[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF55698.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2e11A.bssp"
#ERROR : Can't open dsspfile "2e2kB.bssp"
#ERROR : Can't open dsspfile "2e2lE.bssp"
#ERROR : Can't open dsspfile "2e2kF.bssp"
#ERROR : Can't open dsspfile "2e2kC.bssp"
#ERROR : Can't open dsspfile "2e2kD.bssp"
#ERROR : Can't open dsspfile "2e2kE.bssp"
#ERROR : Can't open dsspfile "2e2kA.bssp"
#ERROR : Can't open dsspfile "2e2lA.bssp"
#ERROR : Can't open dsspfile "2dyuA.bssp"
#ERROR : Can't open dsspfile "3dlaD.bssp"
#ERROR : Can't open dsspfile "3dlaB.bssp"
#ERROR : Can't open dsspfile "3dlaC.bssp"
#ERROR : Can't open dsspfile "3dlaA.bssp"
#ERROR : Can't open dsspfile "3c8wB.bssp"
#ERROR : Can't open dsspfile "3c8wA.bssp"
#ERROR : Can't open dsspfile "2aplA.bssp"

## Summary of PDB Search
:266
    4e-47  22%  2e11A  [x.x.x] HYDROLASE
    4e-46  18%  2e2kB  [x.x.x] FORMAMIDASE
    1e-44  17%  2e2lE  [x.x.x] FORMAMIDASE
    4e-44  17%  2e2kF  [x.x.x] FORMAMIDASE
    7e-44  17%  2e2kC  [x.x.x] FORMAMIDASE
    1e-42  17%  2e2kD  [x.x.x] FORMAMIDASE
    2e-42  18%  2e2kE  [x.x.x] FORMAMIDASE
    1e-41  17%  2e2kA  [x.x.x] FORMAMIDASE
    1e-41  17%  2e2lA  [x.x.x] FORMAMIDASE
    1e-39  18%  2dyuA  [x.x.x] FORMAMIDASE
    1e-29  21%  3dlaD  [x.x.x] GLUTAMINE-DEPENDENT NAD(+) SYNTHETASE
    3e-27  21%  3dlaB  [x.x.x] GLUTAMINE-DEPENDENT NAD(+) SYNTHETASE
    1e-25  20%  3dlaC  [x.x.x] GLUTAMINE-DEPENDENT NAD(+) SYNTHETASE
    2e-25  20%  3dlaA  [x.x.x] GLUTAMINE-DEPENDENT NAD(+) SYNTHETASE
    8e-17  10%  3c8wB  [x.x.x] ACETOACETATE DECARBOXYLASE ADC
    3e-16  12%  3c8wA  [x.x.x] ACETOACETATE DECARBOXYLASE ADC
    4e-13   6%  2aplA  [x.x.x] HYPOTHETICAL PROTEIN PG0816
:266

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRIALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEELDGEFSTAVKELA
2e11A           LRISLVQGTRWHDPAGNRDYYGALLEPLA-GQSDLVILPETFTSGFSNEAID-KAEDMDGPTVAWIRTQA
2e2kB           FLVAAIQFPSRKDIDHNIESIIRTLHKAGYPGVELIIFPEYQGLNTAKWLSEEFLLDVPGKETELYAKAC
2e2lE           FLVAAIQFPSRKDIDHNIESIIRTLHKAGYPGVELIIFPEYQGLNTAKWLSEEFLLDVPGKETELYAKAC
2e2kF           FLVAAIQFPSRKDIDHNIESIIRTLHKAGYPGVELIIFPEYQGLNTAKWLSEEFLLDVPGKETELYAKAC
2e2kC           FLVAAIQFPSRKDIDHNIESIIRTLHKAGYPGVELIIFPEYQGLNTAKWLSEEFLLDVPGKETELYAKAC
2e2kD           FLVAAIQFPSRKDIDHNIESIIRTLHKAGYPGVELIIFPEYSTQGLNTALSEEFLLDVPGKETELYAKAC
2e2kE           FLVAAIQFPSRKDIDHNIESIIRTLHKAGYPGVELIIFPEYQGLNTAKWLSEEFLLDVPGKETELYAKAC
2e2kA           FLVAAIQFPSRKDIDHNIESIIRTLHKAGYPGVELIIFPEYQGLNTAKWLSEEFLLDVPGKETELYAKAC
2e2lA           FLVAAIQFPSRKDIDHNIESIIRTLHKAGYPGVELIIFPEYQGLNTAKWLSEEFLLDVPGKETELYAKAC
