[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF55454.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2c0cB.bssp"
#ERROR : Can't open dsspfile "2b5wA.bssp"
#ERROR : Can't open dsspfile "2cd9B.bssp"
#ERROR : Can't open dsspfile "2dq4A.bssp"
#ERROR : Can't open dsspfile "2dm6A.bssp"
#ERROR : Can't open dsspfile "2eerA.bssp"
#ERROR : Can't open dsspfile "2b5vA.bssp"
#ERROR : Can't open dsspfile "1bxzA.bssp"
#ERROR : Can't open dsspfile "2c0cA.bssp"
#ERROR : Can't open dsspfile "2cdaB.bssp"
#ERROR : Can't open dsspfile "2cdbA.bssp"
#ERROR : Can't open dsspfile "3b70A.bssp"
#ERROR : Can't open dsspfile "2eihA.bssp"
#ERROR : Can't open dsspfile "2cd9A.bssp"
#ERROR : Can't open dsspfile "1e3lB.bssp"
#ERROR : Can't open dsspfile "1e3jA.bssp"
#ERROR : Can't open dsspfile "2eerB.bssp"
#ERROR : Can't open dsspfile "2cdbC.bssp"
#ERROR : Can't open dsspfile "2dfvA.bssp"
#ERROR : Can't open dsspfile "3cosD.bssp"
#ERROR : Can't open dsspfile "1cdoA.bssp"
#ERROR : Can't open dsspfile "1ee2A.bssp"
#ERROR : Can't open dsspfile "1axeA.bssp"
#ERROR : Can't open dsspfile "2cdaA.bssp"
#ERROR : Can't open dsspfile "2d8aA.bssp"
#ERROR : Can't open dsspfile "3b6zA.bssp"
#ERROR : Can't open dsspfile "2cdbB.bssp"
#ERROR : Can't open dsspfile "2cf5A.bssp"
#ERROR : Can't open dsspfile "1d1sA.bssp"
#ERROR : Can't open dsspfile "1axgA.bssp"
#ERROR : Can't open dsspfile "1d1tA.bssp"
#ERROR : Can't open dsspfile "3cosA.bssp"
#ERROR : Can't open dsspfile "1a71A.bssp"
#ERROR : Can't open dsspfile "1e3eB.bssp"
#ERROR : Can't open dsspfile "2dphA.bssp"
#ERROR : Can't open dsspfile "1e3lA.bssp"
#ERROR : Can't open dsspfile "1dlgA.bssp"
#ERROR : Can't open dsspfile "1e3eA.bssp"
#ERROR : Can't open dsspfile "2dg2A.bssp"
#ERROR : Can't open dsspfile "2b83A.bssp"
#ERROR : Can't open dsspfile "3eeqB.bssp"
#ERROR : Can't open dsspfile "2ebjA.bssp"
#ERROR : Can't open dsspfile "3c85C.bssp"
#ERROR : Can't open dsspfile "3c85D.bssp"
#ERROR : Can't open dsspfile "3e48B.bssp"
#ERROR : Can't open dsspfile "2c29F.bssp"
#ERROR : Can't open dsspfile "2cnbB.bssp"
#ERROR : Can't open dsspfile "3dxfA.bssp"
#ERROR : Can't open dsspfile "3e90D.bssp"
#ERROR : Can't open dsspfile "3c3pB.bssp"
#ERROR : Can't open dsspfile "3c3xA.bssp"
#ERROR : Can't open dsspfile "1b8pA.bssp"
#ERROR : Can't open dsspfile "3e90B.bssp"
#ERROR : Can't open dsspfile "3e5mA.bssp"
#ERROR : Can't open dsspfile "2cnbA.bssp"
#ERROR : Can't open dsspfile "2bllA.bssp"
#ERROR : Can't open dsspfile "2dknB.bssp"
#ERROR : Can't open dsspfile "3e48A.bssp"
#ERROR : Can't open dsspfile "2dknA.bssp"
#ERROR : Can't open dsspfile "2e37E.bssp"
#ERROR : Can't open dsspfile "2c29D.bssp"
#ERROR : Can't open dsspfile "2e37D.bssp"
#ERROR : Can't open dsspfile "2c20A.bssp"
#ERROR : Can't open dsspfile "2cnbC.bssp"
#ERROR : Can't open dsspfile "2c5eA.bssp"
#ERROR : Can't open dsspfile "2belC.bssp"

## Summary of PDB Search
:335
    3e-25  18%  2c0cB  [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN
    5e-25  14%  2b5wA  [x.x.x] GLUCOSE DEHYDROGENASE
    6e-25  13%  2cd9B  [x.x.x] GLUCOSE DEHYDROGENASE
    6e-25  19%  2dq4A  [x.x.x] L-THREONINE 3-DEHYDROGENASE
    1e-24  15%  2dm6A  [x.x.x] NADP-DEPENDENT LEUKOTRIENE B4 12-
    1e-23  19%  2eerA  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    1e-23  16%  2b5vA  [x.x.x] GLUCOSE DEHYDROGENASE
    3e-23  16%  1bxzA  [b.35.1 - c.2.1] NADP-DEPENDENT ALCOHOL DEHYDROGENASE
    7e-23  19%  2c0cA  [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN
    2e-22  14%  2cdaB  [x.x.x] GLUCOSE DEHYDROGENASE
    4e-22  14%  2cdbA  [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,
    5e-22  17%  3b70A  [x.x.x] ENOYL REDUCTASE
    1e-21  23%  2eihA  [x.x.x] ALCOHOL DEHYDROGENASE
    1e-21  13%  2cd9A  [x.x.x] GLUCOSE DEHYDROGENASE
    2e-21  15%  1e3lB  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    2e-21  14%  1e3jA  [b.35.1 - c.2.1] NADP(H)-DEPENDENT KETOSE REDUCTASE
    2e-21  20%  2eerB  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    4e-21  14%  2cdbC  [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,
    9e-21  19%  2dfvA  [x.x.x] PROBABLE L-THREONINE 3-DEHYDROGENASE
    1e-20  15%  3cosD  [x.x.x] ALCOHOL DEHYDROGENASE 4
    2e-20  16%  1cdoA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    2e-20  13%  1ee2A  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    3e-20  13%  1axeA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    3e-20  14%  2cdaA  [x.x.x] GLUCOSE DEHYDROGENASE
    4e-20  19%  2d8aA  [x.x.x] PROBABLE L-THREONINE 3-DEHYDROGENASE
