[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF55672.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1e6eC.bssp"
#ERROR : Can't open dsspfile "1cjcA.bssp"
#ERROR : Can't open dsspfile "2c7gA.bssp"
#ERROR : Can't open dsspfile "2ejrA.bssp"
#ERROR : Can't open dsspfile "1e6eA.bssp"
#ERROR : Can't open dsspfile "2dw4A.bssp"
#ERROR : Can't open dsspfile "3ctyB.bssp"
#ERROR : Can't open dsspfile "3d4oC.bssp"
#ERROR : Can't open dsspfile "3dk9A.bssp"
#ERROR : Can't open dsspfile "2a87A.bssp"
#ERROR : Can't open dsspfile "2a87B.bssp"
#ERROR : Can't open dsspfile "3d4oB.bssp"
#ERROR : Can't open dsspfile "3ctyA.bssp"
#ERROR : Can't open dsspfile "3d4oA.bssp"
#ERROR : Can't open dsspfile "1b73A.bssp"
#ERROR : Can't open dsspfile "2dldA.bssp"
#ERROR : Can't open dsspfile "2bc0A.bssp"
#ERROR : Can't open dsspfile "2cduB.bssp"
#ERROR : Can't open dsspfile "3eanC.bssp"
#ERROR : Can't open dsspfile "2drvA.bssp"
#ERROR : Can't open dsspfile "1cl0A.bssp"
#ERROR : Can't open dsspfile "3eanF.bssp"
#ERROR : Can't open dsspfile "1bhyA.bssp"
#ERROR : Can't open dsspfile "3eanA.bssp"
#ERROR : Can't open dsspfile "3d1cA.bssp"
#ERROR : Can't open dsspfile "1djnA.bssp"
#ERROR : Can't open dsspfile "3coxA.bssp"
#ERROR : Can't open dsspfile "2e4gB.bssp"
#ERROR : Can't open dsspfile "2a8xA.bssp"
#ERROR : Can't open dsspfile "3cukA.bssp"
#ERROR : Can't open dsspfile "2cfyA.bssp"
#ERROR : Can't open dsspfile "1b37A.bssp"
#ERROR : Can't open dsspfile "3cnjA.bssp"
#ERROR : Can't open dsspfile "2bk4B.bssp"
#ERROR : Can't open dsspfile "1cc4A.bssp"
#ERROR : Can't open dsspfile "1d7yA.bssp"
#ERROR : Can't open dsspfile "1cc6A.bssp"
#ERROR : Can't open dsspfile "3b3rA.bssp"
#ERROR : Can't open dsspfile "3bh1C.bssp"
#ERROR : Can't open dsspfile "1bgjA.bssp"
#ERROR : Can't open dsspfile "3cmmC.bssp"
#ERROR : Can't open dsspfile "3cp8A.bssp"
#ERROR : Can't open dsspfile "1an9A.bssp"
#ERROR : Can't open dsspfile "1ebdA.bssp"
#ERROR : Can't open dsspfile "1dncA.bssp"
#ERROR : Can't open dsspfile "3cgcA.bssp"
#ERROR : Can't open dsspfile "2b76M.bssp"
#ERROR : Can't open dsspfile "3cgvA.bssp"
#ERROR : Can't open dsspfile "2amfC.bssp"
#ERROR : Can't open dsspfile "1cj3A.bssp"
#ERROR : Can't open dsspfile "2e4gA.bssp"
#ERROR : Can't open dsspfile "2dpoA.bssp"
#ERROR : Can't open dsspfile "1bgnA.bssp"
#ERROR : Can't open dsspfile "1djqA.bssp"
#ERROR : Can't open dsspfile "1d7lA.bssp"
#ERROR : Can't open dsspfile "1bzlA.bssp"
#ERROR : Can't open dsspfile "1b37B.bssp"
#ERROR : Can't open dsspfile "3cpiH.bssp"
#ERROR : Can't open dsspfile "1cj4A.bssp"
#ERROR : Can't open dsspfile "2bc1A.bssp"
#ERROR : Can't open dsspfile "3eanD.bssp"
#ERROR : Can't open dsspfile "3dc2A.bssp"
#ERROR : Can't open dsspfile "3djeB.bssp"
#ERROR : Can't open dsspfile "3bg7A.bssp"
#ERROR : Can't open dsspfile "2apgA.bssp"
#ERROR : Can't open dsspfile "2c75A.bssp"
#ERROR : Can't open dsspfile "3ed8C.bssp"
#ERROR : Can't open dsspfile "3djdB.bssp"
#ERROR : Can't open dsspfile "2c72B.bssp"
#ERROR : Can't open dsspfile "1bf3A.bssp"
#ERROR : Can't open dsspfile "3bg6A.bssp"
#ERROR : Can't open dsspfile "2c75B.bssp"
#ERROR : Can't open dsspfile "2bhtB.bssp"
#ERROR : Can't open dsspfile "3dojA.bssp"
#ERROR : Can't open dsspfile "3d1lB.bssp"

## Summary of PDB Search
:455
    2e-25  33%  1e6eC  [c.4.1 - c.3.1] NADPH\:ADRENODOXIN OXIDOREDUCTASE
    1e-21  33%  1cjcA  [c.4.1 - c.3.1] PROTEIN (ADRENODOXIN REDUCTASE)
    6e-19  37%  2c7gA  [x.x.x] NADPH-FERREDOXIN REDUCTASE FPRA
    3e-17  12%  2ejrA  [x.x.x] LYSINE-SPECIFIC HISTONE DEMETHYLASE 1
    5e-15  33%  1e6eA  [c.4.1 - c.3.1] NADPH\:ADRENODOXIN OXIDOREDUCTASE
    6e-13  12%  2dw4A  [x.x.x] LYSINE-SPECIFIC HISTONE DEMETHYLASE 1
    1e-11  15%  3ctyB  [x.x.x] THIOREDOXIN REDUCTASE
    2e-11  13%  3d4oC  [x.x.x] DIPICOLINATE SYNTHASE SUBUNIT A
    2e-11  13%  3dk9A  [x.x.x] GLUTATHIONE REDUCTASE
    2e-11  17%  2a87A  [x.x.x] THIOREDOXIN REDUCTASE
    9e-11  19%  2a87B  [x.x.x] THIOREDOXIN REDUCTASE
    9e-11  11%  3d4oB  [x.x.x] DIPICOLINATE SYNTHASE SUBUNIT A
    2e-10  15%  3ctyA  [x.x.x] THIOREDOXIN REDUCTASE
    3e-10  12%  3d4oA  [x.x.x] DIPICOLINATE SYNTHASE SUBUNIT A
    2e-09  12%  1b73A  [c.78.2 - c.78.2] GLUTAMATE RACEMASE
    3e-09  11%  2dldA  [c.23.12 - c.2.1] D-LACTATE DEHYDROGENASE
    4e-09  16%  2bc0A  [x.x.x] NADH OXIDASE
    2e-08  17%  2cduB  [x.x.x] NADPH OXIDASE
    2e-08  10%  3eanC  [x.x.x] THIOREDOXIN REDUCTASE 1
    4e-08  10%  2drvA  [x.x.x] UPF0130 PROTEIN PH1069
    6e-08  15%  1cl0A  [c.3.1 - c.3.1] THIOREDOXIN REDUCTASE
    1e-07  11%  3eanF  [x.x.x] THIOREDOXIN REDUCTASE 1
    2e-07  16%  1bhyA  [x.x.x] P64K
    7e-07  12%  3eanA  [x.x.x] THIOREDOXIN REDUCTASE 1
    1e-06  16%  3d1cA  [x.x.x] FLAVIN-CONTAINING PUTATIVE MONOOXYGENASE
    1e-06  12%  1djnA  [c.1.4 - c.4.1 - c.3.1] TRIMETHYLAMINE DEHYDROGENASE
    5e-06  12%  3coxA  [x.x.x] CHOLESTEROL OXIDASE
    7e-06  13%  2e4gB  [x.x.x] TRYPTOPHAN HALOGENASE
    7e-06  12%  2a8xA  [x.x.x] DIHYDROLIPOYL DEHYDROGENASE
    9e-06  11%  3cukA  [x.x.x] D-AMINO-ACID OXIDASE
    1e-05   6%  2cfyA  [x.x.x] THIOREDOXIN REDUCTASE 1[MASQUE : MEMB(X) 44 / COIL(x)
    1e-05  17%  1b37A  [c.3.1 - d.16.1] PROTEIN (POLYAMINE OXIDASE)
    2e-05  10%  3cnjA  [x.x.x] CHOLESTEROL OXIDASE
    2e-05  17%  2bk4B  [x.x.x] AMINE OXIDASE [FLAVIN-CONTAINING] B
    2e-05  22%  1cc4A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    2e-05  14%  1d7yA  [c.3.1 - c.3.1 - d.87.1] FERREDOXIN REDUCTASE
    3e-05  20%  1cc6A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    4e-05  12%  3b3rA  [x.x.x] CHOLESTEROL OXIDASE
    5e-05   8%  3bh1C  [x.x.x] UPF0371 PROTEIN DIP2346
    5e-05  25%  1bgjA  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    6e-05  13%  3cmmC  [x.x.x] UBIQUITIN-ACTIVATING ENZYME E1 1
    6e-05  10%  3cp8A  [x.x.x] TRNA URIDINE 5-CARBOXYMETHYLAMINOMETHYL
    6e-05  19%  1an9A  [c.4.1 - d.16.1] D-AMINO ACID OXIDASE
    8e-05  11%  1ebdA  [c.3.1 - c.3.1 - d.87.1] DIHYDROLIPOAMIDE DEHYDROGENASE
    9e-05  14%  1dncA  [x.x.x] GLUTATHIONE REDUCTASE
    1e-04  13%  3cgcA  [x.x.x] PYRIDINE NUCLEOTIDE-DISULFIDE OXIDOREDUCTASE,
    1e-04  11%  2b76M  [x.x.x] FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
    1e-04  16%  3cgvA  [x.x.x] GERANYLGERANYL REDUCTASE RELATED PROTEIN
    2e-04  12%  2amfC  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
