[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF55467.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c0lA.bssp"
#ERROR : Can't open dsspfile "3dx5A.bssp"
#ERROR : Can't open dsspfile "3bzgA.bssp"
#ERROR : Can't open dsspfile "3cqjA.bssp"
#ERROR : Can't open dsspfile "3cqiB.bssp"
#ERROR : Can't open dsspfile "3cqiA.bssp"
#ERROR : Can't open dsspfile "3cqjB.bssp"
#ERROR : Can't open dsspfile "1a0cA.bssp"
#ERROR : Can't open dsspfile "1dxiA.bssp"
#ERROR : Can't open dsspfile "3bzjA.bssp"
#ERROR : Can't open dsspfile "1a0dA.bssp"

## Summary of PDB Search
:282
    1e-08  11%  3c0lA  [x.x.x] UV ENDONUCLEASE
    3e-08  11%  3dx5A  [x.x.x] UNCHARACTERIZED PROTEIN ASBF
    3e-07  11%  3bzgA  [x.x.x] UV ENDONUCLEASE
    3e-07  14%  3cqjA  [x.x.x] L-RIBULOSE-5-PHOSPHATE 3-EPIMERASE ULAE
    2e-06  17%  3cqiB  [x.x.x] L-RIBULOSE-5-PHOSPHATE 3-EPIMERASE ULAE
    2e-05  14%  3cqiA  [x.x.x] L-RIBULOSE-5-PHOSPHATE 3-EPIMERASE ULAE
    4e-05  17%  3cqjB  [x.x.x] L-RIBULOSE-5-PHOSPHATE 3-EPIMERASE ULAE
    2e-04  11%  1a0cA  [c.1.15] XYLOSE ISOMERASE
    7e-04  11%  1dxiA  [c.1.15] D-XYLOSE ISOMERASE
    8e-04   8%  3bzjA  [x.x.x] UV ENDONUCLEASE
    8e-04   9%  1a0dA  [c.1.15] XYLOSE ISOMERASE
:282

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxIGVQMMMLKDQVAELGMYPVLEKLKELNIASVEVSQIPMNEENTAALERGISELGIEVGALSVAFGP
3c0lA           ----------------------------------------ASHPLFPYDWEGAYEEELARLGALARAFGQ
3dx5A           -----------------------VQFAYENGFEGIELWNLYQEYETTERELNCLKDKTLEITISD-YLDI
3bzgA           ----------------------------------------ASHPLFPYDWEGAYEEELARLGALARAFGQ
3cqjA           ----------------------------------------------------------------------
3cqiB           ---LGIYEKALPACWLER-----LQLAKTLGFDFVEMSVDETSREQRLALVNAIVETGVRVPSMCLSAHR
3cqiA           ----------------------------------------------------------------------
3cqjB           ---LGIYEKAL----PAGCWLERLQLAKTLGFDFVEMSRLDWSREQRLALVNAIVETGVRVPSMCLLGSE
1a0cA           ----------------------------------------KNLDTIVAMIKDYLKTSKTKVLWGT-ANLF
1dxiA           ----------------------------------------------------------------------
3bzjA           ----------------------------------------------------------------------
1a0dA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SAAPGVDSLENDFDKIVADCKRLGVKYTRIGMMPFQAMTSKEATETWAAQVEPYAARLAVEGITLCYHNH
3c0lA           RGSPDPEVVERSLAELRYSARLLSLIGAEDGVLVLHLGGAYGEKGKALRRFVENLRGEEEVLRYLALEND
3dx5A           SLSADFEKTIEKCEQLAILANWFKTNKIRTFAGKGSADFSQQERQEYVNRIRICELFAQHNYVLLETHPN
3bzgA           RGSPDPEVVERSLAELRYSARLLSLLGAEDGVLVLHLGGAYGEKGKALRRFVENLRGEEEVLRYLALEND
3cqjA           -----------IMRKAIQFAQDVGIRVIQLAGYDVYYQEANNETRRRFRDGLKESVEMASRQVTLAMEIM
3cqiB           RFPLGRAQGLEIMRKAIQFAQDVGIRVIQLYDVYYQEAN-NETRRRFRDGLKESVEMASRAQVTLAMEIM
3cqiA           ------------MRKAIQFAQDVGIRVIQLGYDVYYQEANNETRRRFRDGLKESVEMASRAQVTLAMEIM
3cqjB           DDAVRAQGLEI-MRKAIQFAQDVGIRVIQLGYDVYYQEANNETRRRFRDGLKESVEMASRAQVTLAMEIM
1a0cA           SNPRFVHGASTSCNKALEITKELGGENYREGYETLLNTDMEFELDNFARFLHMAVDYAKEIGFEGQFLIE
1dxiA           -----------KTIGNIDLAAELGAKTYVAWGGREGAESGRDALDRMKEAFDLLGEYVTAQGYDFAIEPK
3bzjA           ----------AELRYSARLLSLLGAEDGV---LVLHLGGAYGEKGKALRRFVENLRGEEEVLRYLALEND
1a0dA           ----GAENYVFWGGREGYETLLNTDMKLELDNLARFLHMAVDYAKEIGFDGQFLIEPKPKEPTKHQYDFD