    4e-20  17%  3b6zA  [x.x.x] ENOYL REDUCTASE
    4e-20  14%  2cdbB  [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,
    1e-19  21%  2cf5A  [x.x.x] CINNAMYL ALCOHOL DEHYDROGENASE
    4e-19  15%  1d1sA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE CLASS IV SIGMA CHAIN
    1e-18  13%  1axgA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    1e-18  15%  1d1tA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE CLASS IV SIGMA CHAIN
    2e-18  15%  3cosA  [x.x.x] ALCOHOL DEHYDROGENASE 4
    2e-18  14%  1a71A  [b.35.1 - c.2.1] LIVER ALCOHOL DEHYDROGENASE
    2e-18  15%  1e3eB  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    5e-18  16%  2dphA  [x.x.x] FORMALDEHYDE DISMUTASE
    3e-17  15%  1e3lA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    4e-17  11%  1dlgA  [d.68.2] UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL TRANSFERASE
    1e-16  16%  1e3eA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    4e-16  11%  2dg2A  [x.x.x] APOLIPOPROTEIN A-I BINDING PROTEIN
    9e-16  17%  2b83A  [x.x.x] NADP-DEPENDENT ALCOHOL DEHYDROGENASE
    3e-15  10%  3eeqB  [x.x.x] PUTATIVE COBALAMIN BIOSYNTHESIS PROTEIN G
    2e-08  11%  2ebjA  [x.x.x] PYRROLIDONE CARBOXYL PEPTIDASE
    7e-08  16%  3c85C  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    2e-05  13%  3c85D  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    5e-05  19%  3e48B  [x.x.x] PUTATIVE NUCLEOSIDE-DIPHOSPHATE-SUGAR EPIMERASE
    6e-05  27%  2c29F  [x.x.x] DIHYDROFLAVONOL 4-REDUCTASE
    6e-05  12%  2cnbB  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    8e-05  24%  3dxfA  [x.x.x] NMRA-LIKE FAMILY DOMAIN-CONTAINING PROTEIN 1
    8e-05  13%  3e90D  [x.x.x] NS3 PROTEASE
    9e-05  10%  3c3pB  [x.x.x] METHYLTRANSFERASE
    1e-04  25%  3c3xA  [x.x.x] EUGENOL SYNTHASE 1
    1e-04  13%  1b8pA  [c.2.1 - d.162.1] PROTEIN (MALATE DEHYDROGENASE)
    1e-04  12%  3e90B  [x.x.x] NS3 PROTEASE
    2e-04  27%  3e5mA  [x.x.x] NMRA-LIKE FAMILY DOMAIN-CONTAINING PROTEIN 1
    3e-04  18%  2cnbA  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    5e-04  19%  2bllA  [x.x.x] PROTEIN YFBG
    6e-04  24%  2dknB  [x.x.x] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    6e-04  24%  3e48A  [x.x.x] PUTATIVE NUCLEOSIDE-DIPHOSPHATE-SUGAR EPIMERASE
    7e-04  18%  2dknA  [x.x.x] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    7e-04  15%  2e37E  [x.x.x] L-LACTATE DEHYDROGENASE
    7e-04  32%  2c29D  [x.x.x] DIHYDROFLAVONOL 4-REDUCTASE
    8e-04  17%  2e37D  [x.x.x] L-LACTATE DEHYDROGENASE
    8e-04  32%  2c20A  [x.x.x] UDP-GLUCOSE 4-EPIMERASE
    8e-04  25%  2cnbC  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    8e-04  24%  2c5eA  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    0.001  27%  2belC  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
:335

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxVVLTQDEDGNFSTAYQDTYSDPSFLGEGDVLIEVGWSSLNYKDAMALKGDKGVVRTVPLIP
2c0cB           ---------------------------------PGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDI
2b5wA           ---------------------------------PESGEALVRTLRVGVCGTDHEVIAGGHGGFPEGHLVL
2cd9B           -----------------------------EKKLDSYGKIKIRTIYNGICGTDREIVNGKLTLG-KDFLVL
2dq4A           ---------------------------------PGPGEILVRVEAASICGTDLHIWKWDAWARGRIPLVT
2dm6A           ---------------------------------LKNGEVLLEALFLSVDPYMRIASKRL----KEGAVMM
2eerA           ---------------------------------PKGSQVLIKIEAAGVCHSDVHMRQGREDLGVKLPVTL
2b5vA           ---------------------------------PESGEALVRTLRVGVDGTDHEVIAGGHGGFPEGHLVL
1bxzA           ---------------------------------PGPFDAIVRPLAVAPCTSDIHTVFEGAIGER-HNMIL
2c0cA           ---------------------------------PGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDI
2cdaB           -----------------------------EKKLDSYGKIKIRTIYNGICGTDREIVNGKL---GKDFLVL
2cdbA           -----------------------------EKKLDSYGKIKIRTIYNGICGADREIVNGKLKGKD--FLVL
3b70A           ---------------------------------LPRDQVYVRVEAVAINPSDTKMRGQF----ATPWAFL
2eihA           ---------------------------------PGPKEVRVRLKAAALNHLDVWVRKGVASPKLPLPHVL
2cd9A           -----------------------------EKKLDSYGKIKIRTIYNGICGTDREIVNGKLTLSK--GKDF
1e3lB           ---------------------------------PKACEVRIQVIATCVCHTDINATDPKKK--ALFPVVL
1e3jA           ---------------------------------PKEDEVLLQMAYVGICGSDVHYYEHGRIADFIVPMVI
2eerB           ---------------------------------PKGSQVLIKIEAAGVCHSDVHMRQGREDLGVKLPVTL
2cdbC           -----------------------------EKKLDSYGKIKIRTIYNGICGADREIVNGK----LKDFLVL
