[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF55730.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dljB.bssp"
#ERROR : Can't open dsspfile "3dljA.bssp"
#ERROR : Can't open dsspfile "3ct9A.bssp"
#ERROR : Can't open dsspfile "1cg2A.bssp"
#ERROR : Can't open dsspfile "3ct9B.bssp"
#ERROR : Can't open dsspfile "1cx8A.bssp"
#ERROR : Can't open dsspfile "1de4C.bssp"
#ERROR : Can't open dsspfile "3d7fA.bssp"
#ERROR : Can't open dsspfile "2c6cA.bssp"
#ERROR : Can't open dsspfile "2c6gA.bssp"
#ERROR : Can't open dsspfile "3d7gA.bssp"
#ERROR : Can't open dsspfile "3b3vA.bssp"
#ERROR : Can't open dsspfile "3bhxA.bssp"
#ERROR : Can't open dsspfile "3b3tA.bssp"
#ERROR : Can't open dsspfile "3bxmA.bssp"
#ERROR : Can't open dsspfile "2cf4A.bssp"
#ERROR : Can't open dsspfile "3cpxB.bssp"
#ERROR : Can't open dsspfile "2c6pA.bssp"
#ERROR : Can't open dsspfile "3b35A.bssp"
#ERROR : Can't open dsspfile "2anpA.bssp"
#ERROR : Can't open dsspfile "3cpxA.bssp"
#ERROR : Can't open dsspfile "2atzA.bssp"
#ERROR : Can't open dsspfile "1cp7A.bssp"
#ERROR : Can't open dsspfile "2afmA.bssp"
#ERROR : Can't open dsspfile "2afsA.bssp"
#ERROR : Can't open dsspfile "2afuA.bssp"
#ERROR : Can't open dsspfile "2afoA.bssp"

## Summary of PDB Search
:441
    7e-30  14%  3dljB  [x.x.x] BETA-ALA-HIS DIPEPTIDASE
    1e-29  14%  3dljA  [x.x.x] BETA-ALA-HIS DIPEPTIDASE
    2e-22  16%  3ct9A  [x.x.x] ACETYLORNITHINE DEACETYLASE
    2e-20  18%  1cg2A  [c.56.5 - d.58.19] CARBOXYPEPTIDASE G2
    4e-20  17%  3ct9B  [x.x.x] ACETYLORNITHINE DEACETYLASE
    2e-17  11%  1cx8A  [c.56.5 - c.8.4 - a.48.2] TRANSFERRIN RECEPTOR PROTEIN
    4e-16  10%  1de4C  [c.56.5 - c.8.4 - a.48.2] TRANSFERRIN RECEPTOR
    1e-15  11%  3d7fA  [x.x.x] GLUTAMATE CARBOXYPEPTIDASE 2
    3e-15  11%  2c6cA  [x.x.x] GLUTAMATE CARBOXYPEPTIDASE II
    3e-15  10%  2c6gA  [x.x.x] GLUTAMATE CARBOXYPEPTIDASE II
    5e-15  11%  3d7gA  [x.x.x] GLUTAMATE CARBOXYPEPTIDASE 2
    4e-14   9%  3b3vA  [x.x.x] BACTERIAL LEUCYL AMINOPEPTIDASE
    4e-14  10%  3bhxA  [x.x.x] GLUTAMATE CARBOXYPEPTIDASE 2
    7e-13   9%  3b3tA  [x.x.x] BACTERIAL LEUCYL AMINOPEPTIDASE
    3e-12  10%  3bxmA  [x.x.x] GLUTAMATE CARBOXYPEPTIDASE 2
    1e-11  14%  2cf4A  [x.x.x] PROTEIN PH0519
    1e-11   9%  3cpxB  [x.x.x] AMINOPEPTIDASE, M42 FAMILY
    1e-11   8%  2c6pA  [x.x.x] GLUTAMATE CARBOXYPEPTIDASE II
    2e-11   9%  3b35A  [x.x.x] BACTERIAL LEUCYL AMINOPEPTIDASE
    2e-10   8%  2anpA  [x.x.x] LEUCYL AMINOPEPTIDASE
    5e-10   9%  3cpxA  [x.x.x] AMINOPEPTIDASE, M42 FAMILY
    7e-10   9%  2atzA  [x.x.x] H. PYLORI PREDICTED CODING REGION HP0184
    5e-09  11%  1cp7A  [c.56.5] AMINOPEPTIDASE
    5e-09   9%  2afmA  [x.x.x] GLUTAMINYL-PEPTIDE CYCLOTRANSFERASE
    6e-07   9%  2afsA  [x.x.x] GLUTAMINYL-PEPTIDE CYCLOTRANSFERASE
    6e-07   8%  2afuA  [x.x.x] GLUTAMINYL-PEPTIDE CYCLOTRANSFERASE
    9e-06   9%  2afoA  [x.x.x] GLUTAMINYL-PEPTIDE CYCLOTRANSFERASE
:441

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xTLYDETLTLLQELIRNACVNDLTPDSGQEIRNAESLERFFEGTPNVEITKLEPRPGRTSIIVTVPGSDP
3dljB           -LHQDEFVQTLKEWVAIESDSVQPRFRQELFRMMAVAADTLQRASVDMGPQQLQSLPIPPVILAELGSDP
3dljA           -LHQDEFVQTLKEWVAIESDQPVPRFRQELFRMMAVAADTLQRSVDMGPQQLGQSLPIPPVILAELGSDP