    2e-04  18%  1cj3A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    2e-04  20%  2e4gA  [x.x.x] TRYPTOPHAN HALOGENASE
    2e-04  18%  2dpoA  [x.x.x] L-GULONATE 3-DEHYDROGENASE
    2e-04  18%  1bgnA  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    3e-04  13%  1djqA  [c.1.4 - c.4.1 - c.3.1] TRIMETHYLAMINE DEHYDROGENASE
    3e-04  27%  1d7lA  [c.3.1 - d.16.1] P-HYDROXYBENZOATE HYDROXYLASE
    3e-04  12%  1bzlA  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE (OXIDIZED
    3e-04  17%  1b37B  [c.3.1 - d.16.1] PROTEIN (POLYAMINE OXIDASE)
    4e-04  30%  3cpiH  [x.x.x] RAB GDP-DISSOCIATION INHIBITOR
    4e-04  35%  1cj4A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    4e-04  23%  2bc1A  [x.x.x] NADH OXIDASE
    4e-04  12%  3eanD  [x.x.x] THIOREDOXIN REDUCTASE 1
    4e-04  17%  3dc2A  [x.x.x] D-3-PHOSPHOGLYCERATE DEHYDROGENASE
    5e-04  18%  3djeB  [x.x.x] FRUCTOSYL AMINE: OXYGEN OXIDOREDUCTASE
    5e-04  13%  3bg7A  [x.x.x] PYRANOSE OXIDASE
    5e-04  15%  2apgA  [x.x.x] TRYPTOPHAN HALOGENASE PRNA
    5e-04  20%  2c75A  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    5e-04   7%  3ed8C  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    6e-04  20%  3djdB  [x.x.x] FRUCTOSYL AMINE: OXYGEN OXIDOREDUCTASE
    6e-04  26%  2c72B  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    7e-04  17%  1bf3A  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    7e-04  19%  3bg6A  [x.x.x] PYRANOSE OXIDASE
    8e-04  21%  2c75B  [x.x.x] AMINE OXIDASE (FLAVIN-CONTAINING) B
    9e-04  16%  2bhtB  [x.x.x] CYSTEINE SYNTHASE B
    0.001  18%  3dojA  [x.x.x] DEHYDROGENASE-LIKE PROTEIN
    0.001  15%  3d1lB  [x.x.x] PUTATIVE NADP OXIDOREDUCTASE BF3122
:455

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSRPLRVAVVGAGPAGIYASDLLMKSDTDVQIDLFERMPAPFGLIRYGVAPDHPRIKGIVKSLHNVMDKE
1e6eC           --QTPQICVVGSGPAGFYTAQHLLKHHSRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSD
1cjcA           -----QICVVGSGPAGFYTAQHLLKHHSRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSD
2c7gA           --RPYYIAIVGSGPSAFFAAASLLKEDLDMAVDMLEMLPTPWGLVRSGVAPDQPKIKSISKQFEKTAEDP
2ejrA           -----KVIIIGSGVSGLAAARQLQSFGMDVTL--LEARDRVGGRVATFRKGNYVADLGA----MVVTG--
1e6eA           --QTPQICVVGSGPAGFYTAQHLLKHHSRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSD
2dw4A           -----KVIIIGSGVSGLAAARQLQSFGMDVTL--LEARDRVGGRVATFRKGNYVADLGA-----MVVTGL
3ctyB           ----FSVAILDKAVAGGLTAEAP-------------LVENYLGFKSIVGSELAKLFADHAANYAKIREGV
3d4oC           ---GKHVVIIGGDARQLEIIRKLSTFDAKI--SLVGFDQLDDGFIGVTKRIDEVDWNTVDAILLPISGTE
3dk9A           -----TCVNVGCVPKKVMWNTAVHSEFMHDHADYGFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKS
2a87A           --PVRDVIVIGSGPAGYTAA--LYAARAQLAPLVFEGTSFGGALMTTTDVENYPGFRNLMDEMREQALRF
2a87B           -----DVIVIGSGPAGYTAA--LYAARAQLAPLVFEGTSFGGALMTTTDVENYPGFRNLMDEMREQALRF
3d4oB           ----KHVVIIGGDARQLEIIRKLSTFDAKISLVGFDQLDGFIGVTKRIDEVDWN-TVDAILLPISGTNEA
3ctyA           ----FSVAILDKAVAGGLTAEAP-------------LVENYLGFKSIVGSELAKLFADHAANYAKIREGV
3d4oA           ---GKHVVIIGGDARQLEIIRKLSTFDAKISLVGFDQLDFIGVTKRI-DEVDWNTVDAILLPISGTNEAG
1b73A           ----MKIGIFDSGVGGLTVLKAIRNRYRKVDI--VYLGDTARV--PYGIRSKDTIIRYSLECAGFLKDKG
2dldA           MTKV---FAYAIRKDEEPFLNEWKEAHKDIDV--DYTDKLLTPETAKLAKGADGVVLDYTADTLQALADA
2bc0A           -RWGSKIVVVGANHAGTACIKTMLTNYGDANE--IVVFDQNSNISFLGLFYSDKEELESLGAKVYMESPV
2cduB           ----MKVIVVGCTHAGTFAMNDNISFLSGIALYLGKEIKNNDPRGLFYSSPEELSNLGANVQMRHQVTN-
3eanC           --FVTPTPLGTRWGLGGTCVLMHQAALLGQALKDSRNYGWKLEDTVKHDWEKMTESVQNHIGSLNWGYRV
2drvA           -----RSPILHVGAKTLEDAVKLVNLAVSCGF--KYSNIKSILIVEI---RSTERDVLLGENGEIFVGEE
1cl0A           -TKHSKLLILGSGPAGYTAAVYAARANLQPVL--ITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMH
3eanF           --FVTPTPLGTRWGLGGTCVNVGLMHQAALLGQALKDSRNYGWKLEDTVKHDWEKMQNHIGSLNWGYRVA
1bhyA           ------VVVLGGGPGGYSAAFAAADEGLKVAI--VERYKTLGGVCLNVG-CIPSKALLHNAAVIDEVRHL
3eanA           --FVTPTPLGTRWGLGGTCVNVGCIPKKLMAALLGQALKDSRNYGWKLEDTVKHDWEKMTESVQNHIGSL
3d1cA           -----DVIILEKGTVGHSKHWPKSTRTITPSFTSNGFGPDNAISPAFTFNEEHISGETYAEYLQVVANHY
1djnA           ------------------------------------------------------YHRDYRETQITKLLKK
3coxA           ------ALVIGSGYGGAVAALRL--TQAGIPTQIVEMGRSWDTPGSDGKIFCGMLNPDKRSMWLADKTDQ
2e4gB           -GKIDKILIVGGGTAGWMAASYLGKALQGTAITLLQAPDIPTLGVGEATIPNLQTAFFDFLGIPEDEWMR
2a8xA           ------VVVLGAGPGGYVAAIRAAQLGLSTAI--VEPKYWGGVCLNVGCIPSKALLRNA-ELVHIFTKDA
3cukA           ----MRVVVIGAGVIGLSTALCIHERYHSVLQ--PLDIKVYADRFTPLTTTDVAAGLWLPQEADWSQQTF
2cfyA           --FVTPTPLGTRWGLGGTCVLMHQAALLGQALQDSRNYGWKVEETVKHDWDRMIEAVQNHIGSLNWGYRV
1b37A           -----RVIVVGAGMSGISAAKRLSEAGITDLL--ILEATDHIGGRMHKTNFAGINV--ELGANWVEGVNG
3cnjA           ------AVVIGTGYGAAVSALRLGEAGVQTL--MLEMGQLWNQPGPDG-NIFCGMLNPDKRSSWFKNRTE
2bk4B           -----DVVVVGGGISGMAAAKLLHDSGLNVVV--LEARDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNLR
1cc4A           -----QVAIIGAGPSGLLLGQLLHKAGIDNVI--LERQTPDYVLGRIR-AGVLEQGMVDLLREAGVDRRM
1d7yA           -----PVVVLGAGLASVSFVAELRQA--GYQGLITVVGDEAERPYDRPPLSKDFMAHGDAEKIRLDCKRA
1cc6A           -----QVAIIGAGPSGLLLGQLLHKAGIDNV--ILERQTPDYVLGRIR-AGVLEQGMVDLLREAGVDRRM
3b3rA           ------AVVIGTGYGAAVSALRL--GEAGVQTLMLEMGQLWNQPGPDGNIFCGMLNPDK-RSSWFKNRTE
3bh1C           ----------------------------------------------------------------------
1bgjA           -----QVAIIGAGPSGLLLGQLLHKAGIDNVI--LERQTPDYVLGRIR-AGVLEQGMVDLLREAGVDRRM
3cmmC           -----NVLILGLKGLGVEIAKNVVLAGVKS-MTVFDPEPVQLADLSTQFFLTEKDIG---QKRGDVTRAK
3cp8A           ------VIVVGAGHAGCEAA--LAVARGGLHCLLITSDLSAVARMSCNPAIGG-VAKGQITREIDALGGE
1an9A           ----MRVVVIGAGVIGLSTA--LCIHERYHSVLQPLDVKVYADRFTPFTTTDVA----------------
1ebdA           ----QKVTIVEKGNLGGVCGCIPSKALISASHRYEQAKHSEEMGIKAENVTIDFAKVQEWKVKKLTGGVE
1dncA           ---------VGVPKKVMWNTAVHSE-----FMHDHADYGFPSCEGKFNWRKRDAYVSRLNAIYQNNLTKS
3cgcA           ----MNYVIIGGDAAGMSAAMQIVRNDENANVVTLEKGAIASTEKLIARNVKTFRDKYGIDAKVRHEVTK
2b76M           -----DTVAGGDWLCEQDVVDYFVHHCPTEMTQLELRRFGGMKIERTWFAADKTGFHMLHTLFQTSLQFP
3cgvA           ------VLVVGGGPGGSTAARYAAKYGLKTLI--EKRPEIGSPVRCGEGLSKGILNEADIKADRSFIANE
2amfC           ----------------------------------------------------------------------
1cj3A           -----QVAIIGAGPSGLLLGQLLHKAGIDNVI--LERQTPDEVLGRIRAGVLEQ-GMVDLLREAGVDRRM
2e4gA           --KIDKILIVGGGTAGWMAASYLGKALQGTADITLLQAPDIPTLGVGEATIPN-----------------