2dfvA           ---------------------------------PGPGEVLIKVLATSICGTDLHIYEWNWAQSRIKPPQI
3cosD           ----------------------------------------------------------------------
1cdoA           ---------------------------------PHANEIRIKIIATGVCHTDLYHLFEGKHKDGF-PVVL
1ee2A           ---------------------------------PKAHEVRIKMVAAGICRSDDHVVSGTLVA--PLPVIA
1axeA           ---------------------------------PKAHEVRIKMVATGICRSDDHVVSGTLV--TPLPVIA
2cdaA           -----------------------------EKKLDSYGKIKIRTIYNGICGTDREIVNGKLKGKD--FLVL
2d8aA           ---------------------------------PGPGEVLIKVLATSICGTDLHIYEWNEWAQSRIPPQI
3b6zA           ---------------------------------LPRDQVYVRVEAVAINPSDTKMRGQF----ATPWAFL
2cdbB           -----------------------------EKKLDSYGKIKIRTIYNGICGADREIVNGKL---GKDFLVL
2cf5A           ---------------------------------TGPEDVNIRIICCGICHTDLHQTKNDLGMSNY-PMVP
1d1sA           ---------------------------------PKTKEVRIKILATGICRTDDHVIKGTMVS--KFPVIV
1axgA           ---------------------------------PKAHEVRIKMVATGICRSDDHVVSGTLVTPL--PVIA
1d1tA           ---------------------------------PKTKEVRIKILATGICRTDDHVIKGTMV--SKFPVIV
3cosA           ----------------------------------------------------------------------
1a71A           ---------------------------------PKAHEVRIKMVATGICRSDDHVVSGTLVTPL--PVIA
1e3eB           ---------------------------------PKACEVRIQVIATCVCPTDINATDPKKK--ALFPVVL
2dphA           ---------VVYHGTRDLRVETVPYPKLEHNNRKLEHAVILKVVSTNICGSDQHIYRGRFI--VPKGHVL
1e3lA           ---------------------------------PKACEVRIQVIATCVCHTDINATDPKKKA--LFPVVL
1dlgA           -----------------------------LGTKVERGSVWIDASNVNNFSAPYDLVKTMRASIWALGPLV
1e3eA           ---------------------------------PKACEVRIQVIATCVCPTDINATDPKKKALF--PVVL
2dg2A           ----------------------------------------------------------------------
2b83A           ---------------------------------AGSYDAIVRPLAVSPCTSDIHTVFEGALGDRK-NMIL
3eeqB           -----------------------------------------------------------RGICIISASED
2ebjA           ----------------------------------------------------------------------
3c85C           ----------------------------------------------------------------------
3c85D           ----------------------------------------------------------------------
3e48B           ----------------------------------------------------------------------
2c29F           ----------------------------------------------------------------------
2cnbB           ----------------------------------------------------------------------
3dxfA           ----------------------------------------------------------------------
3e90D           --------------------------------RTKPGVFKTPEGEIGAVTLDFPTGTSGSPIVDKNGDVI
3c3pB           ----------------------------------------------------------------------
3c3xA           ----------------------------------------------------------------------
1b8pA           ----------------------------------------------------------------------
3e90B           -----------------------------KNVRTKPGVFKTPEGEIGAVTLDFPTGTSGSPIVDKNGDVI
3e5mA           ----------------------------------------------------------------------
2cnbA           ----------------------------------------------------------------------
2bllA           ----------------------------------------------------------------------
2dknB           ----------------------------------------------------------------------
3e48A           ----------------------------------------------------------------------
2dknA           ----------------------------------------------------------------------
2e37E           ----------------------------------------------------------------------
2c29D           ----------------------------------------------------------------------
2e37D           ----------------------------------------------------------------------
2c20A           ----------------------------------------------------------------------
2cnbC           ----------------------------------------------------------------------
2c5eA           ----------------------------------------------------------------------
2belC           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GIDVVGTVIESADPRFGRGDEVVLNGAGLGENRHGGFTQRLKVPSEPLLHIPFNFSAQQVXXXXXXXXXX
2c0cB           GFEGIGEVVALGLSASA----RYTVGQAVAYMAPGSFAEYTVVPASIATPVPSVKPEYLTLLVSGTTAYI
2b5wA           GHEAVGVVVDPNDTELEEGDIVVPTVRRGIVGAHGYMSEFFTSPEKYLVRIPRSQAELGFLIEPISITEK
2cd9B           GHEAIGVVEEHGFSQGDLVMPVNEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGIIEKSIEEILE
