[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF53395.1

[Show Plain Result]


## Summary of Sequence Search
    1::188
    2::37      4e-06  50%   37 aa  PF05901 Excalibur "Excalibur calcium-binding domain"
    1::188

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05901         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05901         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxYKNCTEVWNVLGRSIRQGEPGYGTHLDRDRDGIGCExxxx
PF05901         --------YKNCKAMRSAGEAGVYRGDPGYSPHLDRDGDGIACE----