2dpoA           -----DVLIVGSGLVGRSWAMLFASGGFRVKL--YDIEPRQITGALENIRK-------------------
1bgnA           -----QVAIIGAGPSGLLLGQLLHKAGIDNV--ILERQTPDYVLGRIR-AGVLEQGMVDLLREAGVDRRM
1djqA           ----------------------------------------------------------------------
1d7lA           -----QVAIIGAGPSGLLLGQLLHKAGIDNVI--LERQTPDYVLGRIRAGVLEQGMVDLLREAGVDR---
1bzlA           MSKIFDLVVIGAGSGGLEAA--WNAATLYKKRVAVIDVQMVHGPPFFSALGGTCVNVGCVPKKLM-VTGA
1b37B           -----RVIVVGAGMSGISAAKRLSEAGITDLL-ILEATDHIGGRMHKTNFAGINVELGAN---WVEGVNG
3cpiH           IDTDYDVIVLGTGITECILSGLL-----------------------------------------------
1cj4A           -----QVAIIGAGPSGLLLGQLLHKAGIDNVILERTTPD-------------------------------
2bc1A           -RWGSKIVVVGANHAGTACIKTMLTNYGDANE--------------------------------------
3eanD           --FVTPTPLGTRWGLGGTCVGCIPKKLMHQAALLGQALKDSRNYGWKLEDTVKHDWEKMTESVQNHIGSL
3dc2A           ----------------------------------------------------------------------
3djeB           VTKSSSLLIVGAGTWGTSTALHLARRGYTNVTVLDPYPV-------------------------------
3bg7A           MDIKYDVVIVGSGPIGCTYA--RELVGAGYKVAMFDIGEIDSGLKIGAKNTVEYQKNIDKFVNVIQGQLM
2apgA           -----NIVIVGGGTAGWMASYLVRALQQQANITLIESAAIPRIGVGEATIPSLQFFDFLGIPEREWMPQV
2c75A           -----DVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILR
3ed8C           ----------------------------------------------------------------------
3djdB           VTKSSSLLIVGAGTWGTSTALHLARRGYTNVT-VLDPYPVP-----------------------------
2c72B           -----DVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLR-----------------------
1bf3A           -----QVAIIGAGPSGLLLGQLLHKAGIDNVI--LERQTPDYVLGKIRAGVLEQGMVDLLREAGVDRRMA
3bg6A           MDIKYDVVIVGSGPIGCTYA--RELVGAGYKVAMFDIGEIDSGLKIGAHKKNTV----------------
2c75B           -----DVVVVGGGISGMAAAKLLHDSGLNVVV--LEARDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRI
2bhtB           ------LIEATSGNTGIALAMIAALKGYRMKLLMPDNRRA--AMRAYG-AELIEGARDEMANRGEGKLLD
3dojA           ----------------------------------------------------------------------
3d1lB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QLRFLGNIEVGKDITVEELREFYDAIVFSTGATGDQDLRVPGSDLEGSWGAGEFVGFYDGNPNFERNWDL
1e6eC           RCAFYGNVEVGRDVTVQELQDAYHAVVLSYGAEDHQALDIPGEELPGVFSARAFVGWYNGLPENRLAPDL
1cjcA           RCAFYGNVEVGRDVTVQELQDAYHAVVLSYGAEDHQALDIPGEELPGVFSARAFVGWYNGLPENRELADL
2c7gA           RFRFFGNVVVGEHVQPGELSERYDAVIYAVGAQSDRMLNIPGEDLPGSIAAVDFVGWYNAHPHFEQVSPD
2ejrA           -LGGNPMAVVSKQVNMELKIKQKCPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHNNKPVSLGQALE
1e6eA           RCAFYGNVEVGRDVTVQELQDAYHAVVLSYGAEDHQALDIPGEELPGVFSARAFVGWYNGLPERELAPDL
2dw4A           GGNPMAVVSKQVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLNVLNNKPVSLGQAQL
3ctyB           EVRSIKKTQGGFDIETNDDTYHAKYVIITTGTT-HKHLGVKGESEYFGKGTSYCSTCD--------GYLF
3d4oC           AGKVDTIFSNESIVLTEEIEKTPNHCVVYSGISNTYLNQCKKTNRTLVKLERDDIAIYNSIP--------
3dk9A           HIEIIRGSDPKPTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGF-----------FQLEE
2a87A           GADLRMEDVESVSLTADGQTHRARAVIL---AMGAAARYLQV------PGEQELLGRGVSSCATCDGFFF
2a87B           GADLRMEDVESVSLHGPLKSHRARAVILAMGAAA-RYLQVPGEQ--------ELLGRGVSSCATCDGFFF
3d4oB           GKVDTIFSNESIVLTEEIEKTPNHCVVYSGISNTYLNQCKKTNRTLVKLERDDIAIYNSIPTAEGTIFTI
3ctyA           EVRSIKKTQGGFDIETNDDTYHAKYVIITTGTTH---------KHLGVKGESEYFGKGTSYCSTCDGYLF
3d4oA           KVDTIFSNESIVLTEEIEKTPNHCVVYSGISNTYLNQCKKTNRTLVKLERDDIAIPTAEGTIAIQHTDFT
1b73A           VDIIVVACNTASAYALERLKKEINVPVFGVIEPGVKEALKKSRNKKIGVIGTPATVKSG-----------
2dldA           GVTKMSLRNVGVDIDMDKAKELGFQITNVPVYSPNAIAEHAAIQAARVLRQDKRMDEKDLRWAPTIGREV
2bc0A           QSIDYDAKTVTALVDGKNHVETYDKLIFATGS-QPILPPIKGAEIKEGSLEFFVKLYQNSADVIAKLENK
2cduB           VDPETKTIKVKDLITNEEKTEAYDKLIMTTGSK-PTVPPIPGID-----SSRVYLCKNYNDAKKLFEEAP
3eanC           ALREKKVVYENAYGKFIGPHKIMATNNKGKEKVYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPY
2drvA           YLNKIVEIANRFKEKLKRLESKINAL--------------------------------------------
1cl0A           EHATKFETEIIFDHINKVDLQNRPFRLNGDNGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATFY
3eanF           LREKKVVYENAYGKFIGPHKIMAT-NNKGKEKVYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPY
1bhyA           AANGIKYPEPELDIDMLRAYKDGVVSRLTGGLAGMAKSRKVDVIQGDGQ---------------------
3eanA           NWGYRVALREKKVVYENAYGKFIGPHKIMATNNKGKEKVYSAERFLIATGERPRYLGIPGDKEYLFSLPY
3d1cA           ELNIFENTVVTNIYTIATTTETYHAYIFVATGDYNFPKKPFKYGIHYSEIE--------------DFDNF
1djnA           NKESQLALGQKPMTADDVLQYGADKVIIATGAR-WNTDGTNCLTHDPIPGADASLPDQLTPEQVMDGKKK
3coxA           PVSNFMGFGINKSID--RYVGVLDSERF-SGIKVYQGRGVGGGSL---VNGGMAVTPKRNYFEEILPSVD
2e4gB           ECNASYKVAIKFINWRTAGEGTSE----------------------------------------------
2a8xA           KAFGISGEVTFDYGIAYDRSRKVAEGRVAGVHFLKKNKITEIHGYGTFADANTLLVD-------------
3cukA           DYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPRELDMFPD---------------
2cfyA           ALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPY
1b37A           GKMNPIWPIVNSTLKLRNFRSDFDYLA-------------------------------------------
3cnjA           APLGSFLWLDVVNRNIDPYAGVLDRVNY------------------------------------------
2bk4B           LAKELGRLIHHVKGKSYPFRGPFPPVWNPITYMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTE
1cc4A           ARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEARE---------------------
1d7yA           PEAQSFDPQAHTVALSDGRTLPYGTLVLATGAA-PRALPTLQGATMPVHTLRTLE-----DARRIQAGLR
1cc6A           ARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREASGATTVYQ------------
3b3rA           APLGSFLWLDVVNRNIDPYAGVLDRVNYGGGSLVNGGMAVEPKRSYFEEILPRVDSSEMYDRYFPRANS-
3bh1C           --EMQSQHIRERREALGGKLYLMGGKLFDDMHASRV---LPGFTPDNKIAMLDRIKDEVEILVCINAKDL
1bgjA           ARDGLVHEGVEIAFAGQRRRIDL-----------------------------------------------
3cmmC           LAELNAYVPVDSLDDVTQLSQFQVVVATDTVSLEDKVKINEFCHSSG-------IRFISSET-----RGL
3cp8A           MGKAIDATGIQFRMLNRSKGPAMHSPRAQADKTQYSLYMRRIVEHEPNIDLLQDTVIGVSANSGKFSSVT
1an9A           ----------------------------------------------------------------------
1ebdA           GLLKGNKVEIVKGEAYFVDANTVRVVNGDSAQTYTFKNAIIATGSRPIELPNFKFSNRILDSTGALNLGE
1dncA           HIEIIRGHAAFTSIEVSGKKYTAPHILIATGGM-PSTPHESQIPGA------SLGITSDG----FFQLEE
3cgcA           VDTEKKIVYAEHTKTKDVFEFSYDRLLIATGVR-PVMPEWEGRDLQGVHL---LKTIPDAERILKTLETN
2b76M           QIQRFDEHFVLDILVDDGHVRGLVAMNMMEGATGGAGRVYRYNTNGGIVTGDGMGMALSHGVPLRDMEFV