2dq4A           GHEFSGVVEAPGVRRPQVGDHVSLNTQILGVDRDGGFAEYVVVPAENAWVNPKDLPFEVAAILEPFGNAV
2dm6A           GQQVARVVESKNSAFPAGSIVLAQSGWT-----THFISDGKGLEKLLTEWPDKLPLSLA---LGTIGMPG
2eerA           GHEIAGRIEEDEVVGYSKGDLVADSPRWLGINYDGAYAEYVLVPHYKYLYKLRRLSAVEA---APLTCSG
2b5vA           GHEAVGVVVDPNDTELEEGDIVVPYFERGIVGAHGYMSEFFTSPEKYLVRIPRSQAELGFLIEPISITEK
1bxzA           GHEAVGEVVESEVKDFKPGDRVVVWKFSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAA---VMIPDMM
2c0cA           GFEGIGEVVALGLSARYTVGQAV------AYMAPGSFAEYTVVPASIATPVPSVKPEYLTLLVSGTTAYI
2cdaB           GHEAIGVVEESYHGFSQGVMPVNRRGCGGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEK
2cdbA           GHEAIGVVEESYHGQGDLVMPVGEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEK
3b70A           GTDYAGTVVASDVTHIQVGDRVYQNEMCPRTPDQGAFSQYTVTRGRVWAKIPKGLSFEQTAGLAMKLLGL
2eihA           GADGSG-VVDAVGPGFAPGDEVVPRYQILGEHRHGTYAEYVVLPEANLAPKPKNLSFEEA---AAIPLTF
2cd9A           LVLGHEAIGVESYHGFSQGDLVMPVGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEK
1e3lB           GHECAGIVERCKLCLSPLTNQELMEDRTYHFMGVSSFSQYTVVSEANLARVDDEANLERVCLIGCGFSSG
1e3jA           GHEASGTVVKKNVKHLKKGDRVAVLTFCATPPDDGNLARYYVHAADFCHKLPDNVSLEEGALLEPLSVGV
2eerB           GHEIAGRIEEDEVVGYSKGDLVADSPRWLGINYDGAYAEYVLVPHYKYLYKLRRLSAVEAAPLTCSGVTT
2cdbC           GHEAIGVVEESYHGFSQVGRPTGEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEIGILAQPLADIEKS
2dfvA           GHEVAGEVVEGKCYACRRGQYHVCNTKIFGVDTDGVFAEYAVVPAQNIWKNPKSIPPEYATLQEPLG---
3cosD           ----QQLMEDKTSRFTCKGKPV------YHFFGTSTFSQYTVVSDINLAKIDDDANLERVCLLGCGFSTG
1cdoA           GHEGAGIVESPGVTEFQPGEKVIPLRKVLQFLGTSTFSQYTVVNQIAVAKIDPSAPLDTVCLLGCGVSTG
1ee2A           GHEAAGIVESEGVTTVRPGDKVIPLKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLVGCGFSTG
1axeA           GHEAAGIVESIGEGTVRPGDKVIPLKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTG
2cdaA           GHEAIGVVEESYHGFSQGDCETGEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEK
2d8aA           GHEVAGEVVEIGPGVEGIGDYVSVETHIVCGKTDGVFAEYAVVPAQNIWKNPKSIPPEYATLQEPLGN--
3b6zA           GTDYAGTVVASDVTHIQVGDRVYQNEMCPRTPDQGAFSQYTVTRGRVWAKIPKGLSFEQAAALPAGISTA
2cdbB           GHEAIGVVEESYHSQGDLVMPVNRFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEK
2cf5A           GHEVVGEVVESDVSKFTVGDLEQYCPKINGQPTQGGFAKATVVHQKFVVKIPEGMAVEQAAPLLCAGVT-
1d1sA           GHEATGIVESIGETTVKPGDKVIPLKPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTG
1axgA           GHEAAGIVESIGEGTVRPGDKVIPLKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTG
1d1tA           GHEATGIVESEGVTTVKPGDKVIPLKPVHHFLNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTG
3cosA           ----QQLMEDKTSRFTCKGKPVY------HFFGTSTFSQYTVVSDINLAKIDDDANLERVCLLGCGFSTG
1a71A           GHEAAGIVESEGVTTVRPGDKVIPLKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTG
1e3eB           GHECAGIVESLRNFKYPTIDQELMEDRTYHFMGVSSFSQYTVVSEANLARVDDEANLERVCLIGCGFSSG
2dphA           GHEITGVEKGSDVELMDIGDLVSGAFGFDLKGWSGGQAEYVLVPYADYMLLKFGDKEQAMEKIKDLTLIS
1e3lA           GHECAGIVGKLRNFKYPTIDQELMEDRTYHFMGVSSFSQYTVVSEANLARVDDEANLERV---CLIGCGF
1dlgA           ARFGQGQVSLPGGSGARPVDLHIFGLEKLGAEIKLEEGYVKASVNGRLKGAHIVM-----------DKVS
1e3eA           GHECAGIVESVRNFKYPTIDQELMEDRTYHFMGVSSFSQYTVVSEANLARVDDEANLERVCLIGCGFSSG
2dg2A           --------------------------------KYLSQEEAQAVDQELFNEYQFSVDQLELAGLSCATAIA
2b83A           GHEAVGEVVESEVKDFKPGDRVIVPCWKFSNFKDGVFGEYFHVNDADLAILPKDMPLENAVMITDMMTTG
3eeqB           AFSAGETIKEKSFEIPVVHYRYK--DAEIETIWKCYDAIVFVMALEGATRIVCKYAKED-----------
2ebjA           -----------------------------GFEPFGSLEHNPSQALLDLLPSEVDGKPLRKAVLPVDAEA-
3c85C           ----------------------------------------------------------------------
3c85D           ----------------------------------------------------------------------
3e48B           ----------------------------------------------------------------------
2c29F           ----------------------------------------------------------------------
2cnbB           ----------------------------------------------------------------------
3dxfA           ----------------------------------------------------------------------
3e90D           GLYGNGVIMPSYISAIVQGKRMD-----------------------------------------------
3c3pB           --------------------------------VDSRIGAYLDGLLPEADPVVAAEQIAR----ERNIPIV
3c3xA           ----------------------------------------------------------------------
1b8pA           ----------------------------------------------------------------------
3e90B           GLYGNGVIMPSYISAIVQGKRMD-----------------------------------------------
3e5mA           ----------------------------------------------------------------------