3ct9A           -PTTAEAVSLLKSLISIPSI------SREETQAADFLQNYIEAE-GQTGR-------KGNNVWCLSPFDL
1cg2A           -DEQPAVIKTLEKLVN---IETGTGDAEGIAAAGNFLEAELKNLFTVTRSKSAGLVVGDNIVGKIKGRGG
3ct9B           -PTTAEAVSLLKSLISIPSI------SREETQAADFLQNYIEAE-GQTGR------KGNNVWCLSPFDKP
1cx8A           ----------------------------------------------------------------------
1de4C           -------------------------------------------EGDCPSDWKTDSTCRMVTSESKNVKLT
3d7fA           ----------------------------------------------------------------------
2c6cA           ----------------------------------------------------------------------
2c6gA           --------------------------------------------PPDSSWRGSLKVPYNVGPGFQKVKMH
3d7gA           ----------------------------------------------------------------------
3b3vA           ----SQITGTISSLES---FTNRFYTTTSGAQASDWIASEWQAPNASVKQVSHSGYNQKSVVMTITGSEA
3bhxA           ----------------------------------------------------------------------
3b3tA           ----SQITGTISSLES---FTNRFYTTTSGAQASDWIASEASLPNASVKQVSHSGYNQKSVVMTITGSEA
3bxmA           ----------------------------------------------------------------------
2cf4A           ------SIEKLKKFTQIPGI------SGYEERIREEIIREIKDFADYKVD------AIGNLIVELGEGEE
3cpxB           --NLYFQGQLLKELCSIHAP------SGNEEPLKDFILEYIRSN-AGSWSYQPVIYADNDLQDCIVLVFG
2c6pA           --------------------------------------LLEKMGGSAPPDSSWRGSLKVPYNVGPGFVKM
3b35A           ----SQITGTISSLES---FTNRFYTTTSGAQASDWIASEASLPNASVKQVSHSGYNQKSVVMTITGSEA
2anpA           ----SQITGTISSLES---FTNRFYTTTSGAQASDWIASEWQAPNASVKQVSHSGYNQKSVVMTITGSEA
3cpxA           ---LYFQGQLLKELCSIHAP------SGNEEPLKDFILEYIRSN-AGSWSYQPVIYADNDLQDCIVLVFG
2atzA           ----------------------------------------------------------------------
1cp7A           ----ANVKAHLTQLSTIAANNGGNHGRPGYKASVDYVKAKLDGYTTTLQQFTSGGATGYNLIANWPGGDP
2afmA           ------------------------PGSPGSYAARQHIMQRIQEIDTFLSQTPYGYRSFSNIISTLNPTAK
2afsA           ------------------------PGSPGSYAARQHIMQRIQEIDTFLSQTPYGYRSFSNIISTLNPTAK
2afuA           -----SISEMWQNDLQPLLIERYPG-SPGSYAARQHIMQRIQEIDTFLSQTPYGYRSFSNIISTLNPTAK
2afoA           ----SEMWQNDLQPLLIERY----PGSPGSYAARQHIMQRIQEIDTFLSQTPYGYRSFSNIISTLNPTAK


                         .         .         *         .         .         .         .:140
query           NAEPLTLLGHTDVVPVDLPKWTKDPFGAEISDGQIWGRGSVDMLFIXXXXXXXXXXXXXEGGLRGTLTFV
3dljB           TKGTVCFYGHLDVQPARGDGWLTDPYVLTEVDGKLYGRGATDKGPVLAWINAVSAFRALEQDLPVNIKFI
3dljA           TKGTVCFYGHLDVQPARGDGWLTDPYVLTEVDGKLYGRGATDNGPVLAWINAVSAFRALEQDLPVNIKFI
3ct9A           KKPTILLNSHIDTVK--------PVFTPREENGKLYGLGSNDAG-ASVVSLLQVFLQLCRTSQNYNLIYL
1cg2A           K--NLLLMSHMDTVYLK-GILAKAPF--RVEGDKAYGPGIADDKGGNAVILHTLKLLKEYGVDYGTITVL
3ct9B           ---TILLNSHIDTVK-----PVKDPFTPREENGKLYGLGSNDAG-ASVVSLLQVFLQLCRTSQNYNLIYL
1cx8A           ---------ILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKALLLKLAQMFSDMVLKDGFQPSRSIIFA
1de4C           VSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSLLLKLAQMFSDMVLKDGFQPSRSIIFA
3d7fA           --------TRIYNVIGTLRAVEPDRYVILGGHRDSWVFGGIDPAVVHEIVRSFGTLKKEGWRPRRTILFA
2c6cA           --STNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPAVVHEIVRSFGTLKKEGWRPRRTILFA
2c6gA           IHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSVHEIVRSFGTLKKEGWRPRRTILFA