3cgvA           VKGARIYGPSEKRPIRDKFDKHLAALAAKAGADVWVKSPALGVIKENGKVAGAKIRHNNEIVDVRA----
2amfC           ----------------------------------------------------------------------
1cj3A           ARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREASGATTVYQAAEVRLHDLQG-
2e4gA           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
1bgnA           ARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREASGATTVYQAAEVRLHDLQG-
1djqA           ------ALGQKPMTADDVLQYGADKVIIATGAR-WNTDGTNCLTHDPIPGADASLPDQLTPEQVMDGKKK
1d7lA           ----------------------------------------------------------------------
1bzlA           QYMEHLRESAGFGWEFDRTTLRAEWKNLIAVKDEAVLNINKSYDEMFRDTEGLEFFL-------------
1b37B           GKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDY----------------------------
3cpiH           ----------------------------------------------------------------------
1cj4A           ----------------------------------------------------------------------
2bc1A           ----------------------------------------------------------------------
3eanD           NWGYRVALREKKVVYENAYGKFIGPHKIMATNNKGKEKVYSAERFLIATGERPRYLGIPGDKEYLFSLPY
3dc2A           KLKIVARAGVGLDVDVDAATAVVNAPTSNIHSAAEHALALLLAASRQIPAADASLREHTWKRSSFSGTEI
3djeB           ----------------------------------------------------------------------
3bg7A           SVSVPVNTLVVDTLSPTSWQASTFFVRNGSNPEQDPLRNLSGQAVTRVVGGMS-THWTCATPRF------
2apgA           NGAFKAAIKFVNWRKSPDPSRDDHFYHLFGNVPNCDGVPLTHYWLRKFQQPMEYACYPQPGALDGKLAPC
2c75A           LAKELG----------------------------------------------------------------
3ed8C           ----------------------------------------------------------------RYPDHM
3djdB           ----------------------------------------------------------------------
2c72B           ----------------------------------------------------------------------
1bf3A           R-DGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREASGATTVYQAAEVRLHDLQG-
3bg6A           ----------------------------------------------------------------------
2c75B           LLAKELGLETYKVNEVERLIHHVKGKSY------------------------------------------
2bhtB           QFNNPDNPKAHYTTTGQQTGGRITHFVSSMGTTGT-----------------------------------
3dojA           ---------------------------------------------------------------------S
3d1lB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           SAEKVAVVGVGNVALDVARILAKTGDELLVTEIPDNVYESLAKNQAKEVHVFGRRGPAQAKFTPLELKEL
1e6eC           SCDTAVILGQGNVALDVARILLTPPDHLEKTDITEAALGALRQSRVKTVWIVGRRGPLQVAFTIKELREM
1cjcA           SCDTAVILGQGNVALDVARILLTPPDHLEKTDITEAALGALRQSRVKTVWIVGRRGPLQVAFTIKELREM
2c7gA           LSGAAVVIGNGNVALDVARILLTDPDVLARTDIADHALESLRPRGIQEVVIVGRRGPLQAAFTTLELREL
2ejrA           VVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEDITAEFLVKSKHRDLTALC
1e6eA           SCDTAVILGQGNVALDVARILLTPPDHLEKTDITEAALGALRQSRVKTVWIVGRRGPLQVAFTIKELREM
2dw4A           QEKHVKDEQIEHWKKIVKTQEELLKEKIKELHTAEFLVKSKHRDLTALCKEYDELAETQGKLEE-KLQEL
3ctyB           KGKRVVTIGGGNSGAIAAISMSEYVKNVTIIEYMPKYMCENAYVQEIKKR--------------------
3d4oC           ----------------------------------------------------------------------
3dk9A           LPGRSVIVGAGYIAVEMAGILSALGSKTSLMI--------------------------------------
2a87A           RDQDIAVIGGGDSAMEEATFLTRFARSVTLVHRRD-----------------------------------
2a87B           RDQDIAVIGGGDSAMEEATFLTRFARSVTLVHRRDEF---------------------------------
3d4oB           HGANVAVLGLGRVGSVARKFAALGAKVKVG----------------------------------------
3ctyA           KGKRVVTIGGGNSGAIAAISMSEYVKNVTIIEYMP-----------------------------------
3d4oA           IHGANVAVLGLGRVGSVARKFAALGAKVKVGA--------------------------------------
1b73A           ----------------------------------------------------------------------
2dldA           RDQVVGVVGTGHIGQVFMRIMEGFG---------------------------------------------
2bc0A           DIKRVAVVGAGYIGVELAEAFQRKGKEVVLIDVVD-----------------------------------
2cduB           KAKTITIIGSGYIGAELAEAYSNQNYNVNLIDGHE-----------------------------------
3eanC           CPGKTLVVGASYVALECAGFLAGIGLDVTV----------------------------------------
2drvA           ----------------------------------------------------------------------
1cl0A           RNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRD-----------------------------------
3eanF           CPGKTLVVGASYVALECAGFLAGIGLDVTVMV--------------------------------------
1bhyA           ----------------------------------------------------------------------
3eanA           CPGKTLVVGASYVALECAGFLAGIGLDVTVMV--------------------------------------
3d1cA           NKGQYVVIGGNESGFDAAYQLAKNGSDIALYT--------------------------------------
1djnA           IGKRVVILNAYFMAPSLAEKLATAGHEVTIVSGVH-----------------------------------
3coxA           ---SNEMYNKYFPRANTGLGVNNIDQAW----FESTEWYKFARTGRKTAQRSGFTTAFVPN---------
2e4gB           ----------------------------------------------------------------------
2a8xA           ----------------------------------------------------------------------
3cukA           ----------------------------------------------------------------------
2cfyA           CPGKTLVVGASY----------------------------------------------------------
1b37A           ----------------------------------------------------------------------
3cnjA           ----------------------------------------------------------------------
2bk4B           SAKCVTAETHEVSALWFLWYVKQCGGT-------------------------------------------
1cc4A           ----------------------------------------------------------------------
1d7yA           PQSRLLIVGGGVIGLELAATARTAGVHVSLVETQP-----------------------------------
1cc6A           ----------------------------------------------------------------------
3b3rA           ----------------------------------------------------------------------
3bh1C           ERHKIRAISYEEDVLRLVDVFRDRGFLVEHVVLTQLAFIERLQRLGIKVS--------------------
1bgjA           ----------------------------------------------------------------------
3cmmC           FGNTFVDLGDEFTVLDPTGEEPRTGMVSDIEPTVTMLDDNRHGLEDGNFVRFVEGLDKLNDGTLFKVEVL
3cp8A           VRSGRAIQAKAAILACGTFLNGLIHIGMDHFPGSTAEPPVEGLTESLASLGFSFGRLKTGTPPRIDSRSV
1an9A           ----------------------------------------------------------------------
1ebdA           VPKSLVVIGGGYIGIELGTAYANFGTKVTILE--------------------------------------
1dncA           LPGRSVIVGAGYIAVEMAGILSA-----------------------------------------------
