[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for cglu2:BAF55908.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2chpC.bssp"
#ERROR : Can't open dsspfile "2c2jA.bssp"
#ERROR : Can't open dsspfile "2chpA.bssp"
#ERROR : Can't open dsspfile "1dpsD.bssp"
#ERROR : Can't open dsspfile "1dpsB.bssp"
#ERROR : Can't open dsspfile "2chpB.bssp"
#ERROR : Can't open dsspfile "2cf7A.bssp"
#ERROR : Can't open dsspfile "2c2fA.bssp"
#ERROR : Can't open dsspfile "1dpsA.bssp"
#ERROR : Can't open dsspfile "2bw1G.bssp"
#ERROR : Can't open dsspfile "2cf7C.bssp"
#ERROR : Can't open dsspfile "2d5kB.bssp"
#ERROR : Can't open dsspfile "2d5kA.bssp"
#ERROR : Can't open dsspfile "2c41F.bssp"
#ERROR : Can't open dsspfile "2cf7E.bssp"
#ERROR : Can't open dsspfile "2c41C.bssp"
#ERROR : Can't open dsspfile "2cf7B.bssp"
#ERROR : Can't open dsspfile "2c41B.bssp"
#ERROR : Can't open dsspfile "2bjyL.bssp"
#ERROR : Can't open dsspfile "2bk6A.bssp"
#ERROR : Can't open dsspfile "2d5kC.bssp"
#ERROR : Can't open dsspfile "1datA.bssp"
#ERROR : Can't open dsspfile "2c41A.bssp"
#ERROR : Can't open dsspfile "2bjyA.bssp"
#ERROR : Can't open dsspfile "2c41J.bssp"
#ERROR : Can't open dsspfile "2bk6C.bssp"
#ERROR : Can't open dsspfile "2ceiA.bssp"
#ERROR : Can't open dsspfile "3e1qA.bssp"
#ERROR : Can't open dsspfile "2bjyB.bssp"
#ERROR : Can't open dsspfile "2bkcA.bssp"
#ERROR : Can't open dsspfile "3bveA.bssp"
#ERROR : Can't open dsspfile "2cluA.bssp"
#ERROR : Can't open dsspfile "3bveF.bssp"
#ERROR : Can't open dsspfile "3bveE.bssp"
#ERROR : Can't open dsspfile "2bjyH.bssp"
#ERROR : Can't open dsspfile "3bknA.bssp"
#ERROR : Can't open dsspfile "2cf7G.bssp"
#ERROR : Can't open dsspfile "2cn7A.bssp"
#ERROR : Can't open dsspfile "3e6sA.bssp"
#ERROR : Can't open dsspfile "2bkcR.bssp"
#ERROR : Can't open dsspfile "1bcfA.bssp"
#ERROR : Can't open dsspfile "1aewA.bssp"
#ERROR : Can't open dsspfile "3e1nA.bssp"
#ERROR : Can't open dsspfile "3e6sB.bssp"
#ERROR : Can't open dsspfile "2chiA.bssp"
#ERROR : Can't open dsspfile "3e2cA.bssp"
#ERROR : Can't open dsspfile "2clbA.bssp"
#ERROR : Can't open dsspfile "2clbB.bssp"
#ERROR : Can't open dsspfile "2clbD.bssp"

## Summary of PDB Search
:165
    3e-29  25%  2chpC  [x.x.x] METALLOREGULATION DNA-BINDING STRESS PROTEIN
    4e-18  27%  2c2jA  [x.x.x] DNA-BINDING STRESS RESPONSE PROTEIN
    2e-17  25%  2chpA  [x.x.x] METALLOREGULATION DNA-BINDING STRESS PROTEIN
    3e-17  35%  1dpsD  [a.25.1] DPS
    1e-16  36%  1dpsB  [a.25.1] DPS
    4e-16  25%  2chpB  [x.x.x] METALLOREGULATION DNA-BINDING STRESS PROTEIN
    5e-16  25%  2cf7A  [x.x.x] DPR
    1e-15  27%  2c2fA  [x.x.x] DNA-BINDING STRESS RESPONSE PROTEIN
    9e-15  36%  1dpsA  [a.25.1] DPS