2dyuA           FLVAAIQFPSRKDIDHNIESIIRTLHKAGYPGVELIIFPEYQGLNTAKWLSEEFLLDVPGKETELYAKAC
3dlaD           VRVAACTHHTIGDPAANAASVLDMARACHDDGAALAVFPELTLSGYSIEDVLLQDSLLDADALLDLVTES
3dlaB           VRVAACTHTTIGDPAANAASVLDMARACHDDGAALAVFPELTLSGYSIEDVLLQDSLLDADALLDLVTES
3dlaC           VRVAACTHHTIGDPAANAASVLDMARACHDDGAALAVFPELTLSGYSIEDVLLQDSLLDADALLDLVTES
3dlaA           VRVAACTHTTIGDPAANAASVLDMARACHDDGAALAVFPELTLSGYSIEDVLLQDSLLDADALLDLVTES
3c8wB           -------------------------------------------------------------LEGVIDNEF
3c8wA           ---------------------------------------------------------LSANSLEGVIDNE
2aplA           GNNPFITARSDEALTAYCDAVAQGFSHPEAESASEVLYQGLHFSRYDTLVSVEFEQELPSPLPERLAPIL


                         .         .         *         .         .         .         .:140
query           DELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAGLHQGYNKIHTYDAFGYRESDTVKPGDELVVFE
2e11A           ARLGAAITGSVQLRTEHGVF--------NRLLWATPDGALQYYDKRHLFRFG--NEHLRYAAGRERLCVE
2e2kB           KEAKVYGVFSIM------ERNPDSNKNPYNTAIIIDPQIILKYRKLFP---WNPIEPWYPGDLGMPVCEG
2e2lE           KEAKVYGVFSIM------ERNPDSNKNPYNTAIIIDPQGEIIL-KYRKLFPWNPIEPWYPGDLGMPVCEG
2e2kF           KEAKVYGVFSIM------ERNPDSNKNPYNTAIIIDPQGEIIL-KYRKLFPWNPIEPWYPGDLGMPVCEG
2e2kC           KEAKVYGVFSIM------ERNPDSNKNPYNTAIIIDPQIILKYRKLFP---WNPIEPWYPGDLGMPVCEG
2e2kD           KEAKVYGVFSIM------ERNPDSNKNPYNTAIIIDPQGEIIL-KYRKLFPWNPIEPWYPGDLGMPVCEG
2e2kE           KEAKVYGVFSIM------ERNPDSNKNPYNTAIIIDPQIILKYRKLFP---WNPIEPWYPGDLGMPVCEG
2e2kA           KEAKVYGVFSIM------ERNPDSNKNPYNTAIIIDPQIILKYRKLFP---WNPIEPWYPGDLGMPVCEG
2e2lA           KEAKVYGVFSIM------ERNPDSNKNPYNTAIIIDPQGEIIL-KYRKLFPWNPIEPWYPGDLGMPVCEG
2dyuA           KEAKVYGVFSIM------ERNPDSNKNPYNTAIIIDPQIILKYRKLFPWNP---IEPWYPGDLGMPVCEG
3dlaD           ADLLPVLVVGAPLRHRHRIY--------NTAVVIHRGAVLGVVPKSYLPTYREFYEDVAFGTDLLFAASD
3dlaB           ADLLPVLVVGAPLRHRHRIY--------NTAVVIHRGAVLGVVPKSYLPTYREFYEDVAFGTDLLFAASD
3dlaC           ADLLPVLVVGAPLRHRHRIY--------NTAVVIHRGAVLGVVPKSYLPTYREFYEDVAFGTDLLFAASD
3dlaA           ADLLPVLVVGAPLRHRHRIY--------NTAVVIHRGAVLGVVPKSYLPTYREFYEDVAFGTDLLFAASD
3c8wB           --SPAPRWLNTYPAGPY---------RFINREFFIIAYDPDLLQAILPPDELKFEFIRPDSTGFGRYKGE
3c8wA           F-SPAPRWLNTYPAGP---------YRFINREFFIIAYILPPDELLEPVVKFEFIRPDSTGFGDYTYKGE
2aplA           LKNKAIQSVFAKYDLTDDFEA----SPEYEHLYTELTGIVLLIESNH-----------------------


                         +         .         .         .         .         *         .:210
query           VDDIKFGVATCYDIRFPEQFKDLARNDAQVILVPTSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARL
2e11A           WKGWRINPQVCYDLRFPVFCRNRFDVERPGQLDFDVANWPSARAYAWKTLLRARAIENLCFVAAVNRVGV