3cgcA           KVEDVTIIGGGAIGLEMAETFVERNDHIGTIYDGDMAEYIYKEADKHHIEILTNENVKAFKGNERVEAVE
2b76M           QYHPTGLPGSGILMTEGCRGEGGILVNKNGYRYLQ-----------------------------------
3cgvA           ----------------------------------------------------------------------
2amfC           ---KIGIIGVGKMASAIIKGLKQTPHELIISGSSLERSKEIAEQLALPYAMSHQDLIDQVDLVILGIKPQ
1cj3A           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
1bgnA           ----------------------------------------------------------------------
1djqA           KRVVILNADTYFMAPSLAEKLATAGHEVTIVSGVHLA---------------------------------
1d7lA           ----------------------------------------------------------------------
1bzlA           ----------------------------------------------------------------------
1b37B           ----------------------------------------------------------------------
3cpiH           ----------------------------------------------------------------------
1cj4A           ----------------------------------------------------------------------
2bc1A           ----------------------------------------------------------------------
3eanD           CPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSI-----------------------------------
3dc2A           FGKTVGVVGLGRIGQLVAQRIAAFGAYVVAYDP-------------------------------------
3djeB           ----------------------------------------------------------------------
3bg7A           ----------------------------------------------------------------------
2apgA           LSDGTRQMSHAWHAHLVADFLKRWAVERGVNRVVDEVVDVRLNNRGYISNLLTKEG--------------
2c75A           ----------------------------------------------------------------------
3ed8C           KQHDFFKSAMPEGYVQERTISFKDDGKYKTRAVVKFEGDTLVNRIELKGTDFKEDGNILGHKLEYNFNSH
3djdB           ----------------------------------------------------------------------
2c72B           ----------------------------------------------------------------------
1bf3A           ----------------------------------------------------------------------
3bg6A           ----------------------------------------------------------------------
2c75B           ----------------------------------------------------------------------
2bhtB           ----------------------------------------------------------------------
3dojA           HMMEVGFLGLGIMGKAMSMNLLKNGFKVTVWNRTLSKCDELVEHGASVC---------------------
3d1lB           ---PIVLIGAGNLATNLAKALYRKGFRIVQVYSRTEESARELAQKVEAE---------------------


                         .         .         .         +         .         .         .:280
query           DHSDTIEVIVNPEDIDYDAASEQARRDSKSQDLVCQTLESYAMRDPKGAPHKLFIHFFESPVEILGEDGK
1e6eC           IQLPGTRPMLDPADFLGLQDRIKEAARPRKRLMELLLRTATEKPGVEEAARRASARFFRSPQQVLPSPDG
1cjcA           IQLPGTRPMLDPADFLGLQDRIKEAARPRKRLMELLLRTATEKPGVEEAARRASARFFRSPQQVLPSPDG
2c7gA           ADLDGVDVVIDPLDGITDEDAAAVGKVCKQNIKVLRGYADREPRPGHRRMVFRFLTSPIEIKGKRKVERI
2ejrA           KEYDEL----------------------------------------------------------------
1e6eA           IQLPGTRPMLDPADFLGLQDRIKEAARPRKRLMELLLRTATEKPGVEEAARRASARFFRSPQQVLPSPDG
2dw4A           EANPPSDVYLSSRD--------------------------------------------------------
3ctyB           ----------------------------------------------------------------------
3d4oC           ----------------------------------------------------------------------
3dk9A           ----------------------------------------------------------------------
2a87A           ----------------------------------------------------------------------
2a87B           ----------------------------------------------------------------------
3d4oB           ----------------------------------------------------------------------
3ctyA           ----------------------------------------------------------------------
3d4oA           ----------------------------------------------------------------------
1b73A           ----------------------------------------------------------------------
2dldA           ----------------------------------------------------------------------
2bc0A           ----------------------------------------------------------------------
2cduB           ----------------------------------------------------------------------
3eanC           ----------------------------------------------------------------------
2drvA           ----------------------------------------------------------------------
1cl0A           ----------------------------------------------------------------------
3eanF           ----------------------------------------------------------------------
1bhyA           ----------------------------------------------------------------------
3eanA           ----------------------------------------------------------------------
3d1cA           ----------------------------------------------------------------------
1djnA           ----------------------------------------------------------------------
3coxA           -------VYDFEYMKKEAAGQVTKSGLGGEVIYGNNAGKKSLDKTQAAATGKLTITTLHRVTKVAPATGS
2e4gB           ----------------------------------------------------------------------
2a8xA           ----------------------------------------------------------------------
3cukA           ----------------------------------------------------------------------
2cfyA           ----------------------------------------------------------------------
1b37A           ----------------------------------------------------------------------
3cnjA           ----------------------------------------------------------------------
2bk4B           ----------------------------------------------------------------------
1cc4A           ----------------------------------------------------------------------
1d7yA           ----------------------------------------------------------------------
1cc6A           ----------------------------------------------------------------------
3b3rA           ----------------------------------------------------------------------
3bh1C           ----------------------------------------------------------------------
1bgjA           ----------------------------------------------------------------------
3cmmC           GP--------------------------------------------------------------------
3cp8A           DYTIVTEQPGDVDPVPFSFSSTSVANRNLVSCYLTKTTEKTHDILRTGFDRSPLFTGCPSIEDKISRFPD
1an9A           ----------------------------------------------------------------------