    2e-14  24%  2bw1G  [x.x.x] DPS-LIKE PEROXIDE RESISTANCE PROTEIN
    2e-14  25%  2cf7C  [x.x.x] DPR
    6e-14  26%  2d5kB  [x.x.x] DPS FAMILY PROTEIN
    8e-14  26%  2d5kA  [x.x.x] DPS FAMILY PROTEIN
    1e-13  24%  2c41F  [x.x.x] DPS FAMILY DNA-BINDING STRESS RESPONSE PROTEIN
    4e-13  25%  2cf7E  [x.x.x] DPR
    7e-13  22%  2c41C  [x.x.x] DPS FAMILY DNA-BINDING STRESS RESPONSE PROTEIN
    9e-13  26%  2cf7B  [x.x.x] DPR
    1e-12  24%  2c41B  [x.x.x] DPS FAMILY DNA-BINDING STRESS RESPONSE PROTEIN
    1e-12  20%  2bjyL  [x.x.x] NON-HEME IRON-CONTAINING FERRITIN
    1e-12  21%  2bk6A  [x.x.x] NON-HEME IRON-CONTAINING FERRITIN
    2e-12  26%  2d5kC  [x.x.x] DPS FAMILY PROTEIN
    2e-12  13%  1datA  [x.x.x] L FERRITIN
    3e-12  24%  2c41A  [x.x.x] DPS FAMILY DNA-BINDING STRESS RESPONSE PROTEIN
    4e-12  21%  2bjyA  [x.x.x] NON-HEME IRON-CONTAINING FERRITIN
    6e-12  22%  2c41J  [x.x.x] DPS FAMILY DNA-BINDING STRESS RESPONSE PROTEIN
    1e-11  21%  2bk6C  [x.x.x] NON-HEME IRON-CONTAINING FERRITIN
    2e-11  13%  2ceiA  [x.x.x] FERRITIN HEAVY CHAIN
    2e-11  16%  3e1qA  [x.x.x] BACTERIOFERRITIN
    2e-11  20%  2bjyB  [x.x.x] NON-HEME IRON-CONTAINING FERRITIN
    3e-11  21%  2bkcA  [x.x.x] NON-HEME IRON-CONTAINING FERRITIN
    3e-11   8%  3bveA  [x.x.x] FERRITIN
    4e-11  11%  2cluA  [x.x.x] FERRITIN HEAVY CHAIN
    5e-11   9%  3bveF  [x.x.x] FERRITIN
    1e-10   9%  3bveE  [x.x.x] FERRITIN
    1e-10  21%  2bjyH  [x.x.x] NON-HEME IRON-CONTAINING FERRITIN
    2e-10  14%  3bknA  [x.x.x] BACTERIOFERRITIN
    3e-10  25%  2cf7G  [x.x.x] DPR
    6e-10  11%  2cn7A  [x.x.x] FERRITIN HEAVY CHAIN
    6e-10   8%  3e6sA  [x.x.x] FERRITIN
    7e-10  21%  2bkcR  [x.x.x] NON-HEME IRON-CONTAINING FERRITIN
    9e-10  15%  1bcfA  [a.25.1] BACTERIOFERRITIN
    1e-09  13%  1aewA  [x.x.x] FERRITIN
    2e-09  15%  3e1nA  [x.x.x] BACTERIOFERRITIN
    6e-09   8%  3e6sB  [x.x.x] FERRITIN
    8e-09  11%  2chiA  [x.x.x] FERRITIN HEAVY CHAIN
    1e-07  16%  3e2cA  [x.x.x] BACTERIOFERRITIN
    6e-07  16%  2clbA  [x.x.x] DPS-LIKE PROTEIN
    8e-06  16%  2clbB  [x.x.x] DPS-LIKE PROTEIN
    4e-05  16%  2clbD  [x.x.x] DPS-LIKE PROTEIN
:165

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MANYTVPGINENDAKQLIDGLQERLTDYNDLHLILKHVHWNVTGPNFIAVHEMLDPQVDLVRGYADEVAE
2chpC           ------------NQTLVENSLNTQLSNWFLLYSKLHRFHWYVKGPHFFTLHEKFEELYDHAAETVDTIAE
2c2jA           ------------DLKKSVQALQNTLTELQALQLQTKQAHWNVSGTLWYTLHELLQDHYEGISKFADDVAE
2chpA           ----------KTNQTLVENSLNTQLSNWFLLYSKLHRFHWYVKGPHFFTLHEKFEELYDHAAETVDTIAE
1dpsD           NLLYTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
1dpsB           ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