3d7gA           -----EVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPAVVHEIVRSFGTLKKEGWRPRRTILFA
3b3vA           PDEWIVIGGHLDSTIGS------------HTNEQSVAPGADDDSGIAAVTEVIRVLSENNFQPKRSIAFM
3bhxA           ------EVTRIYNVGTLRGAVEPDRYVILGGHRDSWVFGGIDPAVVHEIVRSFGTLKKEGWRPRRTILFA
3b3tA           PDEWIVIGGHLDSTIGSHTNEQSVAPGADDNASGIAAVTEVIRVLSENNFQ-----------PKRSIAFM
3bxmA           --------TRIYNVGTLRGAVEPDRYVILGGHRDSWVFGGIDPAVVHEIVRSFGTLKKEGWRPRRTILFA
2cf4A           ----RILFAHDEIGLLI-TGITDEGK------LRFRKVGGIDDRLLYGRHVNVVTEKGILDGVIGATPPH
3cpxB           --NPRTAVFAHDSGFTVSYNNHLHPIGSPSAKEGYRLVGKDSNDIEGVLKIVDEEWLETDRLIDRGTEVT
2c6pA           HIHSTNEVTRIYNVIGTLRAVEPDRYVILGGHRDSWVFGGIDPAVVHEIVRSFGTLKKEGWRPRRTILFA
3b35A           PDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQ-----------PKRSIAFM
2anpA           PDEWIVIGGHLDSTIGSHTNEQSVAPGADDDAS-----------GIAAVTEVIRVLSENNFQPKRSIAFM
3cpxA           N-PRTAVFAHDSIGFTVSYNNHLHPIGSPSAKEGYRLVGKDSNDIEGVLKIVDEEWLETDRLIDRGTEVT
2atzA           ----------------------------------------------------------------------
1cp7A           N-KVLMAGAHLDSVSSG-AGINDNGSGSAAVLETALAVSRAGYQP------------------DKHLRFA
2afmA           --RHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARAL--DKKLLSLKPDLSLQLIFFDGEEAF
2afsA           --RHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARAL--DKKLLSLKPDLSLQLIFFDGEEAF
2afuA           --RHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARAL----DKKLLSLDLSLQLIFFDGQEAF
2afoA           --RHLVLACHYDSKYFSHWNNRV----FVGATDSAVPCAMMLELARALDKKLLSLDLSLQLIFFDGEEAF


                         +         .         .         .         .         *         .:210
query           GVADEEARGGLGAKWLSEEHQNLFSWKNCLSESGGSHLPVHDGSDAVVINVGEKGAAQRRIHVNGDAGHG
3dljB           IEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWI----SKPAITYGTRGNSYFMVEVKCRDQDFHS
3dljA           IEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWI----SKPAITYGTRGNSYFMVEVKCRDQDFHS
3ct9A           ASCEEEVSGKEGIESVLPGL---PPVSFAI------------VGEPTEQPAIAEKGLVLDVTATGKAGHA
1cg2A           FNTDEEKGSFGSRDLI---QEEAKLADYVLSFEPT-------SAGDEKLSLGTSGIAYVQVNITGKASHG
3ct9B           ASCEEEVSGKEGIESVLPGL-----------PPVSFAIVGEPTE----QPAIAEKGLVLDVTATGKAGHA
1cx8A           SWSAGD-FGSVGATEWLEGYLSSLHLK-------AFTYINLDKAVLGTSNFKVSASPLLYTLIEKTMQNV
1de4C           SWSAGDF-GSVGATYLSSLHLKAFTYINLDKAVLGTSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQD
3d7fA           SWDAEEFGLLGSTEWAEENSRLLQ--------ERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKEL
2c6cA           SWDAEEF-GLLGSTEWAEENS----RLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSP
2c6gA           SWDAEEFGLLGSTEWAEENSRLLQ--------ERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKEL
3d7gA           SWDAEE-FGLLGSTEWAEENSRLLQER-------GVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKEL
3b3vA           AYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDV-VFITDYTDSNFTQYLTQLMDEYLPS
3bhxA           SWDAEE-FGLLGSTEWAEENSRLLQER-------GVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKEL
3b3tA           AYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGS-AQDVVFITDYTDSNFTQYLTQLMDEYLPS
3bxmA           SWDAAE-FGLLGSTEWAEENSRLLQER-------GVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKEL
2cf4A           LSLERDKSVIPWYDLVIDIGAESK-----------------EEALELVKPLDFAVFKKHFSVLNGKYVST
3cpxB           FKPDFREEGDFILTPYLDDRLGVWTALELAKTLEH-----GIIAFTCWEEHGGGSVAYLARWIYETFHVK
2c6pA           SWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEG-----NYTLRVDCTPLMYSLVHNLTKELKSP
3b35A           AYAAEEVGLRGSQDLANQYKSEGKNVVSALLDATNYKGSAQDVVFI--TDYTDSNFTQYLTQLMDEYLPS
2anpA           AYAAHEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQ-DVVFITDYTDSNFTQYLTQLMDEYLPS
3cpxA           FKPDFREEGDFILTP---YLDDRLGVWTALELAKTLEHGIIAFTCWEEHGGGSVA---------------
2atzA           ----------------------------------------------------------------------
1cp7A           WWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGS----PNPGYFVYDDDPVIEKTFKNYFAGLNVP
2afmA           LHWSPQD-SLYGSRHLAAKM--------------------------------------------------
2afsA           LHWSPQD-SLYGSRHLAAKM--------------------------------------------------
2afuA           LHWSPQD-SLYGSRHLAAKM--------------------------------------------------
2afoA           LHWSPQD-SLYGSRHLAAKM--------------------------------------------------


                         .         .         .         +         .         .         .:280
query           SIPFDRDSAIVKIGEVARRIAAADLKVAKDDIWQGFVQAHRFDPETEQALLSGTSPEAYAEFGGLSRFAH
3dljB           GFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTELDLEEYRNSSRVEKFLFDTKEEILHLWRY
3dljA           GTFGGIHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTELDLEEYRNSSRVEKFLFDTKEEILHLWRY
3ct9A           ARDEGDN----------AIYKVLNDIAWFRDYR--------------------------------FEKES
1cg2A           AAPELGVNALV---------EASDLVLRTMNI----------------------------------DDKA
3ct9B           ARDEGDN----------AIYKVLNDIAWFRDYR--------------------------------FEKES
1cx8A           KHPVTGQFLYQDSN-----WASKVEKLTLDNAAFPFLAYSGI-----PAVSFCFCEDTDYPYLGTTMDTY
1de4C           SNWASKVEKLTLDNAAFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELIERIPELNKVARAAAEVA-
3d7fA           KSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLASGRARYTKNWETNGYPLSVYET
2c6cA           DEGFEGKSLYESWTKKSPSPEFS---------------------------------GMPRISKLGSGNDF
2c6gA           KSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQR-----LGIASGRARYTKNGYPLYH
3d7gA           KSPDEGFEGK----------------SLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRA
3b3vA           LTYGFDTCGYACADHASWHN-------------AGYPAAMPFESKFN-----------------------
3bhxA           KSPDEGFEGKSLYESWTKKSPS------------------------------------------PEFSGM
3b3tA           LTYGFDTCGYACSDHASWH-------------NAGYPAAM-------------PFESKFNDYNPRIHTT-
3bxmA           KSPDEGFEGKS---------LYESWTKKSPSPEFSGMPRISKL------------------GSGNDFEVF
2cf4A           RGLDDRFGVVALIEAIKD-----------------------------------------------LVDHE
3cpxB           QSLI------------------------------------------------------------------
2c6pA           DEGFEGKSLYESWTKKSPSPEFS-----------------------------------------GMPRIS
3b35A           LTYGFDTCGYACSDHASWHNAG--------------YPAAMPFESK------------------------
2anpA           LTYGFDTCGYACSDHASWHN-------------AGYPAAMPFESKFN-----------------------
3cpxA           ----------------------------------------------------------------------