1ebdA           ----------------------------------------------------------------------
1dncA           ----------------------------------------------------------------------
3cgcA           TDKGTYKA--------------------------------------------------------------
2b76M           ----------------------------------------------------------------------
3cgvA           ----------------------------------------------------------------------
2amfC           LFETVLKPLHFKQPIISMAAGISLQRLA-----TFVGQDLPLLRIMPNMNAQILQSSTALTGNA-LVSQE
1cj3A           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
1bgnA           ----------------------------------------------------------------------
1djqA           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
1bzlA           ----------------------------------------------------------------------
1b37B           ----------------------------------------------------------------------
3cpiH           ----------------------------------------------------------------------
1cj4A           ----------------------------------------------------------------------
2bc1A           ----------------------------------------------------------------------
3eanD           ----------------------------------------------------------------------
3dc2A           ----------------------------------------------------------------------
3djeB           ----------------------------------------------------------------------
3bg7A           ----------------------------------------------------------------------
2apgA           ----------------------------------------------------------------------
2c75A           ----------------------------------------------------------------------
3ed8C           NVYITATRGTKQKNG-------------------------------------------------------
3djdB           ----------------------------------------------------------------------
2c72B           ----------------------------------------------------------------------
1bf3A           ----------------------------------------------------------------------
3bg6A           ----------------------------------------------------------------------
2c75B           ----------------------------------------------------------------------
2bhtB           ----------------------------------------------------------------------
3dojA           ----------------------------------------------------------------------
3d1lB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VVGLKTERTQLDGNGGVTGTGEFKTWDVQSVYRAVGYRSDAIEGVPFDDERAVVPNDGGHIIDPEVGSPI
1e6eC           RRAAGIRLAVTRLEGIAVPTGDVEDLPCGLVLSSIGYKSRIDPSVPFDPKL------GVVPNMEGRVVDV
1cjcA           RRAAGIRLAVTRLEGIGEATRAVPTGDVEDLPCGLVLSSIGYKSRPIDPSVPFDPKLGVVPNMEGRVVDV
2c7gA           VLGRNELVSDGSGRVAAKDTGEREELPAQLVVRSVGYRGVPTPGLPFDDQSGTIPNVGGRIN------GS
2ejrA           ----------------------------------------------------------------------
1e6eA           RRAAGIRLAVTRLEGIAVPTGDVEDLPCGLVLSSIGYKSR-----PIDPSVPFDPKLGVVPNMEGRVVDV
2dw4A           ----------------------------------------------------------------------
3ctyB           ----------------------------------------------------------------------
3d4oC           ----------------------------------------------------------------------
3dk9A           ----------------------------------------------------------------------
2a87A           ----------------------------------------------------------------------
2a87B           ----------------------------------------------------------------------
3d4oB           ----------------------------------------------------------------------
3ctyA           ----------------------------------------------------------------------
3d4oA           ----------------------------------------------------------------------
1b73A           ----------------------------------------------------------------------
2dldA           ----------------------------------------------------------------------
2bc0A           ----------------------------------------------------------------------
2cduB           ----------------------------------------------------------------------
3eanC           ----------------------------------------------------------------------
2drvA           ----------------------------------------------------------------------
1cl0A           ----------------------------------------------------------------------
3eanF           ----------------------------------------------------------------------
1bhyA           ----------------------------------------------------------------------
3eanA           ----------------------------------------------------------------------
3d1cA           ----------------------------------------------------------------------
1djnA           ----------------------------------------------------------------------
3coxA           GYSVTME-----QIDEQGNVVATKVVTADRVFFAAGSVGTSMKAQGHLPNLSSQVGEGWGNNGNIM----
2e4gB           ----------------------------------------------------------------------
2a8xA           ----------------------------------------------------------------------
3cukA           ----------------------------------------------------------------------
2cfyA           ----------------------------------------------------------------------
1b37A           ----------------------------------------------------------------------
3cnjA           ----------------------------------------------------------------------
2bk4B           ----------------------------------------------------------------------
1cc4A           ----------------------------------------------------------------------
1d7yA           ----------------------------------------------------------------------
1cc6A           ----------------------------------------------------------------------
3b3rA           ----------------------------------------------------------------------
3bh1C           ----------------------------------------------------------------------
1bgjA           ----------------------------------------------------------------------
3cmmC           ----------------------------------------------------------------------
3cp8A           KSSHHIFL--------EPEGTDTVEMYVNGFSTSLPIQIAGLRSIPGLEEAKMIRPGYAIEYDFFHPWQI
1an9A           ----------------------------------------------------------------------
1ebdA           ----------------------------------------------------------------------
