[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF53009.1

[Show Plain Result]


## Summary of Sequence Search
    1::190
    4::148     6e-30  52%  151 aa  PF00160 Pro_isomerase "Cyclophilin type peptidyl-prolyl cis-trans
    1::190

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxLHTNRGDITIDLFGNHAPETVANFVGLAQGTKEYQAQNAQGDSEG
PF00160         -------------------------IETNLGRIVIELFPDVAPKTVENFLKLCK--------------EG


                         .         .         *         .         .         .         .:140
query           PFYNGSVFHRVIDGFMIQXXXXXXXXXXXXXYTFADEFHPELRFDRAYLLAMANAGPGTNGSQFFITVTP
PF00160         -FYDGTIFHRVIKGFMIQGGDPTGGGGGTGSIPFPDEFSFKLKHKRG-TLSMANAGPNTNGSQFFITLGD


                         +         .         .         .         .         *         .:210
query           TPHLNNAHTIFGEVTDAESQKVVDAIATTATDRYDRPADAVVIESxxxxx
PF00160         TPHLDGKHTVFGRV--VEGMDVVDKIEAVPTDENDRPLEDVVILS-----