2cnbA           ----------------------------------------------------------------------
2bllA           ----------------------------------------------------------------------
2dknB           ----------------------------------------------------------------------
3e48A           ----------------------------------------------------------------------
2dknA           ----------------------------------------------------------------------
2e37E           ----------------------------------------------------------------------
2c29D           ----------------------------------------------------------------------
2e37D           ----------------------------------------------------------------------
2c20A           ----------------------------------------------------------------------
2cnbC           ----------------------------------------------------------------------
2c5eA           ----------------------------------------------------------------------
2belC           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXSVNALVDQGIKPEDGEILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAEYLTSLGASDIIDRAE
2c0cB           SLKELGGLSEGKK-----VLVTAAAGGTGQFAMQLS-KKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKT
2b5wA           ALEHAYASRSAFDWDPSSAFVLGN-GSLGLLTLAMLKVDDKGYENLRDRPDPTIDIIEELDATYVDSRQT
2cd9B           VQKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLF-RTYGLEVWMANRREPTEVEQTVIEETKTNYYNS
2dq4A           HTVYAGSGVSGKSVLITG------AGPIGLMAAMVVRASGAGPILVSDPNPYRLAFARPYADRLVNPLEE
2dm6A           LTAYFGLLEVCGVKGGETVLVSAAAGAVGSV-VGQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKT
2eerA           VTTYRAVRKASLDP-SKTLVVIGAGGGLGTMAIQIAKAVSGATIIGVDVREEALEAAKRAGADYVINASS
2b5vA           ALEHAYASRSAFDWDPSSAFVLGNG-SLGLLTLAMLKVDDKGYENLRDRPDPTIDIIEELDATYVDSRQT
1bxzA           TTGFHGAELADIEL--GATVAVLGIGPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKD
2c0cA           SLKELGGLSEGKK-----VLVTAAAGGTGQFAMQLS-KKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKT
2cdaB           SIKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMAN-RREPTEVEQTVIEETKTNYYNS
2cdbA           SIKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMAN-RREPTEVEQTVIEETKTNYYNS
3b70A           PLPSPSADQPPTHSKPVYVLVYGGSTATATVTMQMLRL--SGYIPIATCSPHNFDLAKSRGAEEVFDYRA
2eihA           LTAWQMVVDKLGVRPGDDVLVMAAGSGV-SVAAIQIAKLFGARVIATAGSEDKLRRAKALGADETVNYTH
2cd9A           SIKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMAN-RREPTEVEQTVIEETKTNYYNS
1e3lB           Y---GAAINTAKVTPGSTCAVFGLGCVGLSAIIGCKIAGASRIIAID-INGEKFPKAKALGATDCLNPRE
1e3jA           HACRRAGVQL------GTTVLVIGAGPIGLVSVLAAKAYGAFVVCTA-RSPRRLEVAKNCGADVTLVVDP
2eerB           Y---RAVRKASLDPSK-TLVVIGAGGGLGTMAIQIAKAVSGATIIGVDVREEALEAAKRAGADYVINASS
2cdbC           IEEILEVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMAN-RREPTEVEQTVIEETKTNYYNS
2dfvA           ---NAVDTVLA-GPISGKSVLITGAGPLGLLGIAVAKASGAYPVIVSEPSDFRRELAKKVGADYVINPFE
3cosD           YG---AAINNAKVTPGSTCAVFGLGGVGLSAVMGCKAAGASRIIGIDINSE-KFVKAKALGATDCLNPRD
1cdoA           FG---AAVNTA-KVEPGSTCAVFGLGAVGLAAVMGCHSAGAKRIIAVDLNPDKFEKAKVFGATDFVNPND
1ee2A           YG---SAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGAARIIGVD-INKDKFAKAKEVGATECVNPQD
1axeA           YG---SAVKVAKVTQGSTCAVFGLGGVGLSVIMGCK-AAGAARIIGVDINKDKFAKAKEVGATECVNPQD
2cdaA           SIEEIPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLE-VWMANRREPTEVEQTVIEETKTNYYNS
2d8aA           -----AVDTVLAGPISGKSVLITGAGPLGLLGIAVAKASGAYPVIVSEPSDFRRELAKKVGADYVINPFE
3b6zA           GLAMKSADQPPTHSKPVYVLVYGGSTATATVTMQMLRLSGYIPIAT--CSPHNFDLAKSRGAEEVFDYRA
2cdbB           SIEEIVWTCDD-GTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMAN-RREPTEVEQTVIEETKTNYYNS
2cf5A           --VYSPLSHFGLKQPGLRGGILG-LGGVGHMGVKIAKAMGHHVTVISSSNKKREEALQDLGADDYVIGSD
1d1sA           YG---AAVKTG-KVKPGSTCVVFGLGGVGLSVIMGCKSAGASRIIGIDLNKDKFEKAMAVGATECISPKD
1axgA           YG---SAVKVAKVTQGSTCAVFGLGGAGLSVIMGCK-AAGAARIIGVDINKDKFAKAKEVGATECVNPQD
1d1tA           YG---AAVKTG-KVKPGSTCVVFGLGGVGLSVIMGCKSAGASRIIGIDLNKDKFEKAMAVGATECISPKD
3cosA           YG---AAINNAKVTPGSTCAVFGLGGVGLSAVMGCKAAGASRIIGIDINSE-KFVKAKALGATDCLNPRD
1a71A           YG---SAVKVAKVTQGSTCAVFGLGGAGLSVIMGCKAAGAARIIGVDINKD-KFAKAKEVGATECVNPQD
1e3eB           Y---GAAINTAKVTPGSTCAVFGLGCVGLSAIIGCK-IAGASRIIAIDINGEKFPKAKALGATDCLNPRE
2dphA           DILPTGFGCVSAGVKPGSHVYIAGAGPVGRCAAAGARLLGAACVIVGDQNPERLKLLSDAGFETIDLRNS
1e3lA           SSGYGAAINTAKVTPGSTCAVFGLGCVGLSAIIGCK-IAGASRIIAIDINGEKFPKAKALGATDCLNPRE