2atzA           -----------------------------TSHYFEKKPGLGERVDAGRCFYNKFQRVNALT-SSLIQKHL
1cp7A           TEIETERSDHAPFKNVGVPV---------------------------GGLFTGAGYTKSAAQAQKWGG--
2afmA           ----------------------------------------------------------------------
2afsA           ----------------------------------------------------------------------
2afuA           ----------------------------------------------------------------------
2afoA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AVSHLTIAQTVVRAGQAINVLPSHAYLELDIRTLPGQTNDYVDDTLRGALGDLADEVEIEHLISEEATVS
3dljB           PSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKMVVSMTLGLHPWIA
3dljA           PSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKMVVSMTLGLHPWIA
3ct9A           PLLGPVKSVTVINAGTQHNVVPDKCTFVVDIRSNELYSNEDLFAEIRKHIACDAKARSFRL---------
1cg2A           KNLRFNW--TIAKAGNVSNIIPASATLNADVRYARNEDFDAAMKTLEERAQQKKADVKVIVTRGRPAFNG
3ct9B           PLLGPVKSVTVINAGTQHNVVPDKCTFVVDIRSNELYSNEDLFAEIRKHIACDAKARSFRLNSSRIDEKH
1cx8A           KELIERIPELNKVARAAAEVAGQFVIKLTHDVELNLDYEEYNSQLLSFVRDLNQYRADIKEMGLSLQWLY
1de4C           GQFVIKLTHDVELNL-DYERYNSQLLSFVRDLNQYRADIKEMGLSLQWLYSARGDFFRAT--SRLTTDFG
3d7fA           YELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVS
2c6cA           EVFFQRLGIASGRARYTKNSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGVFELANSIVLPFDCR
2c6gA           SVYETKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSIKHPQEMKTYSVSFD
3d7gA           RYT------------------KNNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTRGGMVFELANSIVLP
3b3vA           ----DYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSAT-------------------------
3bhxA           PRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQV
3b3tA           -------------QDTLANSDPTGSHAKKFTQLGLAYAIEMGSAT-------------------------
3bxmA           ---------FQRLGIASGRARYTKNWETNKFSGYPYETYELVEKFYDPMFKYHLTRGGMVFELANSIVLP
2cf4A           LEGKVIFAFTVQEEVGLKGAKFLANHYYPQYAFAIDSFACCSPLTGDVKL----GKGPVIRAVDNSAIYS
3cpxB           ----------------------------------------------------------------------
2c6pA           KLGSGNDFEVFFQRLGIASGRARYTKNGYPLYHSVYETYELVEKFYDPMFKYHLTRGGMVFELANSIVLP
3b35A           --FNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSAT-------------------------
2anpA           ----DYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGS---------------------------
3cpxA           ----------------------------------------------------------------------
2atzA           KREIEIAHNLILRNDKVENIVFDYNGRNPERFYHKAQLLLREEGFNFTAYNTKTPGHKGHTELGEGERLV
1cp7A           --------------TAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLS----------------
2afmA           ----------------------------------------------------------------------
2afsA           ----------------------------------------------------------------------
2afuA           ----------------------------------------------------------------------
2afoA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           PTDSRLYNTLEKVLGDFFPDAPVVPIISSGGSDLRFGRRLGGVGYGFAVHARERTLAEAMGQLHSHDEAL
3dljB           NIDDTQYLAAKRAIRTVFTEPD-MIRDGSTIPIAKMFQEIVHKSVVLI------PLGAVDDGEHSQNEKI
3dljA           NIDDTQYLAAKRAIRTVF-GTEPDMIRDGSTIPIAKMFQEIVHVVLIPLGAVDDG-------EHSQNEKI
3ct9A           --------NSSRIDEKHPFVQKAVKGRIPFGSPTLSDQALSFASVKIGPG--------RSSRSHTAEEYI