2chpB           ----------KTNQTLVENSLNTQLSNWFLLYSKLHRFHWYVKGPHFFTLHEKFEELYDHAAETVDTIAE
2cf7A           ----------FSPRPDSKAVLNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLAEMSE
2c2fA           ---VNHHYLEEKEFQTVAETLQRNLATTISLYLKFKKYHWDIRGRFFRDLHLAYDEFIAEIFPSIDEQAE
1dpsA           ---YTRNDVSDSEKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALIDHLDTMAE
2bw1G           SPAEIASFSPRPSLADSKAVLNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLDEMSE
2cf7C           --------------ADSKAVLNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLAEMSE
2d5kB           -----------SNQQDVVKELNQQVANWTVAYTKLHNFHWYVKGPNFFSLHVKFEELYNEASQYVDELAE
2d5kA           ------------NQQDVVKELNQQVANWTVAYTKLHNFHWYVKGPNFFSLHVKFEELYNEASQYVDELAE
2c41F           ----------TTLKEQVLTTLKREQANAVVMYLNYKKYHWLTYGPLFRDLHLLFEEQGSEVFAMIDELAE
2cf7E           --------------ADSKAVLNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLAEMSE
2c41C           ----------TTLKEQVLTTLKREQANAVVMYLNYKKYHWLTYGPLFRDLHLLFEEQGSEVFAMIDELAE
2cf7B           ---------------DSKAVLNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLAEMSE
2c41B           ------------LKEQVLTTLKREQANAVVMYLNYKKYHWLTYGPLFRDLHLLFEEQGSEVFAMIDELAE
2bjyL           ------------NSVDTKEFLNHQVANLNVFTVKIHQIGWYMRGHNFFTLGEKMDDLYSEFGEQMDEVAE
2bk6A           ---------------DTKEFLNHQVANLNVFTVKIHQIGWYMRGHNFFTLHEKMDDLYSEFGEQMDEVAE
2d5kC           -----------SNQQDVVKELNQQVANWTVAYTKLHNFHWYVKGPNFFSLHVKFEELYNEASQYVDELAE
1datA           --------IRQNYSTEVEAAVNRLVNLYLRASYTYLSFYFDRDDVALEGVCHFFRELAEEKREGAERLLK
2c41A           ----------TTLKEQVLTTLKREQANAVVMYLNYKKYHWLTYGPLFRDLHLLFEEQGSEVFAMIDELAE
2bjyA           ----------------TKEFLNHQVANLNVFTVKIHQIGWYMRGHNFFTLGEKMDDLYSEFGEQMDEVAE
2c41J           ------------LKEQVLTTLKREQANAVVMYLNYKKYHWLTYGPLFRDLHLLFEEQGSEVFAMIDELAE
2bk6C           ------------NSVDTKEFLNHQVANLNVFTVKIHQIGWYMRGHNFFTLHEKMDDLYSEFGEQMDEVAE
2ceiA           --------VRQNYHQDSEAAINRQINLYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMK
3e1qA           -----------KGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIE
2bjyB           --------------VDTKEFLNHQVANLNVFTVKIHQIGWYMRGHNFFTLGEKMDDLYSEFGEQMDEVAE
2bkcA           ---------------DTKEFLNHQVANLNVFTVKIHQIHWYMRGHNFFTLGEKMDDLYSEFGEQMDEVAE
3bveA           ------HSQDPMLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLII
2cluA           --------VRQNYHQDSEAAINRQINLYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMK
3bveF           ---------DPMLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLII
3bveE           --------QDPMLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLII
2bjyH           ----------------TKEFLNHQVANLNVFTVKIHQIGWYMRGHNFFTLGEKMDDLYSEFGEQMDEVAE
