[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF55431.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dnjA.bssp"
#ERROR : Can't open dsspfile "3dnjB.bssp"

## Summary of PDB Search
:100
    9e-18  26%  3dnjA  [x.x.x] ATP-DEPENDENT CLP PROTEASE ADAPTER PROTEIN CLPS
    2e-16  26%  3dnjB  [x.x.x] ATP-DEPENDENT CLP PROTEASE ADAPTER PROTEIN CLPS
:100

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxPWLCIVWDDPVNLMSYVTYVFQTVLGFSKKRATELMMQVHTEGKA
3dnjA           --------------------------YRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVG
3dnjB           -------------------------LYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVG


                         .         .         *         .         .         .         .:140
query           VVSSGEKDKVEGDVKKLHTAGLWATMQQxx
3dnjA           VCGVYTYEVAETKVARRHQHPLQCTMEK--
3dnjB           VCGVYTYEVAEIDSARRHQHPLQCTMEK--