2e2kB           PGGSKLAVCISHDGMIPELAREAAYKGCNVYIRISGY---STQVDQWILTNRSNAWHNLMYTVSVNLAG-
2e2lE           PGGSKLAVCISHDGMIPELAREAAYKGCNVYIRISGYSTQVN--DQWILTNRSNAWHNLMYTVSVNL---
2e2kF           PGGSKLAVCISHDGMIPELAREAAYKGCNVYIRISGY---SQVNDQWILTNRSNAWHNLMYTVSVNLAG-
2e2kC           PGGSKLAVCISHDGMIPELAREAAYKGCNVYIRISGYSTQVN--DQWILTNRSNAWHNLMYTVSVNLAG-
2e2kD           PGGSKLAVCISHDGMIPELAREAAYKGCNVYIRISGYSQV---NDQWILTNRSNAWHNLMYTVSVNLAGY
2e2kE           PGGSKLAVCISHDGMIPELAREAAYKGCNVYIRISGY---STQVDQWILTNRSNAWHNLMYTVSVNLAG-
2e2kA           PGGSKLAVCISHDGMIPELAREAAYKGCNVYIRISGY---SQVNDQWILTNRSNAWHNLMYTVSVNLAGY
2e2lA           PGGSKLAVCISHDGMIPELAREAAYKGCNVYIRISGYSTQVN--DQWILTNRSNAWHNLMYTVSVNLA--
2dyuA           PGGSKLAVCICHDGMIPELAREAAYKGCNVYIRISGYSTQVN--DQWILTNRSNAWHNLMYTVSVNL---
3dlaD           LPGFVLHVEICEDMFVPMPPSAEAALAGATVLANLS--GSPGRAEDRRLLARARCLAAYVYAAAGEG---
3dlaB           LPGFVLHVEICEDMFVPMPPSAEAALAGATVLANLS--GSPGRAEDRRLLARARCLAAYVY-AAAGEGES
3dlaC           LPGFVLHVEICEDMFVPMPP--------------------------------------------------
3dlaA           LPGFVLHVEICEDMFVPMPP--------------------------------------------------
3c8wB           EGGFTISFLDCHAPGFPKLAKPKLFVEEDTLIGILSIDIAIATGYKHRPLDAEKVLESVKKPVFL-----
3c8wA           EGGFTISFLDCHAPGFPKLAKPKLFVEEDTLIGILGSIDIAATGYKHRPLDAEKVLESVKKPVFL-----
2aplA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PEELRDKRNGPTGIGHSMVANPHGQVIVSAGYEPEMLIVDIDVSDLSKIREALPVL
2e11A           DG------NQLHYAGDSAVIDFLGQPQVEIREQEQVVTTTISAAALAEHRARFPAM
2e2kB           ------YDNVFYYFGEGQICNFDGTTLVQGHRPWEIVTGEIYPKMADNARLSWGLE
2e2lE           ---------AGYYFGEGQICNFDGTTLVQGHNPWEIVTGEIYPKMADNARLSWGLE
2e2kF           ------YDNVFYYFGEGQICNFDGTTLVQGHNPWEIVTGEIYPKMADNARLSWGLE
2e2kC           -------YDNFYYFGEGQICNFDGTTLVQGHNPWEIVTGEIYPKMADNARLSWGLE
2e2kD           DNVF--------YYFGGQICNFDGTTLVQGHNPWEIVTGEIYPKMADNARLSWGLE
2e2kE           ------YDNVFYYFGEGQICNFDGTTLVQGHNPWEIVTGEIYPKMADNARLSWGLE
2e2kA           DNVFY-------YFGEGQICNFDGTTLVQGHRPWEIVTGEIYPKMADNARLSWGLE
2e2lA           ----------GYYFGEGQICNFDGTTLVQGHNPWEIVTGEIYPKMADNARLSWGLE
2dyuA           ----AGYDNVFYYFGEGQICNFDGTTLVQGHNPWEIVTGEIYPKMADNARLSWGLE
3dlaD           -ESTTDLA----WDGQTMIWENGALLAESERFPKGVRRSVADVDTELLRS------
3dlaB           TTDLAW-------DGQTMIWENGALLAESERFPKGVRRSVADVDTELLRS------
3dlaC           --------------------------------------------------------
3dlaA           --------------------------------------------------------
3c8wB           -------------LKNIPNVDGTPLVNQLTKTLTDITVKGAWTGPGSLELHPHA--
3c8wA           -------------LKNIPNVDGTPLVNQLTKTLTDITVKGAW--------------
2aplA           --------------------------------------------------------