3bknA           -----------QGDPDVLKLLNEQLTSELTAINQYFLHSKMQDNWGFTELAEHTRAESFEEMRHAETITD
2cf7G           --------------ADSKAVLNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLAEMSE
2cn7A           --------VRQNYHQDSEAAINRQINLLYASYVYLSMSYFDRDDVALKNFAKYFLHQSHEEREHAEKLMK
3e6sA           -------------SEELLDLFNRQVTQEFTASQVYLSASIWFDQNDWEGMAAYMLAESAEEREHGLGFVD
2bkcR           -----------------KEFLNHQVANLNVFTVKIHQIHWYMRGHNFFTLGEKMDDLYSEFGEQMDEVAE
1bcfA           -----------KGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIE
1aewA           --------IRQNYSTEVEAAVNRLVNLLRASYTYLSLFYFDRDDVALEGVCHFFRELAEEKREGAERLLK
3e1nA           -----------KGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIE
3e6sB           -------------SEELLDLFNRQVTQEFTASQVYLSASIWFDQNDWEGMAAYMLAESAEEREHGLGFVD
2chiA           --------VRQNYHQDSEAAINRQINLDLYASYVYLSMYFDRDDVALKNFAKYFLHQSHEEREHAEKLMK
3e2cA           -----------KGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIE
2clbA           --------------------------------------HLTGEGE----GLKEIAEDARLEDRLHFELTQ
2clbB           -------------------------------------------------GLKEIAEDARLEDRLHFELTQ
2clbD           -------------------------------------------------GLKEIAEDARLEDRLHFELTQ


                         .         .         *         .         .         .         .:140
query           RISTLGGAPVGTPEGHVADRTPLQYERNAGNAQAHLTDLNRVYTQVLTGVRESMASAGPVDPVTEDIYIG
2chpC           RLLAIGGQPVATVKE-YTEHASITDGGNETSASEMVQALVNDYKQISSESKFVIGLAEENDNATADLFVG
2c2jA           RQLSVGASSDGRAITIVAASRLPEIPGGFLDDAQVIQFFTYQYETVGQRIHQRVGDVEKVDPTTANLLQE
2chpA           RLLAIGGQPVATVKEY-TEHASITDGGNETSASEMVQALVNDYKQISSESKFVIGLAEENDNATADLFVG
1dpsD           RAVQLGGVALGTTQVINSKTPLKSYPLDIHNVQDHLKELADRYAIVANDVRKAIGEAK--DDDTADILTA
1dpsB           RAVQLGGVALGTTQVINSKTPLKSYPLDIHNVQDHLKELADRYAIVANDVRKAIGEAK--DDDTADILTA
2chpB           RLLAIGGQPVATVKEY-TEHASITDGGNETSASEMVQALVNDYKQISSESKFVIGLAEENDNATADLFVG
2cf7A           RLITLGGAPFSTLKEFSENSQLKEVLGDYNTIEEQLARVVEVFRYLAALFQKGFDVSDEGDSVTNDIFNV
2c2fA           RLVALGGSPLAAPADLARYSTVQVPQETVRDARTQVADLVQDLSRVGKGYRDDSQACDEADPVTADMYNG
1dpsA           RAVQLGGVALGTTQVINSKTPLKSYPLDIHNVQDHLKELADRYAIVANDVRKAIGEAK--DDDTADILTA
2bw1G           RLITLGGAPFSTLKEFSENSQLKEVLGDYVTIEEQLARVVEVFRYLAALFQKGFDVSDEGDSVTNDIFNV
2cf7C           RLITLGGAPFSTLKEFSENSQLKEVLGDYVTIEEQLARVVEVFRYLAALFQKGFDVSEEGDSVTNDIFNV
2d5kB           RILAVGGNPVGTLTECLEQSIEAAKGYSAEQMVEELSQDFTNISKQLENAIEIAGNAG--DDVSEDMFIG
2d5kA           RILAVGGNPVGTLTECLEQSIEAAKGYSAEQMVEELSQDFTNISKQLENAIEIAGNAG--DDVSEDMFIG
2c41F           RSLMLDGQPVADPADYLKVATPSSGQLTVKQMIEEAIANHELIITEMHQDAEIATEAG--DIGTADLYTR
