[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF52967.1

[Show Plain Result]


## Summary of Sequence Search
    1::684
    1::167     8e-51  54%  169 aa  PF00204 DNA_gyraseB "DNA gyrase B"
    4::64      2e-17  62%   65 aa  PF00986 DNA_gyraseB_C "DNA gyrase B subunit, carboxyl terminus"
    1::105     1e-14  45%  110 aa  PF01751 Toprim "Toprim domain"
   52::110     1e-04  39%  147 aa  PF04268 SoxG "Sarcosine oxidase, gamma subunit family "
    1::684

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVDNSVDEAMAGHATKVEVTLLEXXX
PF00204         ----------------------------------------------------------------------
PF00986         ----------------------------------------------------------------------
PF01751         ----------------------------------------------------------------------
PF04268         ---------------------------------------------LEAALAEALAGHASVVDVTVLELSG


                         .         .         *         .         .         .         .:140
query           XXXXXXXRGIPVDMHPSGAPTVQVVMTQLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00204         ----------------------------------------------------------------------
PF00986         ----------------------------------------------------------------------
PF01751         ----------------------------------------------------------------------
PF04268         PRARDVLKGCPVDLHPRAFPPGQAARTSL-----------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00204         ----------------------------------------------------------------------
PF00986         ----------------------------------------------------------------------
PF01751         ----------------------------------------------------------------------
PF04268         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGLEDYVQYLNRSKTNI
PF00204         ------------------------------------------------------GIKDFVEYLNKNKTPL
PF00986         ----------------------------------------------------------------------
PF01751         ----------------------------------------------------------------------
PF04268         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           HPSIVSFEAKGDDHEVEVAMQWNSSYKESVHTFANTINTREGGTHEEGFRSALTSLMNRYAREHKLLKEK
PF00204         HPEVFYFEGEKDGIEVEVALQWNDGYGENIYSFVNNIPTTDGGTHVAGFRDALTRTLNEYAKKKNLLK-K
PF00986         ----------------------------------------------------------------------
PF01751         ----------------------------------------------------------------------
PF04268         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           EANLTGDDCREGLSAVISVRVGDPQFEGQTKTKLGNTEIKSFVQRMANEHIGHWLEANPAEAKVIINKAV
PF00204         GKNLTGDDIREGLTAVVSVKVPEPQFESQTKEKLGSSEVKSAVEQVVSEKLDKYLLENPEIAKAILEKAI
PF00986         ----------------------------------------------------------------------
PF01751         ----------------------------------------------------------------------
PF04268         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GSAQARLAARKAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSELYIVEGDSAGGSAKSGRDSMFQAILPL
PF00204         DAARAREAARKA----------------------------------------------------------
PF00986         ----------------------------------------------------------------------
PF01751         -----------------------------------------SELVIVEGPSDAKSIAQGKNYLVTALL--
PF04268         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           RGKILNVEKARLDKVLKNAEVQAIITALGTGIHDEFDINKLRYHKIVLMADADVDGQHIATLLLTLLFRF
PF00204         ----------------------------------------------------------------------
PF00986         ----------------------------------------------------------------------
PF01751         -GHLLNLEKADFYKRWLPTALPQPIGSVGPGKGKIFDLLKLRAHKIIIATDADREGEHIATLLLTFFYRY
PF04268         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           MPDLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKDDGIQRYKGLGEMNASEL
PF00204         ----------------------------------------------------------------------
PF00986         ---------------------------------------------------KKPNIQRFKGLGEMNPEQL
PF01751         MPEI------------------------------------------------------------------
PF04268         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           WETTMDPTVRILRRVDITDAQRADELFSILMGDDVVARRSFIxxxxxxxxxxxx
PF00204         ------------------------------------------------------
PF00986         WETTMDPETRRLLQVTIDDAAEADELFDMLMGKKVEPRREFI------------
PF01751         ------------------------------------------------------
PF04268         ------------------------------------------------------