1dlgA           VGATVTIMSAATLAEGTTIIENAAREPEIVDTANFLVALGAKISGQGTDRITIEGVERLGGGVYRVDRIE
1e3eA           YG---AAINTAKVTPGSTCAVFGLGCVGLSAIIGCKIAGASRIIAID-INGEKFPKAKALGATDCLNPRE
2dg2A           -----KAYPPTSSKSPPTVLVICGPGNNGGDGLVHLKLFGYQPTIYY-PKRPNKPLFTGLVTQCQKDIPF
2b83A           FHGAELA-----DIQMGSSVVVIGIGAVGLMGIAGAKLRGAGRIIGVGSRPICVEAAKFYGATDILNYKN
3eeqB           -----PAIVCIDDKINYVIPLLGGHWGANDIARELSVILNSTPIITKLSIERIA-NILIAKIINPENIVK
2ebjA           --LGEALEDLHREGPKAVLHLGLAEDRPVLTLERLAVNLLDFPRPDNRGRVLEDLPIVPGGPLALPARFP
3c85C           -----------INPGH-AQVLILG-GRIGTGAYDELRARYGKISLGIEIREEAAQQHRSEGRNVISGDAT
3c85D           -----LGIEINVISGDVKLVLLAPHHQGNQTALEQLQRRNYKQIAAIAEYPDQLEGLLESGVDAAFNIYS
3e48B           -------------------ILTGATGHLGTHITNQAIANHI-DHFHIGVRNVEKVPD-------------
2c29F           ------------------VCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDL--------
2cnbB           ------------------VLVCGGAGYIGSHFVRALLRDTN-HSVVIVDSLVGTHGKSDHVETRENVARK
3dxfA           ------------------VVVFGGTGAQGGSVARTLLEDGTFKVRVVTANPRKKA---------------
3e90D           ----------------------------------------------------------------------
3c3pB           DRQTGRLLYLLARIKQPQLVVVPGDGLGCASWWFARAISISSRVVIDPDRDEHARRLHDNGLIDRVELQV
3c3xA           ------------------ILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNSSKTTLLDEFQSLGAIIVK-
1b8pA           ------------------VAVTGAAGQICYSLLFRIANGDM-LGKDQPVILQLLEIPNEKAQKALQGVM-
3e90B           ----------------------------------------------------------------------
3e5mA           ------------------VVVFGGTGAQGGSVARTLLEDGTFKVRVVTRNPRKKA---------------
2cnbA           ------------------VLVCGGAGYIGSHFVRALLRDTNHSVVIVDSLVGTHGKSDHVET--------
2bllA           ------------------VLILGVNGFIGNLTERLLRE--DHYEVYGLDIGS------------------
2dknB           ------------------IAITGSASGIGALKELLA-RAGH-TVIGIDRGQADIE--------------A
3e48A           -------------------ILTGATGHLGTITNQAIAN-HI-DHFHIGVRNVEKV---------------
2dknA           ------------------IAITGSASGIGALKELLA-RAGH-TVIGIDRGQADIEADL-----STPGGRE
2e37E           ------------------VGIVGSGVGSATAYALALLGVAR-EVVLVDLDRKLAQ-----AHAEDILHAT
2c29D           ------------------VCVTGASGFIGSLVMRLLER--GYTVRATVRDPTNVKKVKHL----------
2e37D           ------------------VGIVGSGVGSAAYALALLGVAREVV--LVDLDRKLAQA----------HAED
2c20A           ------------------ILICGGAGYIGSHAVKKLVDEGLSVVVVDNLQTGHEDA--------------
2cnbC           ------------------VLVCGGAGYIGSFVRALLRD--TNHSVVIVDSLVGTHG--------------
2c5eA           ------------------ISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMT---------------
2belC           ------------------VIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQK---------------


                         .         .         .         +         .         .         .:280
query           LSEKGRPLQKGRWAGVVDSVGSHTLVNAIAQTKWGGIVTACGMAQGPDLPGTVLPFILRGVHLVGINSVD
2c0cB           EPTVLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTGLSPVKAGTLPAKLLHYLS
2b5wA           PVEDVPDVYEQMDFIYEATGFPKHAIQSVQALAPNGVGALLGVPSDWAFE-VDAGAFHREMVLHNKALVG
2cd9B           SNGYDKLKDSVGKFDVATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTIVHTNKTIIGLVNGQ
2dq4A           LEVVRRVTGSGVEVLLEFSGNEAAIHQGLMALIPGGEARILGIPSDPIRFDLAGELVMRGITAFGIAGRR
2dm6A           VNSLEEALKPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISVYNRMDQPESIIYKQLRIEGFIVYR
2eerA           QDPVSEIRRITQDAVIDLNNSEKTLSIYPYVLAKQGKYVMVGLFGAD-LKYHAPLITLNEVQFIG--SLV
2b5vA           PVEDVPDVYEQMDFIYEATGFPKHAIQSVQALAPNGVGALLGVPSDWAFEVDAGAFVLHNKALVGS--VN
1bxzA           GPIESQIMNKGVDAAIIAGGNADIMATAVKIVKPGGTIANVNYFGEGE-VLPVPRLEWGCGMAHKTGLCP
2c0cA           VGTVLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTGLSPVKVQGFFLNHYYQAA
2cdaB           SNGYDKLKDSVGKFDVITGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTIVHTNKTIIGLVNGQ
2cdbA           SNKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTIVHTNKTIIG--LVN
3b70A           LAQTIRTYTKNNLRYALDCITNVESTTFAAIGRAGGHYVSLNPFPETRKMVTTDWTLGPTIFGEGSPGSE
2eihA           PDWPKEVRRLTGGKGVVDHTGALYFEGVIKATANGGRIAIAGASSGYEGTLPFAHVFYRQLSILG--STM
2cd9A           SNGYDKLKDKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTLVHTNKTIIG--LVN
1e3lB           LDKPVQDVITELTAGGVDYSTAQTLKAAVDCTVLGWGSCTVVGAKVDMTIPTVDVILGRSINGTFFGGWK
1e3jA           AKEEERSAIGDLPNVTIDCSGNEKCITGINITRTGGTLM-LVGMGSQMVTVPLVNACAREIDIKS--VFR
2eerB           QDPVSEIRRKGADAVIDLNNSEKTLSIYPYVLAKQGKYVMVGLF-GADLKYHAPLITLNEVQFIG--SLV
2cdbC           SNGYDKLKDSVGKFDVITGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTIVHTNKTIIG--LVN
2dfvA           EDVVKDITDGNGVDVFLEFSGAKALEQGLQAVTPAGRVSLLGLYPGKVTIDFNNLIIFKALTIYGITGRH
