[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF53177.1

[Show Plain Result]


## Summary of Sequence Search
    1::136
    1::114     7e-38  66%  116 aa  PF02261 Asp_decarbox "Aspartate decarboxylase"
    1::136

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLRTILGSKIHRATVTQADLDYVGSVTIDADLVHAAGLIEGEKVAIVDITNGARLETYVIVGDAGTGNIC
PF02261         MLRTMLKSKIHRATVTEADLNYEGSITIDEDLLDAAGILENEKVQIVNVNNGARFETYVIPGERGSGVIC


                         .         .         *         .         .         .         .:140
query           INGAAAHLINPGDLVIIMSYLQATDAEAKAYEPKIVHVDADNRIxxxxxxxxxxxxxxxxxxxxxx
PF02261         LNGAAARLVQPGDLVIIAAYAQMDEEEAKTHKPKVVFVDEDNRI----------------------