[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF52976.1

[Show Plain Result]


## Summary of Sequence Search
    1::398
  177::322     3e-07  34%  429 aa  PF00324 AA_permease "Amino acid permease"
    1::398

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00324         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxFFVPGIGVLLAFSIAAFMGFESGAIYSEETKDPSKTVSRATYIAVGIIAIFYAAST
PF00324         --------------FFPPGLGFLAALAIAAFTGFEAVATAAEEAKNPKKNIPRAIILSLLIILVLYILVI


                         +         .         .         .         .         *         .:210
query           WALAMGVGPSAIIDESRIYGPDLVFVWLASFSPALSNVAHLLFVTSIXXXXXXXXXXXXRYFFALGRSKV
PF00324         LALG-GVVPYALLAGSATASP-FVIAFQAAGGPWAASIINAGILISALSSLNSSLYAASRMLYALARDGL


                         .         .         .         +         .         .         .:280
query           IPSVFGKLGKNGAPIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00324         LPKFFAKHNKRGVPV-------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00324         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00324         ------------------------------------------------