2cf7E           RLITLGGAPFSTLKEFSENSQLKEVLGDYVTIEEQLARVVEVFRYLAALFQKGFDVSDEGDSVTNDIFNV
2c41C           RSLMLDGQPVADPADYLKVAT-VTPSSGQLTVKQMIEEAIANHELIITEMHQDAEIAEAGDIGTADLYTR
2cf7B           RLITLGGAPFSTLKEFSENSQLKEVLGDYNTIEEQLARVVEVFRYLAALFQKGFDVSDEGDSVTNDIFNV
2c41B           RSLMLDGQPVADPADYLKVATPSSGQLTVKQMIEEAIANHELIITEMHQDAEIATEAG--DIGTADLYTR
2bjyL           RLLAIGGSPFSTLKEFLENASVEEAPYTKKTMDQLMEDLVGTLELLRDEYKQGIELTDEGDDVTNDMLIA
2bk6A           RLLAIGGSPFSTLKEFLENASVEEAPYTKKTMDQLMEDLVGTLELLRDEYKQGIELTDEGDDVTNDMLIA
2d5kC           RILAVGGNPVGTLTECLEQSIEAAKGYSAEQMVEELSQDFTNISKQLENAIEIAGNAG--DDVSEDMFIG
1datA           MQNQRGGRALFQDLQKPSQDEW----GTTPDAMKAAIVLEKSLNQALLDLHALGSAQA--DPHLCDFLES
2c41A           RSLMLDGQPVADPADYLKVATPSSGQLTVKQMIEEAIANHELIITEMHQDAEIATEAG--DIGTADLYTR
2bjyA           RLLAIGGSPFSTLKEFLENASVEEAPYTKPTMDQLMEDLVGTLELLRDEYKQGIELTDEGDDVTNDMLIA
2c41J           RSLMLDGQPVADPA-DYLKVATVTPSSGQLTVKQMIEEAIANHELIITEMHQDAEIAEAGDIGTADLYTR
2bk6C           RLLAIGGSPFSTLKEFLENASVEEAPYTKPTMDQLMEDLVGTLELLRDEYKQGIELTDKEDDVTNDMLIA
2ceiA           LQNQRGGRIFLQDIQKP----DCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKN--DPHLCDFIET
3e1qA           RILFLEGLPNLQ------DLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVH--DYVSRDMMIE
2bjyB           RLLAIGGSPFSTLKEFLENASVEEAPYTKKTMDQLMEDLVGTLELLRDEYKQGIELTKEGDDVTNDMLIA
2bkcA           RLLAIGGSPFSTLKEFLENASVEEAPYTKPTMDQLMEDLVGTLELLRDEYKQGIELTDEGDDVTNDMLIA
3bveA           FLNENNVPVQLTS-----ISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSK--DHATFNFLQW
2cluA           LQNQRGGRIFLQDIQK-------PDCDDWESGLNAMECALHLDKNVNQSLLELHKLATDKDPHLCDFIET
3bveF           FLNENNVPVQLTS-----ISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSK--DHATFNFLQW
3bveE           FLNENNVPVQLTSIS-----APEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSK--DHATFNFLQW
2bjyH           RLLAIGGSPFSTLKEFLENASVEEAPYTPKTMDQLMEDLVGTLELLRDEYKQGIELTDEGDDVTNDMLIA
3bknA           RILLLDGLPNYQRLFS-----LRVGQTLREQFEADLAIEYEVLERLKPGIVLCREKQ---DATSARLLEQ
2cf7G           RLITLGGAPFSTLKEFSENSQLKEVLGDYNTIEEQLARVVEVFRYLAALFQKGFDVSEEGDSVTNDIFNV
2cn7A           LQNQRGGRIFLQDIQK-------PDCDDWESGLNAMECALHLDKNVNQSLLELHKLATDKDPHLCDFIET
3e6sA           FANKRNIPIELQ---AVPAPVSCAEWSSPEDVWQSILELEQANTRSLLNLAEAASTCH--DFAVMAFLNP
2bkcR           RLLAIGGSPFSTLKEFLENASVEEAPYTKPTMDQLMEDLVGTLELLRDEYKQGIELTDEGDDVTNDMLIA
1bcfA           RILFLEGLPNLQD------LGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVH--DYVSRDMMIE
1aewA           MQNQRGGRALFQDLQKP----SQDEWGTTPDAMKAAIVLEKSLNQALLDLHALGSAQA--DPHLCDFLES
3e1nA           RILFLEGLPNLQ------DLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVH--DYVSRDMMIE
3e6sB           FANKRNIPI---ELQAVPAPVSCAEWSSPEDVWQSILELEQANTRSLLNLAEAASTCH--DFAVMAFLNP
