIDIKSVFRYCNDYPIALEMVASGRCNVKQLVHSFKLEQTVDAF
2eerB           VMVG--LFGADLKYHAPLITLNEVQFIGSLV---GNQSDFLGIMSLAEAGK--VKPMVKTMKLEEANEAI
2b5wA           ALLGVP-SDWAFEVDAGAFHREMVLHNKALVGSSHVEHFEAATVTFTKLPKWFLEDLVGVHPLSEFEAAF
3b70A           YVSLNPFPETRKMVTTDWTLGPTIGRPGSEEERQFGEDLWRIAGQLVEDGRLVHHPLRVQGGFDHIKQGM
2eerA           VMVG--LFGADLKYHAPLITLNEV---QFIGSLVGNQSDFLGIMSLAEAGK--VKPMVKTMKLEEANEAI
2b5vA           ALLGVPSWAFEVDAGAFHREMVLHNKALVGSVNSHVEHFEAATVTFTKLPKWFLEDLVGVHPLSEFEAAF
3b6zA           VSLNPFPRKGPTIFGEGSTWPAPYGRPGSEEERQFGEDLWRIAGQLVEDGRLVHHPLRVQGGFDHIKQGM
2eihA           AIAGA-SSGYEGTLPFAHVFYRQLSILGSTMASKSRLFPILRFVEEGK-----LKPVVQVLPLEAAAEGH
2cdaA           GLFGFSGSVPLDYKTLQEIVHTNKTIIGLVNGQKPHFQQAVVHLASWKLYPKAAKMLIKTVSINDEKELL
2cdbC           GLFGFSTSGPLDYKTLQEIVHTNKTIIGLVNGQKPHFQQAVVHLASWKLYPKAAKMLIKTVSIN------
2dm6A           AICGAISVYNRMDQLPESIIYKQLRIEGFIVYRWQGDKALRDLMKWVLEGK--IQYHEVTKGFENMPAAF
2cd9A           GLFGFSTSGPLDYKTLQEIVHTNKTIIGLVNGQKPHFQQAVVHLASWKLYPKAAKMLIKTVSINDEKELL
2cdaB           GLFGFSTSVPLDYKTLQEIVHTNKTIIGLVNGQKPHFQQAVVHLASWKLYPKAAKMLIKTVSINDEKELL
2cd9B           GLFGFSTSGPLDYKTLQEIVHTNKTIIGLVNGQKPHFQQAVVHLASWKLYPKAAKMLIKTVSINDEKELL
2cdbA           GLFGFSTSGPLDYKTLQEIVHTNKTIIGLVNGQKPHFQQAVVHLASWKLYPKAAKMLIKTVSINDEKELL
2cdbB           GLFGFSTSGPLDYKTLQEIVHTNKTIIGLVNGQKPHFQQAVVHLASWKLYPKAAKMLIKTVSINDEKELL
2c0cA           IVIGFI-SGYQTPTGLSPVKAGTLPAKLLKHYLSKYQAAMSHLLEMCVSGDLVCEVDLRFTGLESIFRAV
2c0cB           IVIGFI-SGYQTPTGLSPVKAGTLPAKLLKKSASVYQAAMSHLLEMCVSGDLVCEVDLRFTGLESIFRAV
2dg2A           ASIDIP-SGWDVEKGNPSGIQPDL---LISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPD
1ch6A           ----------------------------------------------------------------------
2ebjA           GFLHLPPDETLALKRPRPYV--------------------------------------------------
2a33B           GLLNVDGYYNS-LLSFIDKAVEEGFISPTAREIIVSAPTAKELVKKLEE---------------------
1dl5B           IVPINLKLSRRQPAFLFKKKDPYLVGNYKLETRFIT----------------------------------
1dlgA           IETGEDW----ISLDMHGKRPKAVTVRTAPHPAFPTDMQAQFTLLNVAEGTGVITETIFENRFMHVPELI
3c85C           GQIAAIA---------------------------------------------------------------
2bhtD           THFVSSMGTTGTITGVSEFMREQSKPVTIVGLQPEEGSSI------------------------------
3c3pB           IAVNALRREFNHHLSRRRDFFTTI----------------------------------------------
3eeqB           YKDKIVVWLKPLKIDVKMEEIRDGIYKVLERLNLKRERIGIIASIREEEEEINNFMNPCLTPPKGVAEIS
3c85B           GQIAAIA---------------------------------------------------------------
2bhtB           THFVSSMGTTGTITGVSEFMREQSKPVTIVGLQPEEGSSI------------------------------
2eguA           ----------------------------------------------------------------------
2cqwA           ----------------------------------------------------------------------
3e8wA           VIFKKYTVTFDVKDNA-QFGLTNLFNGNKELSDTMLNQNWKQVSEEFGKP---VMEAAAKKIFKNIKHFL
3ci9B           ----------------------------------------------------------------------
3ci9A           ----------------------------------------------------------------------
2bryA           ----------------------------------------------------------------------
3dwgB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ADSASGEVIKPIITFP
1axeA           DLLRSGESIRTILTF-
1a71A           DLLRSGESIRTILTF-
1axgA           DLLRSGESIRTILTF-
1d1sA           ELLNSGQSIRTVLTF-
1ee2A           DLLRSGKSIRTILTF-
1d1tA           ELLNSGQSIRTVLTF-
1e3eA           DLMKEGKSIRTILTF-
1cdoA           DLMKHGKCIRTVLSL-
3cosA           DLMNQGKSIRTILIF-
1e3eB           DLMKEGKSIRTILTF-
1e3lB           DLMKEGKSIRTILTF-
3cosD           DLMNQGKSIRTILIF-
1e3lA           DLMKEGKSIRTILTF-
2dfvA           ELRAGKTGKVVFL---
2b83A           LLMKDKPLIKAVVIL-
2dphA           AKFDKGSPAKFVIDPH
2dq4A           GLLASGQAVKVILDP-
2d8aA           -ELRAGKTGKVVF---
1bxzA           MLMKDKPLIKPVVIL-
2cf5A           ERLEKNDVRRFVVDVE
1e3jA           EAARKKADIKVMISCR
2eerB           DNLENFKAVGRQVLVP
2b5wA           DD--DDTTIKTAIEF-
3b70A           ELVRKGELSGEKL---
2eerA           DNLENFKAVGRQV---
2b5vA           DD--DDTTIKTAIEF-
3b6zA           ELVRKGELSGEKL---
2eihA           RLLEERRVFGKVV---
2cdaA           KREKEHGEIKIRILW-
2cdbC           ----------------
2dm6A           IEMLNGANLGKAV---
2cd9A           KREKEHGEIKIRILW-
2cdaB           KREKEHGEIKIRILW-
2cd9B           KREKEHGEIKIRILW-
2cdbA           KREKEHGEIKIRILW-
2cdbB           KREKEHGEIKIRILW-
2c0cA           NYMYMGKNTKIVVELP
2c0cB           NYMYMGKNTKIVVELP
2dg2A           TECV------------
1ch6A           ----------------
2ebjA           ----------------
2a33B           ----------------
1dl5B           ----------------
1dlgA           RMGAHAEIE-------
3c85C           ----------------
2bhtD           ----------------
3c3pB           ----------------
3eeqB           ALIAGGRNSKLILRKI
3c85B           ----------------
2bhtB           ----------------
2eguA           ----------------
2cqwA           ----------------
3e8wA           AKVPIAEIA-------
3ci9B           ----------------
3ci9A           ----------------
2bryA           ----------------
3dwgB           ----------------