[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF53422.1

[Show Plain Result]


## Summary of Sequence Search
    1::100
    1::77      1e-16  60%   84 aa  PF02583 DUF156 "Uncharacterised BCR, COG1937"
    1::100

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxIEEKQRYLARLKRIEGQTRGIHRMIDEEQYCIDILTQISAVNSALKNVAFGLLDDHLAH
PF02583         -----------IEEKKKLLNRLKRIEGQVRGIERMIEEDRYCIDILTQIAAVRSALDRAGKEVLEEHLRH


                         .         .         *         .         .         .         .:140
query           CVKEAADLGGDELDAKLKEVxxxxxxxxxx
PF02583         CVVEAIESG--EREEKIEEL----------