3cosD           LHEVIIELTKGGVDFALDCAGGSETMKAALDCTTWGSCTFIGVAAGSKGLTVFPEELIIGRTINGTFFGG
1cdoA           HSEPISQVLSGVDFSLECVGNVGVMRNALESCLKGWGVSVLVGWTDLHDVATRPIQLIAGRTWKGSMFGG
1ee2A           YKKPIQEVLTEMSNGSFEVIGRLDTMVAACCQEAYGVSVIVGVPPDSQNLSMNPMLLLSGRTWKGAIFGG
1axeA           YKKPIQEVLTGGVDFSFEVIGRDTMVTALSCCQEAYGVSVIVGVPPDSNLSMNPMLLLSGRTWKGAIFGG
2cdaA           SNGYDKLKDSVGKFDVITGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTIVHTNKTIIGLVNGQ
2d8aA           EDVVKEVDINGVDVFLEFSGAPKALEQGLQAVTPAGRVSLLGLYPGKVTIDFNNLIIFKALTIYGITGRH
3b6zA           LAQTIRTYTKNNLRYALDCITESTTFCFAAIGRAGGHYVSLNPFPRKMGPTIFGEGSTWPAPYGRPGSEE
2cdbB           SNGYDKLKDSVGKFDVITGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTIVHTNKTIIG--LVN
2cf5A           --QAKMSELADSLDYVIDTVPVHHALEPYLSLLKLDGKLILMGVINNPLQFLTPLLMLGRKVITG--SFI
1d1sA           STKPISEVLSNNVGYTFEVIGETMIDALASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGG
1axgA           YKKPIQEVLTGGVDFSFEVIGRLDTMVTACCQEAYGVSVIVGVPPDSQNLSMNPMLLLSGRTWKGAIFGG
1d1tA           STKPISEVLSNNVGYTFEVIGHLETMILASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGG
3cosA           LHKPIQEVIIELTKGGVDFAGSETMKAALDCTTAGWGSCTFIGAAGSKGLTVFPEELIIGRTINGTFFGG
1a71A           YKKPIQEVLTEMSNGGVDFSRLDTMVTALCCQEAYGVSVIVGVPPDSQNLSMNPMLLLSGRTWKGAIFGG
1e3eB           LDKPVQDVITGGVDYSLDCAGTAQTLAAVDCTVLGWSCTVVGAKVDEMTIPTVDVILGRSINGTFFGGWK
2dphA           APLRDQIDQILGKPEVNTETPNGALNSLFDVVRAGGAIGIPGIYVGSDPDPVNKDAGSGRLHLDFGKMWP
1e3lA           LDKPVTELTAGGVDYSLDCAGTAQTLAAVDCTVLGWGSCTVVGAKVDMTIPTVDVILGRSINGTFFGGWK
1dlgA           TGTFLVAAAISGGKIVCRNAQPDTLDAVLAKLREAGADIETG---EDWISLDMHGKRPKAVTVRTAPHPA
1e3eA           LDKPVQDVITGGVDYSLDCAGTQTLKAAVDCTVLGGSCTVVGAKVDEMTIPTVDVILGRSINGTFFGGWK
2dg2A           L-GEPPEPVDELYELVVDAIFGFSFKGDVRESGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKK
2b83A           GHIVDQVMKGKGVDRVIMAGGSETLSQAVSMVKPGGIISNINYHGSGLIPRVEWGCGMAHKTIKGGLCPG
3eeqB           --INAALLRDESICIDGINVNFPENIKVCSYIISLRDKEYKDKIVVWLKPLKISIGIGSKKDVKM--EEI
2ebjA           VKPVLARWREAGIPGRPSLSAGSYLCNSLYRLPEEVPVGFLHLPPDETL---------------------
3c85C           DPDFWERILDTGHVKLVLLAPHQGNQTALEQLQRRNYKGQIAAIAEY--PDQLEGLLESGVDAAFNIYSE
3c85D           EA--------------------------------------------------------------------
3e48B           ----------------------------------------------------------------------
2c29F           ----------------------------------------------------------------------
2cnbB           LQQSDGPKPPWADRYAALEVGDVRNEDFLNGVFTHGPIDAVVHMCAFLAVGESVRDPLKYYDNNVVGILR
3dxfA           ----------------------------------------------------------------------
3e90D           ----------------------------------------------------------------------
3c3pB           GDPLGIAAGQRDIDILFDCDVFNDVLERNRCLAKNALLIAVNALRRENHHLSRRRDFFTTIVPVG----N
3c3xA           ----------------------------------------------------------------------
1b8pA           ----------MEIDDCAFPLLAGMTAHADPMTAFKDADVALLVGARPRGPGMERKDLLEANAQIFTVQGK
3e90B           ----------------------------------------------------------------------
3e5mA           ----------------------------------------------------------------------
2cnbA           ----------------------------------------------------------------------
2bllA           ----------------------------------------------------------------------
2dknB           DLSTPGGRETAVAAVLDRCGGVLDGLVCCAGVNSGVAVNYFGV---------------------------
3e48A           ----------------------------------------------------------------------
2dknA           TAVAAVLDR----CGGVLDGLVCCAGVGVTAANSGLVVAVNYFGVSALLDGLAEALSRGQQPAAVIVGSI
2e37E           PFAHPVWVRAGSYGDLEGARAVVLAAGVAQRPGETRLQLLDRNAQVFAQVVPVLEAAPEAVLLVATN-PV
2c29D           ----------------------------------------------------------------------
2e37D           ILHATPFAHPVWVRAGSYLEGARAVVLAAGVARLQLLDRNAQVF--AQVVPRVLEAAPEAVLLVATNPVD
2c20A           ----------------------------------------------------------------------
2cnbC           ----------------------------------------------------------------------
2c5eA           ----------------------------------------------------------------------
2belC           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           APRELRRRAWALLSEHLDTAVLDDMTTVIDVKDVAQAGEDLMAGKLHGRTAVRVH
2c0cB           KYQAAMSHLLEMCVSGDDLGDLSPEGRFTGLESIFRAVNYMYMGKNTGKIVVEL-
2b5wA           SVNSHVEHFEAATVTFTKLPKWFLEDLVTGVHPLSEFEAAFDDDDTTIKTAIEF-
2cd9B           KPHFQQAVVHLASWKTLYPKAAKMLTKTVSIND----------------------
2dq4A           LWQTWMQGTALVYSGRVDLSPL--LTHRLPLSRYREAFGLLASGQ-AVKVILDPK