1cg2A           EGGKKLVDKAVAYYKEAG-GTLGVEERTGGGTDAAYAALSGKPVIESLGLPGF-------GYHSDKAEYV
3ct9B           PFVQKAVKG-----------------RIPFGSPTLSDQALSFASVKIGP--------GRSSRSHTAEEYI
1cx8A           SARGDFFRATSRLTTDFGNEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHVFWGSGTLPALLENL
1de4C           NAEKTDRFVMKKLNDRVM--RVEYHFLSPYVSPKESPFRHVFWGSGSHTL---PALLENLKLRKQNNGAF
3d7fA           FSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLVIYAPSSHNKYAGESFPGIYDAL
2c6cA           DYAVVLRKYADKIYSIS--MKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSE---------RLQDFDNPI
2c6gA           SSAVKNFTEIASKFSERLQDFDNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPS-SHNKYAGE
3d7gA           FDCRDYAVVLRKYADKIYSISMKHPQEMKSVSFDSLFSAVKNFTEIASKF---------SERLQDFSNPI
3b3vA           ----------------------------------------------------------------------
3bhxA           RGGMVFELANSIVLPFDCRD--------------------------------------------------
3b3tA           ----------------------------------------------------------------------
3bxmA           FDCRDYAVVLRKYADKIYSISMKHPQEMKSVSFDSLFSAVKNFTEIASKFSE---------RLQDFSNPI
2cf4A           RDLARKVWSIAEKNGI-----EIQIGVTGGGTDASA----------FQDRSKTLALSVPIKYLHSEVETL
3cpxB           ----------------------------------------------------------------------
2c6pA           FDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVTEIASKFSERLQDFDNPIVLRMMNDQLMFLERAFIDP
3b35A           ----------------------------------------------------------------------
2anpA           ----------------------------------------------------------------------
3cpxA           ----------------------------------------------------------------------
2atzA           KTLSKLAQGLPKEWKVFPSNEWPKEFNILALPYEVFAKERGSS---------------------------
1cp7A           ----------------------------------------------------------------------
2afmA           ----------------------------------------------------------------------
2afsA           ----------------------------------------------------------------------
2afuA           ----------------------------------------------------------------------
2afoA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           YLEDLELTVRGYDSVVREFLG
3dljB           NRWNYIEGTKLFAAFFLEMA-
3dljA           NRWNYIEGTKLFAAFFLEMA-
3ct9A           -LKEIEEAIGIYLDLLDGLK-
1cg2A           DISAIPRRLYMAARLIMDLGA
3ct9B           -LKEIEEAIGIYLDLLDGLK-
1cx8A           KLRKQNNGAFNETLFRNQL--
1de4C           NETLFRNQLALATWTIQG---
3d7fA           FDIESKVDPKAWGEVKRQI--
2c6cA           VLRMMNDQLMFLERAFIDPLG
2c6gA           SFPGI----------------
3d7gA           VLRMMNDQLMFLERAFIDPLG
3b3vA           ---------------------
3bhxA           ---------------------
3b3tA           ---------------------
3bxmA           VLRMMNDQLMFLERAFIDPLG
2cf4A           HLNDLEKLVKLIEALAFEL--
3cpxB           ---------------------
2c6pA           LGLPDRPFYRHV---------
3b35A           ---------------------
2anpA           ---------------------
3cpxA           ---------------------
2atzA           ---------------------
1cp7A           ---------------------
2afmA           ---------------------
2afsA           ---------------------
2afuA           ---------------------
2afoA           ---------------------