1dncA           ----------------------------------------------------------------------
3cgcA           ----------------------------------------------------------------------
2b76M           ----------------------------------------------------------------------
3cgvA           ----------------------------------------------------------------------
2amfC           LQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYLFIEALAKAGVKNGIPKAKALEIVTQTVL---
1cj3A           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
1bgnA           ----------------------------------------------------------------------
1djqA           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
1bzlA           ----------------------------------------------------------------------
1b37B           ----------------------------------------------------------------------
3cpiH           ----------------------------------------------------------------------
1cj4A           ----------------------------------------------------------------------
2bc1A           ----------------------------------------------------------------------
3eanD           ----------------------------------------------------------------------
3dc2A           ----------------------------------------------------------------------
3djeB           ----------------------------------------------------------------------
3bg7A           ----------------------------------------------------------------------
2apgA           ----------------------------------------------------------------------
2c75A           ----------------------------------------------------------------------
3ed8C           ----------------------------------------------------------------------
3djdB           ----------------------------------------------------------------------
2c72B           ----------------------------------------------------------------------
1bf3A           ----------------------------------------------------------------------
3bg6A           ----------------------------------------------------------------------
2c75B           ----------------------------------------------------------------------
2bhtB           ----------------------------------------------------------------------
3dojA           ----------------------------------------------------------------------
3d1lB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           TGLYATGWIKRGPIGLIGNTKSDAKETTEMLLADHAAGSLPAPAKPELESIIEFLDERKVAFTTWDGWHL
1e6eC           PGLYCSGWVKRGPTGVITTTMTDSFLTGQILLQDLKAGHLPSGPRPGSAFIKALLDSRGVWPVSFSDWEK
1cjcA           PGLYCSGWVKRGPTGVITTTMTDSFLTGQILLQDLKAGHLPSGPRPGSAFIKALLDSRGVWPVSFSDWEK
2c7gA           PNEYVVGWIKRGPTGVIGTNKKDAQDTVDTLIKNLGNAKEGAECKSFDHAVADWLAARQPKLVTSAHWQV
2ejrA           ----------------------------------------------------------------------
1e6eA           PGLYCSGWVKRGPTGVITTTMTDSFLTGQILLQDLKAGHLPSGPRPGSAFIKALLDSRGVWPVSFSDWEK
2dw4A           ----------------------------------------------------------------------
3ctyB           ----------------------------------------------------------------------
3d4oC           ----------------------------------------------------------------------
3dk9A           ----------------------------------------------------------------------
2a87A           ----------------------------------------------------------------------
2a87B           ----------------------------------------------------------------------
3d4oB           ----------------------------------------------------------------------
3ctyA           ----------------------------------------------------------------------
3d4oA           ----------------------------------------------------------------------
1b73A           ----------------------------------------------------------------------
2dldA           ----------------------------------------------------------------------
2bc0A           ----------------------------------------------------------------------
2cduB           ----------------------------------------------------------------------
3eanC           ----------------------------------------------------------------------
2drvA           ----------------------------------------------------------------------
1cl0A           ----------------------------------------------------------------------
3eanF           ----------------------------------------------------------------------
1bhyA           ----------------------------------------------------------------------
3eanA           ----------------------------------------------------------------------
3d1cA           ----------------------------------------------------------------------
1djnA           ----------------------------------------------------------------------
3coxA           ----------------------------------------------------------------------
2e4gB           ----------------------------------------------------------------------
2a8xA           ----------------------------------------------------------------------
3cukA           ----------------------------------------------------------------------
2cfyA           ----------------------------------------------------------------------
1b37A           ----------------------------------------------------------------------
3cnjA           ----------------------------------------------------------------------
2bk4B           ----------------------------------------------------------------------
1cc4A           ----------------------------------------------------------------------
1d7yA           ----------------------------------------------------------------------
1cc6A           ----------------------------------------------------------------------
3b3rA           ----------------------------------------------------------------------
3bh1C           ----------------------------------------------------------------------
1bgjA           ----------------------------------------------------------------------
3cmmC           ----------------------------------------------------------------------
3cp8A           RNLFFAGQITSGYEEAAAQGLMAGINAVRKILGKELIVLGRDQAVLIDDLITKETKEPYRMFTSSAEHR-
1an9A           ----------------------------------------------------------------------
1ebdA           ----------------------------------------------------------------------
