[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cglu2:BAF53444.1

[Show Plain Result]


## Summary of Sequence Search
    1::302
   20::277     1e-34  41%  283 aa  PF02541 Ppx-GppA "Ppx/GppA phosphatase family"
   26::166     8e-04  29%  553 aa  PF02286 Dehydratase_LU "Dehydratase large subunit"
    1::302

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxLRLVELLDDSGAISEKGINKLTSAVGEAADLAKTLGCAELMP
PF02541         ----------------------------VRLGEGLDATGRLSEEAIERALAALKRFAEILRDYGVENIRA
PF02286         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FATSAVRSATNSEAVLDHVEEETGVRLSILSGEDEARQTFLAVRRWYGWSAGRITNLDIGGGSLELSSGT
PF02541         VATSALRDAKNADEFLDRVEKETGLPVEVISGEEEARLIYLGVASTLA-DDGRGLVVDIGGGSTELVLGD
PF02286         -------------------------------------------------------------GLIAMESPN


                         +         .         .         .         .         *         .:210
query           DESPDLAFSLDLGAGRLTHNWFDTDPPARKKINLLRDYIDAELAEPARQMRTLGPARLAVGTSKTFRTLA
PF02541         GGEVKAAESLPLGAVRLTERFFKDDPPTAEEFAAAREAIREELAELAREVRKGGWVR-AVGTSGTITALA
PF02286         DPKP----SIKIENGKVV----ELDGKPRADFDLIDHFINLERAEEAMAMDSLKIARMLVDPNVSREEIV


                         .         .         .         +         .         .         .:280
query           RLTGAAPSSAGPHVTRTLTAPGLRQLIAFISRMTAADRAELEGISSDRSHQIVAGALVAEAAMRALDIDK
PF02541         ELLLA----HGRYGYR-LTREDLEELIERLLKMSREERAKIPGLSPDRADVIPAGAAILEAIFEALGIEE
PF02286         RLTTATPAKIVEVVSHMNVVEMMMAMQKMRARRTPSNQAHVTNV-KDNPVQIAADA--AEAALRGFD---


                         .         *         .         .         .         .         +:350
query           VEICPWALREGVIxxxxxxxxx
PF02541         LIVSDGGLREGLL---------
PF02286         ----------------------