                         +         .         .         .         .         *         .:210
query           HVDLHKFGNERIFDIVRRVAPSLFFEVDLHWVQRGGMAPLDMLKEYAGVCKLIHVKDFRVTELPEEAMEL
3c0lA           E---RLWNVEEVLKAAEA--LGVPVVVDTLHHALNPEEALRLAFPTWRGRPRVHLASQDP----------
3dx5A           TLTDTLPSTLELLGEVD--HPNLKINLDFLHIWESGADPVDSFQQLRPWIQHYHFKNISS----ADYLHV
3bzgA           E---RLWNVEEVLKAAEA--LGVPVVVDTLHHALNPEEALRLAFPTWRGRPKVHLASQDP----------
3cqjA           DYPLMNSISKALGYAHYLNNPWFQLYPDIGNLSAWDNDVQMELQAGIGHIVAVHVKDTKPGV--------
3cqiB           DYPLMNSISKALGYAHYLNNPWFQLYPDIGNLSAWDNDVQMELQAGIGHIVAVHVKDTK-----------
3cqiA           DYPLMNSISKALGYAHYLNNPWFQLYPDIGNLSAWDNDVQMELQAGIGHIVAVHVKDTKPGV--------
3cqjB           DYPLMNSISKALGYAHYLNNPWFQLYPDIGNLSAWDNDVQMELQAGIGHIVAVHVKDTKPGV--------
1a0cA           PKPKEPTKHANVLAFLRKYDLDKYFKVNIEANHLAFHDFQHELRYARINGVLGSIDANTGDMLLGW-DTD
1dxiA           PNDILLPTVGHALAFIERLERPELYGVEVGHEQMAGLNFPHGIAQALWAGKLFHIDLNGQSGIKYDQDLR
3bzjA           E---RLWNVEEVLKAAEALGVPVVVDTLHHALNPGRLPLEEALRLTWRGRPLVHLASQDPK---------
1a0dA           VATALAFLQTY------GLKDYFKFNIEANHATLAGHTFEHELRVARIHGMLGSVDANQGD-MLLGWDTD


                         .         .         .         +         .         .         .:280
query           FTAGDFMKGYEKFVNIVEFAEVGQGNMNWPELLPASKAAGAEYFFIEQDMTYGRDPFDCIKDSREYLTSI
3c0lA           ----------------KKRPGAHAFRVTREDWERLLSALPGPADVM------------------------
3dx5A           FEPNNVYAAAGNRT----GVPLFEGIVNYDEIIQEVRDTDHFASLE------------------------
3bzgA           ----------------KKRPGAHAFRVTREDWERLLSALPGPADVM------------------------
3cqjA           ----------------FKNVPFGEGVVDFERCFETLKQSGYCPYLIEMWSETAEDPAAEVAKARDWV---
3cqiB           -------------PFKNVP--FGEGVVDFERCFETLKQSGYCPYLIEMWSETAEDPAAEVAKARDWV---
3cqiA           --------------FKNVP--FGEGVVDFERCFETLKQSGYCPYLIEMWSETAEDPAAEVAKARDWV---
3cqjB           --------------FKNVP--FGEGVVDFERCFETLKQSGYCPYLIEMWSETAEDPAAEVAKARDWV---
1a0cA           QFPTDIRMTTLAMYEVIKMGGFDKGGLNFDAKVRRASFEPEDLFLGHIAG--------------------
1dxiA           F--------------------GAGDLRAAFWLVDLLETAGYEPRHFDFKPPRTEDFDGVWASAAGCMRNY
3bzjA           -----------------KRPGAHAFRVTREDWERLLSALPGPADVM------------------------
1a0dA           EFPTDLYSTTLAMYEILKNGGLGRGGLNF-----------------------------------------


                         .         *         .         .         .         .         +:350
query           xx
3c0lA           --
3dx5A           --
3bzgA           --
3cqjA           --
3cqiB           --
3cqiA           --
3cqjB           --
1a0cA           --
1dxiA           --
3bzjA           --
1a0dA           --