1dncA           ----------------------------------------------------------------------
3cgcA           ----------------------------------------------------------------------
2b76M           ----------------------------------------------------------------------
3cgvA           ----------------------------------------------------------------------
2amfC           -ASASNLKTSSQSPHDFIDAICSPGGTTIAGLMELERLGLTATVSSAIDKTID-----------------
1cj3A           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
2dpoA           ----------------------------------------------------------------------
1bgnA           ----------------------------------------------------------------------
1djqA           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
1bzlA           ----------------------------------------------------------------------
1b37B           ----------------------------------------------------------------------
3cpiH           ----------------------------------------------------------------------
1cj4A           ----------------------------------------------------------------------
2bc1A           ----------------------------------------------------------------------
3eanD           ----------------------------------------------------------------------
3dc2A           ----------------------------------------------------------------------
3djeB           ----------------------------------------------------------------------
3bg7A           ----------------------------------------------------------------------
2apgA           ----------------------------------------------------------------------
2c75A           ----------------------------------------------------------------------
3ed8C           ----------------------------------------------------------------------
3djdB           ----------------------------------------------------------------------
2c72B           ----------------------------------------------------------------------
1bf3A           ----------------------------------------------------------------------
3bg6A           ----------------------------------------------------------------------
2c75B           ----------------------------------------------------------------------
2bhtB           ----------------------------------------------------------------------
3dojA           ----------------------------------------------------------------------
3d1lB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LDAAERALGEPEGRERKKIVEWNDMVRHARPExxx
1e6eC           LDAEEVSRGQASGKPREKLLDPQEMLR--------
1cjcA           LDAEEVSRGQASGKPREKLLDPQEMLR--------
2c7gA           IDAFERAAGEPHGRPRVKLASLAELLRIG------
2ejrA           -----------------------------------
1e6eA           LDAEEVSRGQASGKPREKLLDPQEMLR--------
2dw4A           -----------------------------------
3ctyB           -----------------------------------
3d4oC           -----------------------------------
3dk9A           -----------------------------------
2a87A           -----------------------------------
2a87B           -----------------------------------
3d4oB           -----------------------------------
3ctyA           -----------------------------------
3d4oA           -----------------------------------
1b73A           -----------------------------------
2dldA           -----------------------------------
2bc0A           -----------------------------------
2cduB           -----------------------------------
3eanC           -----------------------------------
2drvA           -----------------------------------
1cl0A           -----------------------------------
3eanF           -----------------------------------
1bhyA           -----------------------------------
3eanA           -----------------------------------
3d1cA           -----------------------------------
1djnA           -----------------------------------
3coxA           -----------------------------------
2e4gB           -----------------------------------
2a8xA           -----------------------------------
3cukA           -----------------------------------
2cfyA           -----------------------------------
1b37A           -----------------------------------
3cnjA           -----------------------------------
2bk4B           -----------------------------------
1cc4A           -----------------------------------
1d7yA           -----------------------------------
1cc6A           -----------------------------------
3b3rA           -----------------------------------
3bh1C           -----------------------------------
1bgjA           -----------------------------------
3cmmC           -----------------------------------
3cp8A           ----LILRHDNADLRLRKIGYDCNLVSSDDLH---
1an9A           -----------------------------------
1ebdA           -----------------------------------
1dncA           -----------------------------------
3cgcA           -----------------------------------
2b76M           -----------------------------------
3cgvA           -----------------------------------
2amfC           -----------------------------------
1cj3A           -----------------------------------
2e4gA           -----------------------------------
2dpoA           -----------------------------------
1bgnA           -----------------------------------
1djqA           -----------------------------------
1d7lA           -----------------------------------
1bzlA           -----------------------------------
1b37B           -----------------------------------
3cpiH           -----------------------------------
1cj4A           -----------------------------------
2bc1A           -----------------------------------
3eanD           -----------------------------------
3dc2A           -----------------------------------
3djeB           -----------------------------------
3bg7A           -----------------------------------
2apgA           -----------------------------------
2c75A           -----------------------------------
3ed8C           -----------------------------------
3djdB           -----------------------------------
2c72B           -----------------------------------
1bf3A           -----------------------------------
3bg6A           -----------------------------------
2c75B           -----------------------------------
2bhtB           -----------------------------------
3dojA           -----------------------------------
3d1lB           -----------------------------------