2dm6A           WQGDVREKALRDLMKWVLEGKIQYHHVTKGFENMPAAFIEMLNGANLGKAVV---
2eerA           GNQSDFLGIMSLAEAGVKPMV----TKTMKLEEANEAIDNLENFKAVGRQVL---
2b5vA           SHVEHFEAATVTFTKLPKWFLEDLVTGVHPLSEFEAA---FDDDDTTIKTAIEF-
1bxzA           GGRLRMERLIDLVFYKRVDPSKLVTHVFRGFDNIEKAFMLMKDKPKDIKPVVIL-
2c0cA           MSHLLEMCVSGDLVCEVDLGDLSPEGRFTGLESIFRAVNYMYMGKNTGKIVVEL-
2cdaB           KPHFQQAVVHLASWKTLYPKAAKMLTKTVSIND----------------------
2cdbA           GQKPHFQQAVVHLASW---------------------------------------
3b70A           EERQFGEDLWRIAGQLVEDGRLVLRVVQGGFDHIKQGMELVRKGELSGEKLVVR-
2eihA           ASKSRLFPILRFVEEG---KLKPVVGQVLPLEAAAEGHRLLEERRVFGKVVLQV-
2cd9A           GQKPHFQQAVVHLASW---------------------------------------
1e3lB           SVDSVPNLVSDYKNKKFD--LDLLVTHALPFESINDAIDLMKEGKSIRTILT---
1e3jA           YCNDYPIALEMVASGRCNVKQL--VTHSFKLEQTVDAFEAARKKADNIKVMISCR
2eerB           GNQSDFLGIMSLAEAGVKPMV----TKTMKLEEANEAIDNLENFKAVGRQVL---
2cdbC           GQKPHFQQAVVHLASW---------------------------------------
2dfvA           LWETWYTVSRLLQSGKLNLDPI-ITHKYKGFDKYEEA-FELRAGKTGKVVFLK--
3cosD           WKSVDSIPKLVTDYKNKKFNLDALVTHTLPFDKISEAFDLMNQGKSIRTILI---
1cdoA           FKGKDGVPKMVKAYLDKKVKLDEFITHRMPLESVNDAIDLMKHGK-CIRTVLSL-
1ee2A           FKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFDLLRSGKSIRTILT---
1axeA           FKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFDLLRSGESIRTILT---
2cdaA           KPHFQQAVVHLASWKTLYPKAAKMLTKTVSIND----------------------
2d8aA           LWETWYTVSRLLQSGKLNLDPIIT-HKYKGFDKYEEA-FELRAGK----------
3b6zA           ERQFGEDLWRIAG-QLVEDGRLVLRVVQGGFDHIKQGMELVRKGELSGEKLV---
2cdbB           GQKPHFQQAVVHLASW---------------------------------------
2cf5A           GSMKETEEMLEFCKEKG----LSSIIEVVKMDYVNTAFERLEKNDVRYRFVVDVE
1d1sA           LKSRDDVPKLVTEFLAKKFDLDQLITHVLPFKKISEGFELLNSGQSIRTVLT---
1axgA           FKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFDLLRSGESIRTILT---
1d1tA           LKSRDDVPKLVTEFLAKKFDLDQLITHVLPFKKISEGFELLNSGQSIRTVLT---
3cosA           WKSVDSIPKLVTDYKNKKFNLDALVTHTLPFDKISEAFDLMNQGKSIRTILI---
1a71A           FKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFDLLRSGESIRTILT---
1e3eB           SVDSVPNLVSDYKNKKFD--LDLLVTHALPFESINDAIDLMKEGKSIRTILT---
2dphA           VTNYNRHLTEAILWDQMPYLSKVMNIEVITLDQAPDGYAKFDKGSP-AKFVIDPH
1e3lA           SVDSVPNLVSDYKNKKFD--LDLLVTHALPFESINDAIDLMKEGKSIRTILT---
1dlgA           FPTDMQAQFTLLNLVAEGTGVITETIFENRFMHVPELIRMGAHAEIESNTVI---
1e3eA           SVDSVPNLVSDYKNKKFDLDLL--VTHALPFESINDAIDLMKEGKSIRTILT---
2dg2A           SATHFTGRYHYLGGRFVP----PALEKKYQLNLPSYPDTECVY------------
2b83A           GRLRAEMLRDMVVYNRVDLSKLVT-HVYHGFDHIEEALLLMKDKPKDIKAVVIL-
3eeqB           RDGIYKVLERLNLKRERIGIIASIRPCLTPPKGVAEISALIAGGR-NSKLILR--
2ebjA           -------------------------------------------------------
3c85C           AGSGFARHVCKQLEPQ---------------------------------------
3c85D           -------------------------------------------------------
3e48B           -------------------------------------------------------
2c29F           -------------------------------------------------------
2cnbB           LLQAMLLHKCDKIIF----------------------------------------
3dxfA           -------------------------------------------------------
3e90D           -------------------------------------------------------
3c3pB           GVLLGYR------------------------------------------------
3c3xA           -------------------------------------------------------
1b8pA           AIDAVASRNIKVLVVG---------------------------------------
3e90B           -------------------------------------------------------
3e5mA           -------------------------------------------------------
2cnbA           -------------------------------------------------------
2bllA           -------------------------------------------------------
2dknB           -------------------------------------------------------
3e48A           -------------------------------------------------------
2dknA           AATQPGAAELPMV------------------------------------------
2e37E           DVTQVAYRLSGLPPGR---------------------------------------
2c29D           -------------------------------------------------------
2e37D           VTQVAYRLSGLP-------------------------------------------
2c20A           -------------------------------------------------------
2cnbC           -------------------------------------------------------
2c5eA           -------------------------------------------------------
2belC           -------------------------------------------------------