2chiA           LQNQRGGRIFLQDIQK-----PDCDDWE--SGLNAMECALHLEKNVNQSLLELHKLATDKDPHLCDFIET
3e2cA           RILFLEGLP---------NLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVDYVSRDMMIE
2clbA           RIYELGGGLPRDIRQLADISACSDLPENWKDPKEILKVLLEAEQCAIRTWKEVCDTY-GKDPRTYDLAQR
2clbB           RIYELGGGLPRDIRQLADISACSDLPENWKDPKEILKVLLEAEQCAIRTWKEVCDTYGK-DPRTYDLAQR
2clbD           RIYELGGGLPRDIRQLADISACSDLPENWKDPKEILKVLLEAEQCAIRTWKEVCDTYGK-DPRTYDLAQR


                         +         .         .         .         .         *         .:210
query           QAAELEKFQWFIRAHIVDVDGNIQE
2chpC           LIEEVEKQVWMLSSYL---------
2c2jA           VEHIIEKYQWQMRAFL---------
2chpA           LIEEVEKQVWMLSSYL---------
1dpsD           ASRDLDKFLWFIECNI---------
1dpsB           ASRDLDKFLWFIECNI---------
2chpB           LIEEVEKQVWMLSSYL---------
2cf7A           AKASIEKHIWMLQAEL---------
2c2fA           YAATIDKIRWMLQAIM---------
1dpsA           ASRDLDKFLWFIECNI---------
2bw1G           AKASIEKHIWMLQAEL---------
2cf7C           AKASIEKHIWMLQAEL---------
2d5kB           MQTSVDKHNWMFKSYL---------
2d5kA           MQTSVDKHNWMFKSYL---------
2c41F           LVQTHQKHRWFLKEFL---------
2cf7E           AKASIEKHIWMLQAEL---------
2c41C           LVQTHQKHRWFLKEFL---------
2cf7B           AKASIEKHIWMLQAEL---------
2c41B           LVQTHQKHRWFLKEFLAKGDGLV--
2bjyL           FKASIDKHIWMFKAFL---------
2bk6A           FKASIDKHIWMFKAFL---------
2d5kC           MQTSVDKHNWMFKSYL---------
1datA           HLDEEVKLIKKMGDHL---------
2c41A           LVQTHQKHRWFLKEFL---------
2bjyA           FKASIDKHIWMFKAFL---------
2c41J           LVQTHQKHRWFLKEFL---------
2bk6C           FKASIDKHIWMFKAFL---------
2ceiA           HLNEQVKAIKELGDHV---------
3e1qA           ILRDEEGHIDFLETELMGLQNYLQA
2bjyB           FKASIDKHIWMFKAFL---------
2bkcA           FKASIDKHIWMFKAFL---------
3bveA           YVAEQHEEEVLFKDIL---------
2cluA           HLNEQVKAIKELGDHV---------
3bveF           YVAEQHEEEVLFKDIL---------
3bveE           YVAEQHEEEVLFKDIL---------
2bjyH           FKASIDKHIWMFKAFL---------
3bknA           ILADEETHIDYLETQL---------
2cf7G           AKASIEKHIWMLQAEL---------
2cn7A           HLNEQVKAIKELGDHV---------
3e6sA           FHLQQVNEEDKIGSIL---------
2bkcR           FKASIDKHIWMFKAFLGKAPL----
1bcfA           ILRDEEGHIDWLETEL---------
1aewA           HLDEEVKLIKKMGDHL---------
3e1nA           ILRDEEGHIDWLETEL---------
3e6sB           FHLQQVNEEDKIGSIL---------
2chiA           HLNEQVKAIKELGDHVTN-------
3e2cA           ILRDERGHIDWLRTEL---------
2clbA           ILQEEIEHEAWFLELL---------
2clbB           ILQEEIEHEAWFLELLYGR------
2clbD           ILQEEIEHEAWFLELLYGR------